CN1459458A - Testes spermatogenous cell die related gene - Google Patents
Testes spermatogenous cell die related gene Download PDFInfo
- Publication number
- CN1459458A CN1459458A CN02114137A CN02114137A CN1459458A CN 1459458 A CN1459458 A CN 1459458A CN 02114137 A CN02114137 A CN 02114137A CN 02114137 A CN02114137 A CN 02114137A CN 1459458 A CN1459458 A CN 1459458A
- Authority
- CN
- China
- Prior art keywords
- testes
- mouse
- tsarg1
- genes
- related gene
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Abstract
A kind of testicular spermatogonium withering associated gene including 4 such genes (TSARG1, TSARG2, TSARG3 and TSARG4) for man and 2 such genes (Tsarg1 and Tsarg2) for mouse is obtained through using mouse as type to create its testicular withering model, cloning the EST associated with mouse's spermatogonium withering by SSH technique, and jointly cloning the said testicular spermatogonium wither associated genes by the molecular biological technique and the biological information technology. It can be used for preparing the medicine to diagnose and treat the male sterility and the contraceptive.
Description
Technical field: the present invention relates to the biotechnology gene, particularly the testes spermatogenous cell die related gene in healthy reproduction field.
Background technology: at present, the healthy reproduction field is international research focus, along with the smooth implementation of the Human Genome Project and finishing of human genome sketch, the genetics research of male reproductive health and male sterility has become the key subjects in the genetics research field.According to medical statistics, the sterile of 10-15% arranged among the couple at child-bearing age approximately, one of them important reasons is a bridegroom's or husband's side dyszoospermia, show as do not have smart or serious few smart (＜200 ten thousand/ml), account for sterile man 10%.The apoptosis of androgone is a spermatogenetic inverse process, mainly occurs in the testis.Human testicle is a kind of tissue with height multiplication capacity, but the quantity of the mature sperm that produces in the testis of growing up is than estimating that the sperm count that generates lacks 20-75%.Studies show that in a large number this spontaneous degeneration of androgone taken place by apoptosis in the testis, find also that simultaneously the sperm abnormal apoptosis increases in the sterile male sex, therefore, the disorder of apoptosis regulation also is an important determinative of the special property sent out male infertility.Known in the world at present testes spermatogenous cell die related gene has Bcl-2/Bax gene cluster, Fas/Apo-1 gene, HSP gene cluster, iNOS gene, TRAIL and acceptor gene, TR2 gene etc., but does not up to the present still have specific testes spermatogenous cell die related gene in the world.
Summary of the invention: the objective of the invention is to research, clone specific testes spermatogenous cell die related gene.
Technical solution of the present invention is from the little musculus cdna of model animals, or set up the cryptorchidism apoptosis model of mouse from the model animals mouse after, again by suppressing the relevant EST of subtractive hybridization (SSH) technology clone mouse apoptosis of spermatogenic cells, further utilization Protocols in Molecular Biology and biology information technology clone specific 4 human testes spermatogenous cell die related gene (TSARG1 altogether, TSARG2, TSARG3, TSARG4) and 2 spermatogenic cells of mouse testis apoptosis-related genes (Tsarg1, Tsarg), all land genebank and also obtained to land sequence number (still unexposed).
Embodiment: obtaining 4 human testes spermatogenous cell die related genes according to aforementioned techniques solution of the present invention is TSARG1, TSARG2, TSARG3, TSARG4, and 2 spermatogenic cells of mouse testis are apoptosis-related because Tsarg1, Tsarg.
The invention has the advantages that take the present invention can further study as the basis gene expression product---testis withers The die function of relevant protein, the crystallography structure of research protein is determined the relation of its structure and function, thereby For the development of the diagnosis of male sterility and treatment, novel contraceptive medicine provides the candidate target.
