CN118055770A - CD3 expressing natural killer cells with enhanced function for adoptive immunotherapy - Google Patents
CD3 expressing natural killer cells with enhanced function for adoptive immunotherapy Download PDFInfo
- Publication number
- CN118055770A CN118055770A CN202280061681.5A CN202280061681A CN118055770A CN 118055770 A CN118055770 A CN 118055770A CN 202280061681 A CN202280061681 A CN 202280061681A CN 118055770 A CN118055770 A CN 118055770A
- Authority
- CN
- China
- Prior art keywords
- seq
- cells
- composition
- tcr
- intracellular signaling
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 210000000822 natural killer cell Anatomy 0.000 title claims abstract description 355
- 238000009169 immunotherapy Methods 0.000 title description 7
- 108091008874 T cell receptors Proteins 0.000 claims abstract description 498
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 claims abstract description 489
- 239000000203 mixture Substances 0.000 claims abstract description 107
- 238000000034 method Methods 0.000 claims abstract description 68
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 claims description 213
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 claims description 213
- 206010028980 Neoplasm Diseases 0.000 claims description 119
- 239000000427 antigen Substances 0.000 claims description 103
- 108091007433 antigens Proteins 0.000 claims description 103
- 102000036639 antigens Human genes 0.000 claims description 103
- 108090000172 Interleukin-15 Proteins 0.000 claims description 84
- 102000003812 Interleukin-15 Human genes 0.000 claims description 82
- 201000011510 cancer Diseases 0.000 claims description 64
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 59
- 108090000623 proteins and genes Proteins 0.000 claims description 59
- 108090000695 Cytokines Proteins 0.000 claims description 54
- 102000004127 Cytokines Human genes 0.000 claims description 53
- 230000004068 intracellular signaling Effects 0.000 claims description 51
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 50
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 50
- 102000004169 proteins and genes Human genes 0.000 claims description 35
- 102000005962 receptors Human genes 0.000 claims description 33
- 108020003175 receptors Proteins 0.000 claims description 33
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 claims description 31
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 claims description 31
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims description 25
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 claims description 21
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 claims description 21
- 239000012528 membrane Substances 0.000 claims description 20
- 102000006306 Antigen Receptors Human genes 0.000 claims description 17
- 108010083359 Antigen Receptors Proteins 0.000 claims description 17
- 102100030704 Interleukin-21 Human genes 0.000 claims description 17
- 108010074108 interleukin-21 Proteins 0.000 claims description 17
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 claims description 15
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 claims description 15
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 claims description 14
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 claims description 14
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 claims description 14
- 210000004700 fetal blood Anatomy 0.000 claims description 13
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 claims description 12
- 102100027670 Islet amyloid polypeptide Human genes 0.000 claims description 12
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 claims description 12
- 108010002350 Interleukin-2 Proteins 0.000 claims description 11
- 102000000588 Interleukin-2 Human genes 0.000 claims description 11
- 101000809875 Homo sapiens TYRO protein tyrosine kinase-binding protein Proteins 0.000 claims description 10
- 108010065805 Interleukin-12 Proteins 0.000 claims description 10
- 102000013462 Interleukin-12 Human genes 0.000 claims description 10
- 102100038717 TYRO protein tyrosine kinase-binding protein Human genes 0.000 claims description 10
- 102000003810 Interleukin-18 Human genes 0.000 claims description 9
- 108090000171 Interleukin-18 Proteins 0.000 claims description 9
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 claims description 9
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 claims description 8
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 claims description 8
- 108010041872 Islet Amyloid Polypeptide Proteins 0.000 claims description 8
- 102000009410 Chemokine receptor Human genes 0.000 claims description 7
- 108050000299 Chemokine receptor Proteins 0.000 claims description 7
- 230000003612 virological effect Effects 0.000 claims description 7
- 102100027207 CD27 antigen Human genes 0.000 claims description 6
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 claims description 6
- 238000001802 infusion Methods 0.000 claims description 6
- 210000005259 peripheral blood Anatomy 0.000 claims description 6
- 239000011886 peripheral blood Substances 0.000 claims description 6
- 108010002586 Interleukin-7 Proteins 0.000 claims description 5
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 claims description 5
- 102100038078 CD276 antigen Human genes 0.000 claims description 4
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 claims description 4
- 101000884279 Homo sapiens CD276 antigen Proteins 0.000 claims description 4
- 102000013264 Interleukin-23 Human genes 0.000 claims description 4
- 108010065637 Interleukin-23 Proteins 0.000 claims description 4
- 210000001185 bone marrow Anatomy 0.000 claims description 4
- 238000009472 formulation Methods 0.000 claims description 4
- 101000746373 Homo sapiens Granulocyte-macrophage colony-stimulating factor Proteins 0.000 claims description 3
- 230000000735 allogeneic effect Effects 0.000 claims description 3
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 3
- 210000000130 stem cell Anatomy 0.000 claims description 3
- 102000036673 PRAME Human genes 0.000 claims 4
- 108060006580 PRAME Proteins 0.000 claims 4
- 210000004027 cell Anatomy 0.000 abstract description 176
- 210000001744 T-lymphocyte Anatomy 0.000 abstract description 84
- 230000003013 cytotoxicity Effects 0.000 abstract description 19
- 231100000135 cytotoxicity Toxicity 0.000 abstract description 19
- 230000011664 signaling Effects 0.000 abstract description 17
- 230000004913 activation Effects 0.000 abstract description 14
- 230000003834 intracellular effect Effects 0.000 description 48
- 235000001014 amino acid Nutrition 0.000 description 40
- 229940024606 amino acid Drugs 0.000 description 38
- 150000001413 amino acids Chemical class 0.000 description 38
- 239000012636 effector Substances 0.000 description 35
- 235000018102 proteins Nutrition 0.000 description 31
- 239000013598 vector Substances 0.000 description 31
- 108090000765 processed proteins & peptides Proteins 0.000 description 28
- 241000699670 Mus sp. Species 0.000 description 26
- 239000002773 nucleotide Substances 0.000 description 26
- 125000003729 nucleotide group Chemical group 0.000 description 26
- 230000003211 malignant effect Effects 0.000 description 24
- 238000001727 in vivo Methods 0.000 description 23
- 238000010361 transduction Methods 0.000 description 21
- 230000026683 transduction Effects 0.000 description 21
- 108010076504 Protein Sorting Signals Proteins 0.000 description 20
- -1 ethyl oleate) Chemical class 0.000 description 20
- 201000001441 melanoma Diseases 0.000 description 20
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 19
- 230000000694 effects Effects 0.000 description 19
- 102000004196 processed proteins & peptides Human genes 0.000 description 19
- 201000010099 disease Diseases 0.000 description 18
- 238000011282 treatment Methods 0.000 description 17
- 210000004881 tumor cell Anatomy 0.000 description 17
- 206010035226 Plasma cell myeloma Diseases 0.000 description 16
- 229920001184 polypeptide Polymers 0.000 description 16
- 201000000050 myeloid neoplasm Diseases 0.000 description 15
- 230000008685 targeting Effects 0.000 description 15
- 239000003814 drug Substances 0.000 description 14
- 230000002147 killing effect Effects 0.000 description 14
- 241000282414 Homo sapiens Species 0.000 description 13
- 101000578784 Homo sapiens Melanoma antigen recognized by T-cells 1 Proteins 0.000 description 13
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 description 13
- 102000003425 Tyrosinase Human genes 0.000 description 13
- 108060008724 Tyrosinase Proteins 0.000 description 13
- 241000701806 Human papillomavirus Species 0.000 description 12
- 241001465754 Metazoa Species 0.000 description 12
- 238000000338 in vitro Methods 0.000 description 12
- 108091026890 Coding region Proteins 0.000 description 11
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 11
- 230000000139 costimulatory effect Effects 0.000 description 11
- 238000003384 imaging method Methods 0.000 description 11
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 description 10
- 230000004927 fusion Effects 0.000 description 10
- SSOORFWOBGFTHL-OTEJMHTDSA-N (4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[(2S)-2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-5-carbamimidamido-1-[[(2S)-5-carbamimidamido-1-[[(1S)-4-carbamimidamido-1-carboxybutyl]amino]-1-oxopentan-2-yl]amino]-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-[[(2S)-2-[[(2S)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino]-5-oxopentanoic acid Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SSOORFWOBGFTHL-OTEJMHTDSA-N 0.000 description 9
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 9
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 9
- 206010039491 Sarcoma Diseases 0.000 description 9
- 208000009956 adenocarcinoma Diseases 0.000 description 9
- 230000036210 malignancy Effects 0.000 description 9
- 239000000047 product Substances 0.000 description 9
- 230000005855 radiation Effects 0.000 description 9
- 238000012360 testing method Methods 0.000 description 9
- 229940124597 therapeutic agent Drugs 0.000 description 9
- 238000002560 therapeutic procedure Methods 0.000 description 9
- 206010025323 Lymphomas Diseases 0.000 description 8
- 230000000259 anti-tumor effect Effects 0.000 description 8
- 238000003556 assay Methods 0.000 description 8
- 230000004048 modification Effects 0.000 description 8
- 238000012986 modification Methods 0.000 description 8
- 239000013642 negative control Substances 0.000 description 8
- 208000024891 symptom Diseases 0.000 description 8
- 108090000331 Firefly luciferases Proteins 0.000 description 7
- 238000002659 cell therapy Methods 0.000 description 7
- 239000003795 chemical substances by application Substances 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 102000039446 nucleic acids Human genes 0.000 description 7
- 108020004707 nucleic acids Proteins 0.000 description 7
- 150000007523 nucleic acids Chemical class 0.000 description 7
- 230000001225 therapeutic effect Effects 0.000 description 7
- 230000004614 tumor growth Effects 0.000 description 7
- 201000009030 Carcinoma Diseases 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 102100022430 Melanocyte protein PMEL Human genes 0.000 description 6
- 101800001271 Surface protein Proteins 0.000 description 6
- 230000036765 blood level Effects 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 6
- 208000032839 leukemia Diseases 0.000 description 6
- 108020004999 messenger RNA Proteins 0.000 description 6
- 201000008968 osteosarcoma Diseases 0.000 description 6
- 125000006850 spacer group Chemical group 0.000 description 6
- 210000003462 vein Anatomy 0.000 description 6
- 102100028972 HLA class I histocompatibility antigen, A alpha chain Human genes 0.000 description 5
- 108010075704 HLA-A Antigens Proteins 0.000 description 5
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 5
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 5
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 5
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 5
- 230000003321 amplification Effects 0.000 description 5
- 230000029918 bioluminescence Effects 0.000 description 5
- 238000005415 bioluminescence Methods 0.000 description 5
- 238000003501 co-culture Methods 0.000 description 5
- 230000001086 cytosolic effect Effects 0.000 description 5
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 238000003199 nucleic acid amplification method Methods 0.000 description 5
- 230000026731 phosphorylation Effects 0.000 description 5
- 238000006366 phosphorylation reaction Methods 0.000 description 5
- 239000013641 positive control Substances 0.000 description 5
- 230000000638 stimulation Effects 0.000 description 5
- 239000004474 valine Substances 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 4
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 4
- 101001005719 Homo sapiens Melanoma-associated antigen 3 Proteins 0.000 description 4
- 101001005720 Homo sapiens Melanoma-associated antigen 4 Proteins 0.000 description 4
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 102000000440 Melanoma-associated antigen Human genes 0.000 description 4
- 108050008953 Melanoma-associated antigen Proteins 0.000 description 4
- 102100025082 Melanoma-associated antigen 3 Human genes 0.000 description 4
- 102100025077 Melanoma-associated antigen 4 Human genes 0.000 description 4
- 208000003837 Second Primary Neoplasms Diseases 0.000 description 4
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 210000004899 c-terminal region Anatomy 0.000 description 4
- 230000030833 cell death Effects 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 206010052015 cytokine release syndrome Diseases 0.000 description 4
- 238000010586 diagram Methods 0.000 description 4
- 238000000684 flow cytometry Methods 0.000 description 4
- 230000002757 inflammatory effect Effects 0.000 description 4
- 238000010859 live-cell imaging Methods 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 239000008194 pharmaceutical composition Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 238000011002 quantification Methods 0.000 description 4
- 230000001177 retroviral effect Effects 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 230000004083 survival effect Effects 0.000 description 4
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 3
- 101100243447 Arabidopsis thaliana PER53 gene Proteins 0.000 description 3
- 208000003950 B-cell lymphoma Diseases 0.000 description 3
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 3
- VYZAMTAEIAYCRO-BJUDXGSMSA-N Chromium-51 Chemical compound [51Cr] VYZAMTAEIAYCRO-BJUDXGSMSA-N 0.000 description 3
- 206010009944 Colon cancer Diseases 0.000 description 3
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 3
- 101000998120 Homo sapiens Interleukin-3 receptor subunit alpha Proteins 0.000 description 3
- 101000633784 Homo sapiens SLAM family member 7 Proteins 0.000 description 3
- 101000738413 Homo sapiens T-cell surface glycoprotein CD3 gamma chain Proteins 0.000 description 3
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 description 3
- 101000666382 Homo sapiens Transcription factor E2-alpha Proteins 0.000 description 3
- 102100033493 Interleukin-3 receptor subunit alpha Human genes 0.000 description 3
- 102000000704 Interleukin-7 Human genes 0.000 description 3
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 3
- 208000008839 Kidney Neoplasms Diseases 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 3
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 3
- 101710101148 Probable 6-oxopurine nucleoside phosphorylase Proteins 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 206010060862 Prostate cancer Diseases 0.000 description 3
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 3
- 102000007066 Prostate-Specific Antigen Human genes 0.000 description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 3
- 101800001494 Protease 2A Proteins 0.000 description 3
- 101800001066 Protein 2A Proteins 0.000 description 3
- 102000030764 Purine-nucleoside phosphorylase Human genes 0.000 description 3
- 206010038389 Renal cancer Diseases 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 208000005718 Stomach Neoplasms Diseases 0.000 description 3
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 description 3
- 101150080074 TP53 gene Proteins 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 239000004473 Threonine Substances 0.000 description 3
- 102100038313 Transcription factor E2-alpha Human genes 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 208000008383 Wilms tumor Diseases 0.000 description 3