Claims (6)
1, testis spermatogenic cell apoptosis-related genes; TSARG1,：1 aacattttca ccaagggaaa caagttatga ccatgattac gccaaggctt gaatggatgc61 aggtcgaatt ttagattgaa gggatccaga tctccagtct ttactcaata tagggatcga121 gcgtccgccc gggcaggtaa ggctcctagg gcagagggca aacggcccct ccaggaggga181 gccgggagat tacgcagctc catgtaggtc cacgtttagg ttgggaggat ctaccatgaa241 gaaggtcaag aagaaaaggt cagaggccag acgccaccga gactccacct cccagcatgc301 tagctccaat tccacctctc agcagcctag tcctgaatcc acaccacagc agcctagccc361 tgaatccaca ccacagcatt ccagccttga aaccacctcc cggcagccag cattccaagc421 ccttccagca cccgaaatcc gccgctcctc ttgctgcctt ttatctccag atgctaacgt481 gaaggcagcc cctcaatcca ggaaagcagg gcctctgatt cgcgccggcc cgcattcctg541 ctcctgtgcc acttgcccct gcagctccgc ttgctggcgt cgtctggggc tatgccatag601 ccgcatcttc gatgtccttc tgcctcggga ctggcagatg gcgccaggga gaggactccc661 caacctgctc accttctaca gaaaatcttc aagaaaaccc tccagtcatc gtaacgcgtg721 tcctccaagc cctcggaact gtggctgtgg ctctgggggc tctaggagct gcctactaca781 tcactgaatc cttgtgaaca agcccctagg cccacagtct ggcagacctc caccagcccc841 aggagttgat aggtgatggc gctgggagaa gatgttcaga atatctcaaa agccaagtcc901 agaagatcca gtttccatca aagggacctc tcttgtcacc aaaatttaaa aaaagaaaaa961 aaaaacgaaa aaa：MKKVKKKRSEARRHRDSTSQHASSNSTSQQPSPESTPQQPSPESTPQHSSLETTSRQPAFQALPAPEIRRSSCCLLSPDANVKAAPQSRKAGPLIRAGPHSCSCATCPCSSACWRRLGLCHSRIFDVLLPRDWQMAPGRGLPNLLTFYRKSSRKPSSHRNACPPSPRNCGCGSGGSRSCLLHH
2, testis spermatogenic cell apoptosis-related genes; TSARG2,： 1 gcgctgaggt ctcgccccat aagactccgc cccgccccac gaggccgcgc cgccagcaat 61 aaggcccagc cccgccttct gctgttgccg cagcaaccca gaaagcgtca tggctgccgc 121 cggccaggaa aaagggtatt tgacacagac tgcggcagcc ctagacaagt caccgtcact 181 ttcgccacag ctagcagctc ccatccgagg gaggcctaag aagtgtctgg tctatccgca 241 tgcgccgaag agctcccgct tgtctcgttc cgttctgcgt tggcttcagg gtctggatct 301 cagcttcttc cccaggaaca tcaacagaga tttttcaaat ggcttcctaa ttgcagaaat 361 attctgtata tattacccct gggaacttga attatcatcc tttgaaaacg ggacctcttt 421 aaaagtcaag ttggataact gggcacagtt ggagaagttc ctggcaagaa aaaaatttaa 481 attacctaaa gaactaatcc atggaacaat tcattgtaaa gctggagtgc ctgaaatatt 541 gatagaagag gtttacactt tattaacaca tcgagaaatt aaaagtatcc aggatgactt 601 tgtgaatttc acggactata gctaccagat gcgtttaccc ctggtttcca ggtctacagt 661 ttcgaagtct attaaagata acattaggtt atcagaatta ctaagcaatc ccaacatgct 721 gaccaatgaa cttaaagcgg agttcctcat ccttttacat atgttgcaaa gaaaattagg 781 cagaaaattg aatccagaat ggtttgatgt gaaaccaaca gtgggagaag ttactctcaa 841 tcaccttcct gcccaagcct ctgggcgcag atataattta aaagttaaaa gaggaagagt 901 tgtccctgtt ttaccaaata taggtagtgg tggcagttca catagagaaa tacatgtgaa 961 gcaagctgga caacattctt attactctgc tatgaaacct atcagaaaca tggacaagaa1021 accttgaaaa gcacctgtca aatggctttg aagaagtgat gccaccatct ctagccataa1081 taaagaaaca gaatcaccta gtattggatg tatttcaata ataaatagag tggtgtcttt1141 tccataattg tgttaaagaa catttctttt ccattcaatt tgtttattaa actcctatgc1201 caggcattgt tgaaaataca aaattaaata aat：MAAAGQEKGYLTQTAAALDKSPSLSPQLAAPIRGRPKKCLVYPHAPKSSRLSRSVLRWLQGLDLSFFPRNINRDFSNGFLIAEIFCIYYPWELELSSFENGTSLKVKLDNWAQLEKFLARKKFKLPKELIHGTIHCKAGVPEILIEEVYTLLTHREIKSIQDDFVNFTDYSYQMRLPLVSRSTVSKSIKDNIRLSELLSNPNMLTNELKAEFLILLHMLQRKLGRKLNPEWFDVKPTVGEVTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHREIHVKQAGQHSYYSAMKPIRNMDKKP