- 230000002411 adverse Effects 0.000 description 3
- 210000000612 antigen-presenting cell Anatomy 0.000 description 3
- 102220354910 c.4C>G Human genes 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 238000012258 culturing Methods 0.000 description 3
- 230000016396 cytokine production Effects 0.000 description 3
- 230000001472 cytotoxic effect Effects 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 206010017758 gastric cancer Diseases 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 201000010982 kidney cancer Diseases 0.000 description 3
- 201000005202 lung cancer Diseases 0.000 description 3
- 208000020816 lung neoplasm Diseases 0.000 description 3
- FUZOUVDGBZTBCF-UHFFFAOYSA-N methyl 7-[2-[2-(8-methoxycarbonyl-4b,8-dimethyl-5,6,7,8a,9,10-hexahydrophenanthren-2-yl)propan-2-ylperoxy]propan-2-yl]-1,4a-dimethyl-2,3,4,9,10,10a-hexahydrophenanthrene-1-carboxylate Chemical compound C1=C2CCC3C(C)(C(=O)OC)CCCC3(C)C2=CC=C1C(C)(C)OOC(C)(C)C1=CC=C2C3(C)CCCC(C(=O)OC)(C)C3CCC2=C1 FUZOUVDGBZTBCF-UHFFFAOYSA-N 0.000 description 3
- 238000012737 microarray-based gene expression Methods 0.000 description 3
- 238000012544 monitoring process Methods 0.000 description 3
- 238000012243 multiplex automated genomic engineering Methods 0.000 description 3
- 208000025113 myeloid leukemia Diseases 0.000 description 3
- 201000008026 nephroblastoma Diseases 0.000 description 3
- 238000011275 oncology therapy Methods 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 229940002612 prodrug Drugs 0.000 description 3
- 239000000651 prodrug Substances 0.000 description 3
- 210000002307 prostate Anatomy 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 206010041823 squamous cell carcinoma Diseases 0.000 description 3
- 201000011549 stomach cancer Diseases 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 2
- LKKMLIBUAXYLOY-UHFFFAOYSA-N 3-Amino-1-methyl-5H-pyrido[4,3-b]indole Chemical compound N1C2=CC=CC=C2C2=C1C=C(N)N=C2C LKKMLIBUAXYLOY-UHFFFAOYSA-N 0.000 description 2
- 102100023003 Ankyrin repeat domain-containing protein 30A Human genes 0.000 description 2
- 101001005269 Arabidopsis thaliana Ceramide synthase 1 LOH3 Proteins 0.000 description 2
- 101001005312 Arabidopsis thaliana Ceramide synthase LOH1 Proteins 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 206010003571 Astrocytoma Diseases 0.000 description 2
- 102100035526 B melanoma antigen 1 Human genes 0.000 description 2
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 2
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 2
- 206010005003 Bladder cancer Diseases 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- 208000026310 Breast neoplasm Diseases 0.000 description 2
- 102100026094 C-type lectin domain family 12 member A Human genes 0.000 description 2
- 102100038077 CD226 antigen Human genes 0.000 description 2
- 102100028801 Calsyntenin-1 Human genes 0.000 description 2
- 108010033547 Carbonic Anhydrase I Proteins 0.000 description 2
- 102100025518 Carbonic anhydrase 1 Human genes 0.000 description 2
- 102000013392 Carboxylesterase Human genes 0.000 description 2
- 108010051152 Carboxylesterase Proteins 0.000 description 2
- 108010006303 Carboxypeptidases Proteins 0.000 description 2
- 102000005367 Carboxypeptidases Human genes 0.000 description 2
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 2
- 206010008342 Cervix carcinoma Diseases 0.000 description 2
- 208000005243 Chondrosarcoma Diseases 0.000 description 2
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 2
- 102000002004 Cytochrome P-450 Enzyme System Human genes 0.000 description 2
- 108010015742 Cytochrome P-450 Enzyme System Proteins 0.000 description 2
- 102000001301 EGF receptor Human genes 0.000 description 2
- 108060006698 EGF receptor Proteins 0.000 description 2
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 2
- 101710121417 Envelope glycoprotein Proteins 0.000 description 2
- 102000007665 Extracellular Signal-Regulated MAP Kinases Human genes 0.000 description 2
- 108010007457 Extracellular Signal-Regulated MAP Kinases Proteins 0.000 description 2
- 201000008808 Fibrosarcoma Diseases 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 239000000579 Gonadotropin-Releasing Hormone Substances 0.000 description 2
- 101150090209 HCST gene Proteins 0.000 description 2
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 2
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000757191 Homo sapiens Ankyrin repeat domain-containing protein 30A Proteins 0.000 description 2
- 101000874316 Homo sapiens B melanoma antigen 1 Proteins 0.000 description 2
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 2
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 2
- 101000884298 Homo sapiens CD226 antigen Proteins 0.000 description 2
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 2
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 description 2
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 2
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 2
- 101001023379 Homo sapiens Lysosome-associated membrane glycoprotein 1 Proteins 0.000 description 2
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 2
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 2
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 2
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 description 2
- 101000874141 Homo sapiens Probable ATP-dependent RNA helicase DDX43 Proteins 0.000 description 2
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 2
- 101000821981 Homo sapiens Sarcoma antigen 1 Proteins 0.000 description 2
- 101000946860 Homo sapiens T-cell surface glycoprotein CD3 epsilon chain Proteins 0.000 description 2
- 101000738335 Homo sapiens T-cell surface glycoprotein CD3 zeta chain Proteins 0.000 description 2
- 101100369992 Homo sapiens TNFSF10 gene Proteins 0.000 description 2
- 101000610605 Homo sapiens Tumor necrosis factor receptor superfamily member 10A Proteins 0.000 description 2
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 2
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 2
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 2
- 101000954519 Human papillomavirus type 18 Protein E6 Proteins 0.000 description 2
- 101000767629 Human papillomavirus type 18 Protein E7 Proteins 0.000 description 2
- 206010020751 Hypersensitivity Diseases 0.000 description 2
- 206010021143 Hypoxia Diseases 0.000 description 2
- 102100025390 Integrin beta-2 Human genes 0.000 description 2
- 102100020944 Integrin-linked protein kinase Human genes 0.000 description 2
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 2
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 2
- 108010017535 Interleukin-15 Receptors Chemical class 0.000 description 2
- 108090001005 Interleukin-6 Proteins 0.000 description 2
- 102000004889 Interleukin-6 Human genes 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- 102100031413 L-dopachrome tautomerase Human genes 0.000 description 2
- 101710093778 L-dopachrome tautomerase Proteins 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 102100035133 Lysosome-associated membrane glycoprotein 1 Human genes 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- XUMBMVFBXHLACL-UHFFFAOYSA-N Melanin Chemical compound O=C1C(=O)C(C2=CNC3=C(C(C(=O)C4=C32)=O)C)=C2C4=CNC2=C1C XUMBMVFBXHLACL-UHFFFAOYSA-N 0.000 description 2
- 102000018697 Membrane Proteins Human genes 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 102000003735 Mesothelin Human genes 0.000 description 2
- 108090000015 Mesothelin Proteins 0.000 description 2
- 206010027406 Mesothelioma Diseases 0.000 description 2
- 102100023123 Mucin-16 Human genes 0.000 description 2
- 208000034578 Multiple myelomas Diseases 0.000 description 2
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 2
- 108010057466 NF-kappa B Proteins 0.000 description 2
- 102000003945 NF-kappa B Human genes 0.000 description 2
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 2
- 206010029260 Neuroblastoma Diseases 0.000 description 2
- 206010029350 Neurotoxicity Diseases 0.000 description 2
- 102000004459 Nitroreductase Human genes 0.000 description 2
- 102000005650 Notch Receptors Human genes 0.000 description 2
- 108010070047 Notch Receptors Proteins 0.000 description 2
- 201000010133 Oligodendroglioma Diseases 0.000 description 2
- 206010033128 Ovarian cancer Diseases 0.000 description 2
- 206010061535 Ovarian neoplasm Diseases 0.000 description 2
- 108091008606 PDGF receptors Proteins 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- 206010061332 Paraganglion neoplasm Diseases 0.000 description 2
- 102000011653 Platelet-Derived Growth Factor Receptors Human genes 0.000 description 2
- 102100035724 Probable ATP-dependent RNA helicase DDX43 Human genes 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 101710132082 Pyrimidine/purine nucleoside phosphorylase Proteins 0.000 description 2
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 101710173694 Short transient receptor potential channel 2 Proteins 0.000 description 2
- 101000668858 Spinacia oleracea 30S ribosomal protein S1, chloroplastic Proteins 0.000 description 2
- 101000857870 Squalus acanthias Gonadoliberin Proteins 0.000 description 2
- 102100035748 Squamous cell carcinoma antigen recognized by T-cells 3 Human genes 0.000 description 2
- 101000898746 Streptomyces clavuligerus Clavaminate synthase 1 Proteins 0.000 description 2
- 102100037911 T-cell surface glycoprotein CD3 gamma chain Human genes 0.000 description 2
- 108700012411 TNFSF10 Proteins 0.000 description 2
- 108010065917 TOR Serine-Threonine Kinases Proteins 0.000 description 2
- 102000013530 TOR Serine-Threonine Kinases Human genes 0.000 description 2
- 102000006601 Thymidine Kinase Human genes 0.000 description 2
- 108020004440 Thymidine kinase Proteins 0.000 description 2
- 102100031372 Thymidine phosphorylase Human genes 0.000 description 2
- 208000024770 Thyroid neoplasm Diseases 0.000 description 2
- 206010044221 Toxic encephalopathy Diseases 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 102100040113 Tumor necrosis factor receptor superfamily member 10A Human genes 0.000 description 2
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 2
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 2
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 2
- 108091008605 VEGF receptors Proteins 0.000 description 2
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 2
- 230000006786 activation induced cell death Effects 0.000 description 2
- 238000011467 adoptive cell therapy Methods 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 2
- 102000013529 alpha-Fetoproteins Human genes 0.000 description 2
- 230000002707 ameloblastic effect Effects 0.000 description 2
- 230000001745 anti-biotin effect Effects 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 239000003125 aqueous solvent Substances 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 201000000053 blastoma Diseases 0.000 description 2
- 238000002619 cancer immunotherapy Methods 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 201000010881 cervical cancer Diseases 0.000 description 2
- 208000006990 cholangiocarcinoma Diseases 0.000 description 2
- 208000029664 classic familial adenomatous polyposis Diseases 0.000 description 2
- 208000009060 clear cell adenocarcinoma Diseases 0.000 description 2
- 238000004132 cross linking Methods 0.000 description 2
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 231100000673 dose–response relationship Toxicity 0.000 description 2
- 201000008184 embryoma Diseases 0.000 description 2
- 230000002327 eosinophilic effect Effects 0.000 description 2
- 108010087914 epidermal growth factor receptor VIII Proteins 0.000 description 2
- 230000008029 eradication Effects 0.000 description 2
- 230000003325 follicular Effects 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- XLXSAKCOAKORKW-AQJXLSMYSA-N gonadorelin Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)NCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 XLXSAKCOAKORKW-AQJXLSMYSA-N 0.000 description 2
- 229940035638 gonadotropin-releasing hormone Drugs 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- 201000005787 hematologic cancer Diseases 0.000 description 2
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 108010059517 integrin-linked kinase Proteins 0.000 description 2
- 238000007914 intraventricular administration Methods 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 208000014018 liver neoplasm Diseases 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 2
- 210000001161 mammalian embryo Anatomy 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 201000010225 mixed cell type cancer Diseases 0.000 description 2
- 208000029638 mixed neoplasm Diseases 0.000 description 2
- AEMBWNDIEFEPTH-UHFFFAOYSA-N n-tert-butyl-n-ethylnitrous amide Chemical compound CCN(N=O)C(C)(C)C AEMBWNDIEFEPTH-UHFFFAOYSA-N 0.000 description 2
- 230000007135 neurotoxicity Effects 0.000 description 2
- 231100000228 neurotoxicity Toxicity 0.000 description 2
- 108020001162 nitroreductase Proteins 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 230000002611 ovarian Effects 0.000 description 2
- 201000002528 pancreatic cancer Diseases 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- 208000007312 paraganglioma Diseases 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 102000016914 ras Proteins Human genes 0.000 description 2
- 230000008707 rearrangement Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 2
- 102220003351 rs387906411 Human genes 0.000 description 2
- 235000002020 sage Nutrition 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 201000002510 thyroid cancer Diseases 0.000 description 2
- 208000030901 thyroid gland follicular carcinoma Diseases 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000002463 transducing effect Effects 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 201000005112 urinary bladder cancer Diseases 0.000 description 2
- 230000002792 vascular Effects 0.000 description 2
- 229940124676 vascular endothelial growth factor receptor Drugs 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- IPVFGAYTKQKGBM-BYPJNBLXSA-N 1-[(2r,3s,4r,5r)-3-fluoro-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-iodopyrimidine-2,4-dione Chemical compound F[C@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 IPVFGAYTKQKGBM-BYPJNBLXSA-N 0.000 description 1
- KKVYYGGCHJGEFJ-UHFFFAOYSA-N 1-n-(4-chlorophenyl)-6-methyl-5-n-[3-(7h-purin-6-yl)pyridin-2-yl]isoquinoline-1,5-diamine Chemical compound N=1C=CC2=C(NC=3C(=CC=CN=3)C=3C=4N=CNC=4N=CN=3)C(C)=CC=C2C=1NC1=CC=C(Cl)C=C1 KKVYYGGCHJGEFJ-UHFFFAOYSA-N 0.000 description 1
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 description 1
- ASJSAQIRZKANQN-CRCLSJGQSA-N 2-deoxy-D-ribose Chemical compound OC[C@@H](O)[C@@H](O)CC=O ASJSAQIRZKANQN-CRCLSJGQSA-N 0.000 description 1
- WEVYNIUIFUYDGI-UHFFFAOYSA-N 3-[6-[4-(trifluoromethoxy)anilino]-4-pyrimidinyl]benzamide Chemical compound NC(=O)C1=CC=CC(C=2N=CN=C(NC=3C=CC(OC(F)(F)F)=CC=3)C=2)=C1 WEVYNIUIFUYDGI-UHFFFAOYSA-N 0.000 description 1
- 108010082808 4-1BB Ligand Proteins 0.000 description 1
- 102100030310 5,6-dihydroxyindole-2-carboxylic acid oxidase Human genes 0.000 description 1
- 101710163881 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 description 1
- GOZMBJCYMQQACI-UHFFFAOYSA-N 6,7-dimethyl-3-[[methyl-[2-[methyl-[[1-[3-(trifluoromethyl)phenyl]indol-3-yl]methyl]amino]ethyl]amino]methyl]chromen-4-one;dihydrochloride Chemical compound Cl.Cl.C=1OC2=CC(C)=C(C)C=C2C(=O)C=1CN(C)CCN(C)CC(C1=CC=CC=C11)=CN1C1=CC=CC(C(F)(F)F)=C1 GOZMBJCYMQQACI-UHFFFAOYSA-N 0.000 description 1
- LQNBBPPWZOXLOV-UHFFFAOYSA-N 6-methyl-7h-purine;7h-purine Chemical compound C1=NC=C2NC=NC2=N1.CC1=NC=NC2=C1NC=N2 LQNBBPPWZOXLOV-UHFFFAOYSA-N 0.000 description 1
- SYMHUEFSSMBHJA-UHFFFAOYSA-N 6-methylpurine Chemical compound CC1=NC=NC2=C1NC=N2 SYMHUEFSSMBHJA-UHFFFAOYSA-N 0.000 description 1
- 102100040079 A-kinase anchor protein 4 Human genes 0.000 description 1
- 101710109924 A-kinase anchor protein 4 Proteins 0.000 description 1
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 1
- 208000002008 AIDS-Related Lymphoma Diseases 0.000 description 1
- 102100033793 ALK tyrosine kinase receptor Human genes 0.000 description 1
- 101150019464 ARAF gene Proteins 0.000 description 1
- 102100022498 Actin-like protein 8 Human genes 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 102100021305 Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 Human genes 0.000 description 1
- 206010001197 Adenocarcinoma of the cervix Diseases 0.000 description 1