3, testis spermatogenic cell apoptosis-related genes; TSARG3,： 1 tgtagctgga ggacaggaaa tagatcttta ttatgtcagt ttaagccctg cgccatccca 61 cccttgtatc atatctgtgc agcaggctcc cctgcacacc ctgaggctgt ggcgggtagg 121 ggtggggtga ggcccggcta gcctcctctc acccctgctc cagcccacca cagtcatgtc 181 agcaatgcct ggcgcagcat ctgcttcttc tggggtgtga ggcgggtggg gaactggatg 241 tcgaagaaga tgaagagatc ccctttctta gtggggtcct ccggcaatgg catcccctcc 301 cctggcacct tcttgaagta tttggggtgg atgatgtcat tgatggggat gttgagcaga 361 cggtcatcta gggtcctcac ctccacagtg cagcaggtga gagccttgcc aagagggatg 421 gggttcacga agaagaggtt gtcattctcc ctgcggaagc gagggtgtag cttctccttt 481 acgatgaaaa tgatgtctgc tgggatgatg ttggggccct ggtccccttc cttctcaaag 541 gtgatgcgtg tgccctgcct ccaaccgggc ttcacatcaa tggtcaggat cttgtccttg 601 atggtggagg agtacccatc ctcgttcagc acccttctgg agatcttaat ttttttggtg 661 cagccaaaga ataagtcctc cagggacagg tagagatccc gttcgacttg ggggtcctgc 721 ttcttgaccc ctcggccctg gagcccccca aagttcaaat ctacctcact tccttctgca 781 tcaaaaaact ctgcaggagg aaaggaggca ctccctctgg tggccgcgct caggagtgcc 841 agaagagact gctggtagtc ctcggcagga agtgcaaaga cagccccatc ctggctctgc 901 ccctgatgtg ctgtgtgatc cgtgggcttc agtgtcttgg tctgtgggat ggggtaataa 961 tgcctgacct gccttccacc attaagatga agagctaaaa cttgctgaga gcttactatg1021 cgtcaggtgc tatttttgga accttacatt attatttcat tggtccaggg agcccaaaca1081 aaacgcttaa ggtcccgtag ctagtaagca gtagagttgg gatctgaacc acaggacaat1141 atgactacgg aacctgtgtc cttaaccact gtgccacgcc gcatcgctag atgtggaagc1201 ccctcataag ctgtaaactc gaggggcgct atggttaaga gttttcatat tctgcctctc1261 atggttaatg ccatggaata aacttcacag gctagaatgg tgaaatgacc ttaggcaggg1321 atggtgaggt gactacacta tgtccctcta agatgcgatg ggcaatcaag aggcctgaat1381 cttctggtcc tcctgttgca ttgctgaatt cMSKKMKRSPFLVGSSGNGIPSPGTFLKYLGWMMSLMGMLSRRSSRVLTSTVQQVRALPRGMGFTKKRLSFSLRKRGCSFSFTMKMMSAGMMLGPWSPSFSKVMRVPCLQPGFTSMVRILSLMVEEYPSSFSTLLEILIFLVQPKNKSSRDR
4, testis spermatogenic cell apoptosis-related genes; TSARG4,： 1 acttttcagg ggacattcag aggcatcagc cccttcctcc tcaccagctc ccagagttcc 61 catctccatc cccaatccta aagaaggaaa tcgatgccac ggtcctcaag gagccctggg121 gacccaggcg ccctactcga agatgtggcc cacaatccca gaccccggag gattgcccag181 cgaggccgga acaccagcag gatggcagag gacacctccc caaacatgaa tgacaacatc241 ctgttgcctg tccgcaacaa tgaccaagcc ctaggcctga ctcagtgcat gctgggatgt301 gtgtcctggt tcacctgttt tgcctgctcc ctgagaactc aggcccagca ggttctgttt361 aacacgtgca gatgcaagct gctgtgccag aagctcatgg agaagacagg cattctgctc421 ctctgtgctt tcggattctg gatgttttct attcacttac catcgaaaat gaaagtctgg481 caggatgaca gcataaatgg tccactgcag agcttgaggt tgtaccagga gaaggtgcga541 catcacagtg gggaaatcca ggacctccga ggtagcatga accagctcat tgccaagctc601 caggagatgg aagccatgtc cgatgagcaa aaaatggccc agaaaataat gaagatgata661 cacggagatt acatcgaaaa gccagacttt gccctgaagt ctataggggc cagcattgac721 tttgagcaca cgtcagtcac ctataaccat gagaaggccc actcctactg