- 208000034246 Adenocarcinoma of the cervix uteri Diseases 0.000 description 1
- 208000004804 Adenomatous Polyps Diseases 0.000 description 1
- 208000006468 Adrenal Cortex Neoplasms Diseases 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- 102100037982 Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A Human genes 0.000 description 1
- 102100023635 Alpha-fetoprotein Human genes 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 102000052587 Anaphase-Promoting Complex-Cyclosome Apc3 Subunit Human genes 0.000 description 1
- 108700004606 Anaphase-Promoting Complex-Cyclosome Apc3 Subunit Proteins 0.000 description 1
- 102100032187 Androgen receptor Human genes 0.000 description 1
- 102100022014 Angiopoietin-1 receptor Human genes 0.000 description 1
- 201000003076 Angiosarcoma Diseases 0.000 description 1
- 102000004149 Annexin A2 Human genes 0.000 description 1
- 108090000668 Annexin A2 Proteins 0.000 description 1
- 208000007860 Anus Neoplasms Diseases 0.000 description 1
- 101100279855 Arabidopsis thaliana EPFL5 gene Proteins 0.000 description 1
- 101100504181 Arabidopsis thaliana GCS1 gene Proteins 0.000 description 1
- 101000719121 Arabidopsis thaliana Protein MEI2-like 1 Proteins 0.000 description 1
- 102000030431 Asparaginyl endopeptidase Human genes 0.000 description 1
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 description 1
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- 102100021663 Baculoviral IAP repeat-containing protein 5 Human genes 0.000 description 1
- 102100027522 Baculoviral IAP repeat-containing protein 7 Human genes 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 101000653197 Beet necrotic yellow vein virus (isolate Japan/S) Movement protein TGB3 Proteins 0.000 description 1
- 206010004593 Bile duct cancer Diseases 0.000 description 1
- 241000510004 Bipes Species 0.000 description 1
- 208000008720 Bone Marrow Neoplasms Diseases 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 206010005969 Bone giant cell tumour Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 102100031151 C-C chemokine receptor type 2 Human genes 0.000 description 1
- 101710149815 C-C chemokine receptor type 2 Proteins 0.000 description 1
- 102100024167 C-C chemokine receptor type 3 Human genes 0.000 description 1
- 101710149862 C-C chemokine receptor type 3 Proteins 0.000 description 1
- 102100035875 C-C chemokine receptor type 5 Human genes 0.000 description 1
- 101710149870 C-C chemokine receptor type 5 Proteins 0.000 description 1
- 102100036301 C-C chemokine receptor type 7 Human genes 0.000 description 1
- 102100036305 C-C chemokine receptor type 8 Human genes 0.000 description 1
- 108010074051 C-Reactive Protein Proteins 0.000 description 1
- 102100036166 C-X-C chemokine receptor type 1 Human genes 0.000 description 1
- 102100028989 C-X-C chemokine receptor type 2 Human genes 0.000 description 1
- 102100028990 C-X-C chemokine receptor type 3 Human genes 0.000 description 1
- 102100032752 C-reactive protein Human genes 0.000 description 1
- 101710188619 C-type lectin domain family 12 member A Proteins 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- 108091008927 CC chemokine receptors Proteins 0.000 description 1
- 102000005674 CCR Receptors Human genes 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100032937 CD40 ligand Human genes 0.000 description 1
- 108010065524 CD52 Antigen Proteins 0.000 description 1
- 108010084313 CD58 Antigens Proteins 0.000 description 1
- 102100025221 CD70 antigen Human genes 0.000 description 1
- 102100037904 CD9 antigen Human genes 0.000 description 1
- 102000024905 CD99 Human genes 0.000 description 1
- 108060001253 CD99 Proteins 0.000 description 1
- 101150108242 CDC27 gene Proteins 0.000 description 1
- 101150031358 COLEC10 gene Proteins 0.000 description 1
- 108091008925 CX3C chemokine receptors Proteins 0.000 description 1
- 108091008928 CXC chemokine receptors Proteins 0.000 description 1
- 102000054900 CXCR Receptors Human genes 0.000 description 1
- 101100005789 Caenorhabditis elegans cdk-4 gene Proteins 0.000 description 1
- 101100067721 Caenorhabditis elegans gly-3 gene Proteins 0.000 description 1
- 101100314454 Caenorhabditis elegans tra-1 gene Proteins 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 1
- 102100039510 Cancer/testis antigen 2 Human genes 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102100026548 Caspase-8 Human genes 0.000 description 1
- 108090000538 Caspase-8 Proteins 0.000 description 1
- 102100026550 Caspase-9 Human genes 0.000 description 1
- 108090000566 Caspase-9 Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 206010008583 Chloroma Diseases 0.000 description 1
- 102100028757 Chondroitin sulfate proteoglycan 4 Human genes 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- 102100032920 Chromobox protein homolog 2 Human genes 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- 102100038449 Claudin-6 Human genes 0.000 description 1
- 102100035167 Coiled-coil domain-containing protein 54 Human genes 0.000 description 1
- 108010060385 Cyclin B1 Proteins 0.000 description 1
- 102100024462 Cyclin-dependent kinase 4 inhibitor B Human genes 0.000 description 1
- 102000003903 Cyclin-dependent kinases Human genes 0.000 description 1
- 108090000266 Cyclin-dependent kinases Proteins 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 102000012466 Cytochrome P450 1B1 Human genes 0.000 description 1
- 108050002014 Cytochrome P450 1B1 Proteins 0.000 description 1
- 206010050685 Cytokine storm Diseases 0.000 description 1
- 102000000311 Cytosine Deaminase Human genes 0.000 description 1
- 108010080611 Cytosine Deaminase Proteins 0.000 description 1
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Natural products CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 206010012218 Delirium Diseases 0.000 description 1
- 102100029588 Deoxycytidine kinase Human genes 0.000 description 1
- 108010033174 Deoxycytidine kinase Proteins 0.000 description 1
- 102100040606 Dermatan-sulfate epimerase Human genes 0.000 description 1
- 101710127030 Dermatan-sulfate epimerase Proteins 0.000 description 1
- 101100216227 Dictyostelium discoideum anapc3 gene Proteins 0.000 description 1
- 101100095895 Drosophila melanogaster sle gene Proteins 0.000 description 1
- 108050002772 E3 ubiquitin-protein ligase Mdm2 Proteins 0.000 description 1
- 102000012199 E3 ubiquitin-protein ligase Mdm2 Human genes 0.000 description 1
- 101150049307 EEF1A2 gene Proteins 0.000 description 1
- 101150084967 EPCAM gene Proteins 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 206010014958 Eosinophilic leukaemia Diseases 0.000 description 1
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 description 1
- 102100031940 Epithelial cell adhesion molecule Human genes 0.000 description 1
- 208000031637 Erythroblastic Acute Leukemia Diseases 0.000 description 1
- 208000036566 Erythroleukaemia Diseases 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102000008857 Ferritin Human genes 0.000 description 1
- 108050000784 Ferritin Proteins 0.000 description 1
- 238000008416 Ferritin Methods 0.000 description 1
- 102100028043 Fibroblast growth factor 3 Human genes 0.000 description 1
- 108090000382 Fibroblast growth factor 6 Proteins 0.000 description 1
- 102100028075 Fibroblast growth factor 6 Human genes 0.000 description 1
- 208000004463 Follicular Adenocarcinoma Diseases 0.000 description 1
- 102000003817 Fos-related antigen 1 Human genes 0.000 description 1
- 108090000123 Fos-related antigen 1 Proteins 0.000 description 1
- PNNNRSAQSRJVSB-SLPGGIOYSA-N Fucose Natural products C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O PNNNRSAQSRJVSB-SLPGGIOYSA-N 0.000 description 1
- 102100039717 G antigen 1 Human genes 0.000 description 1
- 102100032340 G2/mitotic-specific cyclin-B1 Human genes 0.000 description 1
- 108010012015 GVYDGREHTV Proteins 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 101001077417 Gallus gallus Potassium voltage-gated channel subfamily H member 6 Proteins 0.000 description 1
- 208000003098 Ganglion Cysts Diseases 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- 208000031852 Gastrointestinal stromal cancer Diseases 0.000 description 1
- 208000008999 Giant Cell Carcinoma Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 1
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 1