gaactggatc781 cagctgtgga actacgcaca gcccccagac gtgatccttg agcccaacgt gacacctggc841 aattgctggg cctttgaggg tgaccgcggc caggtgacca tccaattggc tcagaaggtt901 tacctgtcca acctcacgct gcagcacatc cccaagacca tctcattgtc aggcagcctg 961 gacaccgccc ccaaggactt cgtcatctat ggcatggagg gctcccccaa ggaggaggtg1021 ttcctggggg catttcagtt tcagccagaa aacatcatcc agatgttccc actccagaac1081 cagccggccc gggctttcag tgcggtcaag gtgaagatct caagcaactg ggggaaccca1141 ggcttcactt gcctgtaccg cgtgcgagtg catggctctg tggccccgcc cagagagcag1201 cctcaccaga acccctaccc taagagagat taaaatttat tctttacccc ca：MPRSSRSPGDPGALLEDVAHNPRPRRIAQRGRNTSRMAEDTSPNMNDNILLPVRNNDQALGLTQCMLGCVSWFTCFACSLRTQAQQVLFNTCRCKLLCQKLMEKTGILLLCAFGFWMFSIHLPSKMKVWQDDSINGPLQSLRLYQEKVRHHSGEIQDLRGSMNQLIAKLQEMEAMSDEQKMAQKIMKMIHGDYIEKPDFALKSIGASIDFEHTSVTYNHEKAHSYWNWIQLWNYAQPPDVILEPNVTPGNCWAFEGDRGQVTIQLAQKVYLSNLTLQHIPKTISLSGSLDTAPKDFVIYGMEGSPKEEVFLGAFQFQPENIIQMFPLQNQPARAFSAVKVKISSNWGNPGFTCLYRVRVHGSVAPPREQPHQNPYPKRD
5, testis spermatogenic cell apoptosis-related genes; Tsarg1,：1 gaaaagatca agagacatac ccacagggga gactgcctac ctagggaggg agccaggaaa61 ttcacagctc catgtagctc cacggtgtta ctctagaagg atcaccatga agaaggtcaa121 aaagaaaaag tctgattcca ggcgccgcag gaattccatt tcaccgcaga ctagctccga181 ttcctcacag cagcccagct cagaaacccc gccgtcatgt ccagagcccg cctcgccacc241 atctaagcca cagccttgcc aggagtccac cacaccacac caagttaacc ctgagcctaa301 accgcaacag catacaccac agcctctccc gcctccagag aaacctgcct catctccgtt361 cctggtaccc atggaaccta aaccaattct tccaagcagg aaagcagtgc ctctgaccta421 tgtggcccca cgctcctgct cctgtgcagc ctgcccgggc agctccgctt gctggcatcg481 tctggggctt tgccatagcc gaatctttga tgtcctccta cctcgggact ggtcatccat541 gccagggaga ggagtcccaa accttctcac cttctacaga aaaccgtcaa ggaagtactg601 cgctccccgt aactctcgtg cttcaagctc tcggaactgt tgctgtggct ctgggggcct661 tgggagttgc ctacttcatg gctgaatcct tgtgaattgg accccaggcc caccgtccgg721 caggggttca tggcatggca ccccaactat gccactctgc gtaaggatta ttctaagaag781 aaagtcgttg agaaactgaa gctcgtctct gccctctctg atctacctga gaacagcata841 atctctgcta ttacaatgag gtgacgccat cccgggaagg gtgaacagtc ttgcccctga901 agacagcaca cgggaaaacc atcccacaca aagtctgcct tgtctccata tcggtgtcct961 tccacagtca gccaccattc acattcaaac ctcttatagc ttccctacaa aattcttgct1021 gtttatgggg atgtctgtac atcttttgtg tcatttgctc tgtgcacagg cactgcctca1081 ttaataactt gttttctctt gcc：MKKVKKKKSDSRRRRNSISPQTSSDSSQQPSSETPPSCPEPASPPSKPQPCQESTTPHQVNPEPKPQQHTPQPLPPPEKPASSPFLVPMEPKPILPSRKAVPLTYVAPRSCSCAACPGSSACWHRLGLCHSRIFDVLLPRDWSSMPGRGVPNLLTFYRKPSRKYCAPRNSRASSSRNCCCGSGGLGSCLLHG
6, testis spermatogenic cell apoptosis-related genes; Tsarg,： 1 ataggatagg aatctttatt atgtcagcct aaggtctcac gcctccccat cttcataggc 61 tgggggttga gtggatagga gcaggcaagg cccagctagc cctctccatc cctgttcctg121 ctcaggtccc ccagaattag gtcagcaatg cctggcgcag catctgcttc ttctggggtg181 tgaggcgggt ggggaactgg atgtcaaaga agatgaagag gtctcccttc ttgctggggt241 tctcaggcag tggcatcccc tcacctggca caatcttgaa gtacttaggg tggacaatgt301 cgttgatagg gatgttgagc agccggtcat caagagtctt cacctccaca gtgcagcagg361 taagggcctt gcccaaagga atggggtaca cgaagaagag gttgtcatgc tccctgcgga421 agcgagggtg cagcttctcc ttcacaatga agataatgtc agcagggatg atgttggggc481 cctggtcccc ttccttctca aaggtgat~c gtgtgccctg cctccatcca ggtctcacat541 cgatggtcag gatcttgtcc ttgatggtag aagaatatct gtcttcattt agtacccttc601 gggagatctt aatttttttg gtgcagccaa agaataagtc ctcaagggac agatagaggt661 ctcgttcaat gggagggtct tgtttctgga cgcctctgcc ccaaagcccc ccaaaattca 721 aatctatatc atttccttct gcatcaaaaa attcgctgaa ggggttgtct cccccaaaaa 781 actcgtggaa cactttgtca gggttgccat ggaagacgta gccagttgtc catggagtct 841 gggatccaaa ctctagggga atcccaccct tcaggccttc ctcaccaaac ttgtcataga 901 tgcctcgctt cacagggtcg ctcagcacgt cgtaggcttc tgctatttgc ttgaatatct 961 ctggtgcacc cggctcagat gacttcaatg ggtggttctt cagggcaagt ttccggtatc1021 ttgaccacag gtctgtatgg tggggacata ggttatgtca agttgacata aaactagcca1081 gcacacttgg tcttctggta attaggctag ccttatctat ttgccatggt aatccttcca1141 ttgatgagtc ccattggcc：MSKKMKRSPFLLGFSGSGIPSPGTILKYLGWTMSLIGMLSSRSSRVFTSTVQQVRALPKGMGYTKKRLSCSLRKRGCSFSFTMKIMSAGMMLGPWSPSFSKVMRVPCLHPGLTSMVRILSLMVEEYLSSFSTLREILIFLVQPKNKSSRDR
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN02114137A CN1459458A (en) | 2002-05-20 | 2002-05-20 | Testes spermatogenous cell die related gene |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN02114137A CN1459458A (en) | 2002-05-20 | 2002-05-20 | Testes spermatogenous cell die related gene |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN1459458A true CN1459458A (en) | 2003-12-03 |
Family
ID=29426457
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN02114137A Pending CN1459458A (en) | 2002-05-20 | 2002-05-20 | Testes spermatogenous cell die related gene |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN1459458A (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1795929B (en) * | 2004-12-30 | 2011-01-26 | 上海南方模式生物科技发展有限公司 | Method for generating model of mice in male sterility |
| CN101775372B (en) * | 2009-12-02 | 2012-01-11 | 桂耀庭 | Anti-testicle-protein hT279 antibody or antibody fragment and application thereof |
| CN101775371B (en) * | 2009-12-02 | 2012-03-14 | 唐爱发 | Anti-testicle-protein hTSC29 antibody or antibody fragment and application thereof |
-
2002
- 2002-05-20 CN CN02114137A patent/CN1459458A/en active Pending
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1795929B (en) * | 2004-12-30 | 2011-01-26 | 上海南方模式生物科技发展有限公司 | Method for generating model of mice in male sterility |
| CN101775372B (en) * | 2009-12-02 | 2012-01-11 | 桂耀庭 | Anti-testicle-protein hT279 antibody or antibody fragment and application thereof |
| CN101775371B (en) * | 2009-12-02 | 2012-03-14 | 唐爱发 | Anti-testicle-protein hTSC29 antibody or antibody fragment and application thereof |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Doornbos et al. | Nine patients with a microdeletion 15q11. 2 between breakpoints 1 and 2 of the Prader–Willi critical region, possibly associated with behavioural disturbances | |
| Auburger et al. | A gene for autosomal dominant paroxysmal choreoathetosis/spasticity (CSE) maps to the vicinity of a potassium channel gene cluster on chromosome 1p, probably within 2 cM between D1S443 and D1S197 | |