- 206010018498 Goitre Diseases 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 206010018691 Granuloma Diseases 0.000 description 1
- 208000001258 Hemangiosarcoma Diseases 0.000 description 1
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 1
- 102100028721 Hermansky-Pudlak syndrome 5 protein Human genes 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- 102100035108 High affinity nerve growth factor receptor Human genes 0.000 description 1
- 208000002291 Histiocytic Sarcoma Diseases 0.000 description 1
- 102100032742 Histone-lysine N-methyltransferase SETD2 Human genes 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 102100028092 Homeobox protein Nkx-3.1 Human genes 0.000 description 1
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 1
- 101000779641 Homo sapiens ALK tyrosine kinase receptor Proteins 0.000 description 1
- 101000678435 Homo sapiens Actin-like protein 8 Proteins 0.000 description 1
- 101001042227 Homo sapiens Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 Proteins 0.000 description 1
- 101000753291 Homo sapiens Angiopoietin-1 receptor Proteins 0.000 description 1
- 101000936083 Homo sapiens Baculoviral IAP repeat-containing protein 7 Proteins 0.000 description 1
- 101000716065 Homo sapiens C-C chemokine receptor type 7 Proteins 0.000 description 1
- 101000716063 Homo sapiens C-C chemokine receptor type 8 Proteins 0.000 description 1
- 101000947174 Homo sapiens C-X-C chemokine receptor type 1 Proteins 0.000 description 1
- 101000916050 Homo sapiens C-X-C chemokine receptor type 3 Proteins 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101000738354 Homo sapiens CD9 antigen Proteins 0.000 description 1
- 101100496086 Homo sapiens CLEC12A gene Proteins 0.000 description 1
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 1
- 101000889345 Homo sapiens Cancer/testis antigen 2 Proteins 0.000 description 1
- 101000916489 Homo sapiens Chondroitin sulfate proteoglycan 4 Proteins 0.000 description 1
- 101000797586 Homo sapiens Chromobox protein homolog 2 Proteins 0.000 description 1
- 101000882898 Homo sapiens Claudin-6 Proteins 0.000 description 1
- 101000737052 Homo sapiens Coiled-coil domain-containing protein 54 Proteins 0.000 description 1
- 101000980919 Homo sapiens Cyclin-dependent kinase 4 inhibitor B Proteins 0.000 description 1
- 101000954709 Homo sapiens Doublecortin domain-containing protein 2 Proteins 0.000 description 1
- 101000886137 Homo sapiens G antigen 1 Proteins 0.000 description 1
- 101000985516 Homo sapiens Hermansky-Pudlak syndrome 5 protein Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101000654725 Homo sapiens Histone-lysine N-methyltransferase SETD2 Proteins 0.000 description 1
- 101000578249 Homo sapiens Homeobox protein Nkx-3.1 Proteins 0.000 description 1
- 101001103039 Homo sapiens Inactive tyrosine-protein kinase transmembrane receptor ROR1 Proteins 0.000 description 1
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 1
- 101000614481 Homo sapiens Kidney-associated antigen 1 Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101001051093 Homo sapiens Low-density lipoprotein receptor Proteins 0.000 description 1
- 101001134060 Homo sapiens Melanocyte-stimulating hormone receptor Proteins 0.000 description 1
- 101000628547 Homo sapiens Metalloreductase STEAP1 Proteins 0.000 description 1
- 101000957259 Homo sapiens Mitotic spindle assembly checkpoint protein MAD2A Proteins 0.000 description 1
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 1
- 101001133081 Homo sapiens Mucin-2 Proteins 0.000 description 1
- 101000721712 Homo sapiens NTF2-related export protein 1 Proteins 0.000 description 1
- 101001103036 Homo sapiens Nuclear receptor ROR-alpha Proteins 0.000 description 1
- 101001098352 Homo sapiens OX-2 membrane glycoprotein Proteins 0.000 description 1
- 101000613490 Homo sapiens Paired box protein Pax-3 Proteins 0.000 description 1
- 101000601724 Homo sapiens Paired box protein Pax-5 Proteins 0.000 description 1
- 101000691463 Homo sapiens Placenta-specific protein 1 Proteins 0.000 description 1
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 description 1
- 101001136981 Homo sapiens Proteasome subunit beta type-9 Proteins 0.000 description 1
- 101000880770 Homo sapiens Protein SSX2 Proteins 0.000 description 1
- 101000679365 Homo sapiens Putative tyrosine-protein phosphatase TPTE Proteins 0.000 description 1
- 101001109419 Homo sapiens RNA-binding protein NOB1 Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000857677 Homo sapiens Runt-related transcription factor 1 Proteins 0.000 description 1
- 101000706563 Homo sapiens SUN domain-containing protein 3 Proteins 0.000 description 1
- 101000665137 Homo sapiens Scm-like with four MBT domains protein 1 Proteins 0.000 description 1
- 101001059454 Homo sapiens Serine/threonine-protein kinase MARK2 Proteins 0.000 description 1
- 101000825253 Homo sapiens Sperm protein associated with the nucleus on the X chromosome A Proteins 0.000 description 1
- 101000824971 Homo sapiens Sperm surface protein Sp17 Proteins 0.000 description 1
- 101000873927 Homo sapiens Squamous cell carcinoma antigen recognized by T-cells 3 Proteins 0.000 description 1
- 101000946863 Homo sapiens T-cell surface glycoprotein CD3 delta chain Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101000648075 Homo sapiens Trafficking protein particle complex subunit 1 Proteins 0.000 description 1
- 101000813738 Homo sapiens Transcription factor ETV6 Proteins 0.000 description 1
- 101001010792 Homo sapiens Transcriptional regulator ERG Proteins 0.000 description 1
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 description 1
- 241000192019 Human endogenous retrovirus K Species 0.000 description 1
- 206010048643 Hypereosinophilic syndrome Diseases 0.000 description 1
- 208000001953 Hypotension Diseases 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102100039615 Inactive tyrosine-protein kinase transmembrane receptor ROR1 Human genes 0.000 description 1
- 108050002021 Integrator complex subunit 2 Proteins 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000018682 Interleukin Receptor Common gamma Subunit Human genes 0.000 description 1
- 108010066719 Interleukin Receptor Common gamma Subunit Proteins 0.000 description 1
- 102000003814 Interleukin-10 Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 108010018951 Interleukin-8B Receptors Proteins 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 108010092694 L-Selectin Proteins 0.000 description 1
- SHZGCJCMOBCMKK-DHVFOXMCSA-N L-fucopyranose Chemical compound C[C@@H]1OC(O)[C@@H](O)[C@H](O)[C@@H]1O SHZGCJCMOBCMKK-DHVFOXMCSA-N 0.000 description 1
- 102100033467 L-selectin Human genes 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 206010024305 Leukaemia monocytic Diseases 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 102100032913 Leukocyte surface antigen CD47 Human genes 0.000 description 1
- 208000000265 Lobular Carcinoma Diseases 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 102100024640 Low-density lipoprotein receptor Human genes 0.000 description 1
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 1
- 208000028018 Lymphocytic leukaemia Diseases 0.000 description 1
- 206010025312 Lymphoma AIDS related Diseases 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 108700012912 MYCN Proteins 0.000 description 1
- 101150022024 MYCN gene Proteins 0.000 description 1
- 208000006644 Malignant Fibrous Histiocytoma Diseases 0.000 description 1
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- 102100034216 Melanocyte-stimulating hormone receptor Human genes 0.000 description 1
- 206010027145 Melanocytic naevus Diseases 0.000 description 1
- 201000009574 Mesenchymal Chondrosarcoma Diseases 0.000 description 1
- 208000010153 Mesonephroma Diseases 0.000 description 1
- 102100026712 Metalloreductase STEAP1 Human genes 0.000 description 1
- 206010054949 Metaplasia Diseases 0.000 description 1
- 102100038792 Mitotic spindle assembly checkpoint protein MAD2A Human genes 0.000 description 1
- 102100034256 Mucin-1 Human genes 0.000 description 1
- 102100034263 Mucin-2 Human genes 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101100381978 Mus musculus Braf gene Proteins 0.000 description 1
- 101001049378 Mus musculus Ephrin-B2 Proteins 0.000 description 1
- 101001062862 Mus musculus Fatty acid-binding protein, adipocyte Proteins 0.000 description 1
- 101100369076 Mus musculus Tdgf1 gene Proteins 0.000 description 1
- 108090000973 Myeloblastin Proteins 0.000 description 1
- 102100034681 Myeloblastin Human genes 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 102100030856 Myoglobin Human genes 0.000 description 1
- 108010062374 Myoglobin Proteins 0.000 description 1
- 108700026495 N-Myc Proto-Oncogene Proteins 0.000 description 1
- 102100030124 N-myc proto-oncogene protein Human genes 0.000 description 1
- 206010028813 Nausea Diseases 0.000 description 1
- 208000007256 Nevus Diseases 0.000 description 1
- 206010029488 Nodular melanoma Diseases 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 102100037589 OX-2 membrane glycoprotein Human genes 0.000 description 1
- 208000007871 Odontogenic Tumors Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 208000010191 Osteitis Deformans Diseases 0.000 description 1
- 102000004316 Oxidoreductases Human genes 0.000 description 1
- 108090000854 Oxidoreductases Proteins 0.000 description 1
- 108091007960 PI3Ks Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 102100034640 PWWP domain-containing DNA repair factor 3A Human genes 0.000 description 1
- 108050007154 PWWP domain-containing DNA repair factor 3A Proteins 0.000 description 1
- 208000027868 Paget disease Diseases 0.000 description 1
- 102100040891 Paired box protein Pax-3 Human genes 0.000 description 1
- 102100037504 Paired box protein Pax-5 Human genes 0.000 description 1
- 101000621505 Peanut clump virus (isolate 87/TGTA2) Suppressor of RNA silencing Proteins 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 241000286209 Phasianidae Species 0.000 description 1
- 108090000430 Phosphatidylinositol 3-kinases Proteins 0.000 description 1
- 102000003993 Phosphatidylinositol 3-kinases Human genes 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 208000009077 Pigmented Nevus Diseases 0.000 description 1
- 208000007641 Pinealoma Diseases 0.000 description 1
- 102100026181 Placenta-specific protein 1 Human genes 0.000 description 1
- 208000007452 Plasmacytoma Diseases 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 102100036735 Prostate stem cell antigen Human genes 0.000 description 1
- 101710180313 Protease 3 Proteins 0.000 description 1
- 102100035764 Proteasome subunit beta type-9 Human genes 0.000 description 1
- 108091008611 Protein Kinase B Proteins 0.000 description 1
- 102100037686 Protein SSX2 Human genes 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 102100022578 Putative tyrosine-protein phosphatase TPTE Human genes 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- 102100033810 RAC-alpha serine/threonine-protein kinase Human genes 0.000 description 1
- 108010081208 RMFPNAPYL Proteins 0.000 description 1
- 102100022491 RNA-binding protein NOB1 Human genes 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101001039269 Rattus norvegicus Glycine N-methyltransferase Proteins 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 206010062237 Renal impairment Diseases 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 1
- 102100025373 Runt-related transcription factor 1 Human genes 0.000 description 1
- 108050003189 SH2B adapter protein 1 Proteins 0.000 description 1
- 108010017324 STAT3 Transcription Factor Proteins 0.000 description 1
- 102100031129 SUN domain-containing protein 3 Human genes 0.000 description 1
- 208000004337 Salivary Gland Neoplasms Diseases 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 102100038689 Scm-like with four MBT domains protein 1 Human genes 0.000 description 1
- 102100028904 Serine/threonine-protein kinase MARK2 Human genes 0.000 description 1
- 101710173693 Short transient receptor potential channel 1 Proteins 0.000 description 1
- 102100024040 Signal transducer and activator of transcription 3 Human genes 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 241000907663 Siproeta stelenes Species 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 102100022327 Sperm protein associated with the nucleus on the X chromosome A Human genes 0.000 description 1
- 208000000277 Splenic Neoplasms Diseases 0.000 description 1
- 101710185775 Squamous cell carcinoma antigen recognized by T-cells 3 Proteins 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 108010002687 Survivin Proteins 0.000 description 1
- 208000005400 Synovial Cyst Diseases 0.000 description 1
- 102100035891 T-cell surface glycoprotein CD3 delta chain Human genes 0.000 description 1
- 102100035794 T-cell surface glycoprotein CD3 epsilon chain Human genes 0.000 description 1
- 101710131569 T-cell surface glycoprotein CD3 gamma chain Proteins 0.000 description 1
- 102100037906 T-cell surface glycoprotein CD3 zeta chain Human genes 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 108700012457 TACSTD2 Proteins 0.000 description 1
- 102000046283 TNF-Related Apoptosis-Inducing Ligand Human genes 0.000 description 1
- 208000001871 Tachycardia Diseases 0.000 description 1
- 108010017842 Telomerase Proteins 0.000 description 1
- 206010043276 Teratoma Diseases 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 201000009365 Thymic carcinoma Diseases 0.000 description 1
- 102100037357 Thymidylate kinase Human genes 0.000 description 1
- 102100025256 Trafficking protein particle complex subunit 1 Human genes 0.000 description 1
- 102100039580 Transcription factor ETV6 Human genes 0.000 description 1
- 101800001690 Transmembrane protein gp41 Proteins 0.000 description 1
- LVTKHGUGBGNBPL-UHFFFAOYSA-N Trp-P-1 Chemical compound N1C2=CC=CC=C2C2=C1C(C)=C(N)N=C2C LVTKHGUGBGNBPL-UHFFFAOYSA-N 0.000 description 1
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 1
- 102100032101 Tumor necrosis factor ligand superfamily member 9 Human genes 0.000 description 1
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 description 1
- 101710178300 Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 description 1
- 101710187743 Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 1
- 102100033732 Tumor necrosis factor receptor superfamily member 1A Human genes 0.000 description 1
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 1
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 102100027212 Tumor-associated calcium signal transducer 2 Human genes 0.000 description 1
- 102100027244 U4/U6.U5 tri-snRNP-associated protein 1 Human genes 0.000 description 1
- 101710155955 U4/U6.U5 tri-snRNP-associated protein 1 Proteins 0.000 description 1
- 101150110932 US19 gene Proteins 0.000 description 1
- 208000015778 Undifferentiated pleomorphic sarcoma Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 229960004150 aciclovir Drugs 0.000 description 1
- MKUXAQIIEYXACX-UHFFFAOYSA-N aciclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCO)C=N2 MKUXAQIIEYXACX-UHFFFAOYSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 208000006336 acinar cell carcinoma Diseases 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 208000021841 acute erythroid leukemia Diseases 0.000 description 1
- 230000033289 adaptive immune response Effects 0.000 description 1
- 208000002517 adenoid cystic carcinoma Diseases 0.000 description 1
- 201000008395 adenosquamous carcinoma Diseases 0.000 description 1
- 239000000853 adhesive Substances 0.000 description 1
- 230000001070 adhesive effect Effects 0.000 description 1
- 201000002454 adrenal cortex cancer Diseases 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 208000030961 allergic reaction Diseases 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 108010034034 alpha-1,6-mannosylglycoprotein beta 1,6-N-acetylglucosaminyltransferase Proteins 0.000 description 1
- 206010065867 alveolar rhabdomyosarcoma Diseases 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 108010080146 androgen receptors Proteins 0.000 description 1
- 230000001548 androgenic effect Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000003474 anti-emetic effect Effects 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 201000011165 anus cancer Diseases 0.000 description 1
- 201000007436 apocrine adenocarcinoma Diseases 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 108010055066 asparaginylendopeptidase Proteins 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 208000026900 bile duct neoplasm Diseases 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 208000007047 blue nevus Diseases 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 201000011143 bone giant cell tumor Diseases 0.000 description 1