| Derks-Smeets et al. | BRCA1 mutation carriers have a lower number of mature oocytes after ovarian stimulation for IVF/PGD | |
| Bashiardes et al. | SNTG1, the gene encoding γ1-syntrophin: a candidate gene for idiopathic scoliosis | |
| Halder et al. | Chromosome 22q11. 2 microdeletion in monozygotic twins with discordant phenotype and deletion size | |
| Kim et al. | Complex chromosomal rearrangements in infertile males: complexity of rearrangement affects spermatogenesis | |
| JPS63500214A (en) | Nucleic acid probe for fetal sex identification | |
| Tan et al. | Phenotypic expansion and further characterisation of the 17q21. 31 microdeletion syndrome | |
| Rani et al. | Mitochondrial DNA haplogroup ‘R’is associated with Noonan syndrome of south India | |
| Schmidt et al. | Genome editing of CCR5 by CRISPR-Cas9 in Mauritian cynomolgus macaque embryos | |
| Liao et al. | Identification of a microdeletion at Xp22. 13 in a Taiwanese family presenting with Nance-Horan syndrome | |
| Hosseini et al. | The impact of RABL2B gene (rs144944885) on human male infertility in patients with oligoasthenoteratozoospermia and immotile short tail sperm defects | |
| Trujillo et al. | Savior siblings and Fanconi anemia: analysis of success rates from the family’s perspective | |
| CN1459458A (en) | Testes spermatogenous cell die related gene | |
| Brezina et al. | Evaluation of 571 in vitro fertilization (IVF) Cycels and 4,873 embryos using 23-chromosome single nucleotide polymorphism (SNP) microarray preimplantation genetic screening (PGS) | |
| Saleh et al. | Screening Indels from the whole genome to identify the candidates and their association with economic traits in several goat breeds | |
| CN108866183A (en) | The relevant GRP78 gene SNP marker of asthénospermie and its application | |
| Shinoda et al. | Mitochondrial DNA polymorphisms in Late Shell Midden Period skeletal remains excavated from two archaeological sites in Okinawa | |
| Fru et al. | Replete vitamin D levels are associated with higher pregnancy rates and increased number of live births in autologous IVF cycles | |
| Cao et al. | Molecular genetic characterization of a chinese family with severe split hand/foot malformation | |
| Cheng et al. | Insight into human sex ratio imbalance: the more boys born, the more infertile men | |
| CN101967511B (en) | Gene chip, detection reagent and kit for detecting GDM susceptible population | |
| Derks-Smeets et al. | BRCA1 mutation carriers have a lower number of mature oocytes after ovarian hyperstimulation for IVF/PGD | |
| Bouziden | Genetic Modification and the power of CRISPR-Cas9 | |
| Salas-Huetos et al. | Genetic Aspects of Male Infertility |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C02 | Deemed withdrawal of patent application after publication (patent law 2001) | ||
| WD01 | Invention patent application deemed withdrawn after publication |