- 201000006491 bone marrow cancer Diseases 0.000 description 1
- 206010006007 bone sarcoma Diseases 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 201000003714 breast lobular carcinoma Diseases 0.000 description 1
- 208000002458 carcinoid tumor Diseases 0.000 description 1
- 210000004534 cecum Anatomy 0.000 description 1
- 230000011712 cell development Effects 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 201000006662 cervical adenocarcinoma Diseases 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 201000005217 chondroblastoma Diseases 0.000 description 1
- 208000021668 chronic eosinophilic leukemia Diseases 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 230000000536 complexating effect Effects 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 230000001054 cortical effect Effects 0.000 description 1
- 238000005138 cryopreservation Methods 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 108010000742 dTMP kinase Proteins 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 235000015872 dietary supplement Nutrition 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 208000037765 diseases and disorders Diseases 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000002651 drug therapy Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 206010015037 epilepsy Diseases 0.000 description 1
- 201000010877 epithelioid cell melanoma Diseases 0.000 description 1
- 108700010919 epstein-barr-virus proteins Proteins 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 201000008825 fibrosarcoma of bone Diseases 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- XRECTZIEBJDKEO-UHFFFAOYSA-N flucytosine Chemical compound NC1=NC(=O)NC=C1F XRECTZIEBJDKEO-UHFFFAOYSA-N 0.000 description 1
- 229960004413 flucytosine Drugs 0.000 description 1
- 201000003444 follicular lymphoma Diseases 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 230000009454 functional inhibition Effects 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- 229960002963 ganciclovir Drugs 0.000 description 1
- IRSCQMHQWWYFCW-UHFFFAOYSA-N ganciclovir Chemical compound O=C1NC(N)=NC2=C1N=CN2COC(CO)CO IRSCQMHQWWYFCW-UHFFFAOYSA-N 0.000 description 1
- 201000000052 gastrinoma Diseases 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 102000054766 genetic haplotypes Human genes 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 230000001434 glomerular Effects 0.000 description 1
- 201000003872 goiter Diseases 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 210000002503 granulosa cell Anatomy 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 208000006359 hepatoblastoma Diseases 0.000 description 1
- 239000008241 heterogeneous mixture Substances 0.000 description 1
- 208000029824 high grade glioma Diseases 0.000 description 1
- 230000003284 homeostatic effect Effects 0.000 description 1
- 238000001794 hormone therapy Methods 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 230000036543 hypotension Effects 0.000 description 1
- 230000007954 hypoxia Effects 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 239000012642 immune effector Substances 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 210000004263 induced pluripotent stem cell Anatomy 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000011261 inert gas Substances 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 108090000237 interleukin-24 Proteins 0.000 description 1
- 102000003898 interleukin-24 Human genes 0.000 description 1
- 238000010212 intracellular staining Methods 0.000 description 1
- 206010073095 invasive ductal breast carcinoma Diseases 0.000 description 1
- 201000010985 invasive ductal carcinoma Diseases 0.000 description 1
- 206010073096 invasive lobular breast carcinoma Diseases 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 208000022013 kidney Wilms tumor Diseases 0.000 description 1
- 230000005977 kidney dysfunction Effects 0.000 description 1
- 210000000867 larynx Anatomy 0.000 description 1
- 206010024217 lentigo Diseases 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 125000003473 lipid group Chemical group 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 230000005976 liver dysfunction Effects 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 201000005249 lung adenocarcinoma Diseases 0.000 description 1
- 201000000014 lung giant cell carcinoma Diseases 0.000 description 1
- 201000003866 lung sarcoma Diseases 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 230000001926 lymphatic effect Effects 0.000 description 1
- 208000003747 lymphoid leukemia Diseases 0.000 description 1
- 208000025036 lymphosarcoma Diseases 0.000 description 1
- 201000000564 macroglobulinemia Diseases 0.000 description 1
- 201000006812 malignant histiocytosis Diseases 0.000 description 1
- 201000009020 malignant peripheral nerve sheath tumor Diseases 0.000 description 1
- 208000025854 malignant tumor of adrenal cortex Diseases 0.000 description 1
- 208000027202 mammary Paget disease Diseases 0.000 description 1
- 210000005075 mammary gland Anatomy 0.000 description 1
- 208000000516 mast-cell leukemia Diseases 0.000 description 1
- 201000008749 mast-cell sarcoma Diseases 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 1
- 210000003593 megakaryocyte Anatomy 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 201000008806 mesenchymal cell neoplasm Diseases 0.000 description 1
- 208000011831 mesonephric neoplasm Diseases 0.000 description 1
- 230000015689 metaplastic ossification Effects 0.000 description 1
- 239000011325 microbead Substances 0.000 description 1
- 201000006894 monocytic leukemia Diseases 0.000 description 1
- 201000010879 mucinous adenocarcinoma Diseases 0.000 description 1
- 201000005962 mycosis fungoides Diseases 0.000 description 1
- 201000005987 myeloid sarcoma Diseases 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- 230000008693 nausea Effects 0.000 description 1
- 210000003739 neck Anatomy 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 210000001020 neural plate Anatomy 0.000 description 1
- 208000007538 neurilemmoma Diseases 0.000 description 1
- 208000029974 neurofibrosarcoma Diseases 0.000 description 1
- 230000001272 neurogenic effect Effects 0.000 description 1
- 201000000032 nodular malignant melanoma Diseases 0.000 description 1
- 210000000948 non-nucleated cell Anatomy 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 201000010198 papillary carcinoma Diseases 0.000 description 1
- 201000010210 papillary cystadenocarcinoma Diseases 0.000 description 1
- 201000001494 papillary transitional carcinoma Diseases 0.000 description 1
- 208000031101 papillary transitional cell carcinoma Diseases 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 210000002568 pbsc Anatomy 0.000 description 1
- 239000000813 peptide hormone Substances 0.000 description 1
- 201000002628 peritoneum cancer Diseases 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 208000031223 plasma cell leukemia Diseases 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 239000002510 pyrogen Substances 0.000 description 1
- JFINOWIINSTUNY-UHFFFAOYSA-N pyrrolidin-3-ylmethanesulfonamide Chemical compound NS(=O)(=O)CC1CCNC1 JFINOWIINSTUNY-UHFFFAOYSA-N 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 1
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 201000007416 salivary gland adenoid cystic carcinoma Diseases 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 208000014212 sarcomatoid carcinoma Diseases 0.000 description 1
- 206010039667 schwannoma Diseases 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000002784 sclerotic effect Effects 0.000 description 1
- 208000018964 sebaceous gland cancer Diseases 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 230000015607 signal release Effects 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 208000000649 small cell carcinoma Diseases 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 208000021795 small intestine disease Diseases 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 201000002471 spleen cancer Diseases 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 101150050955 stn gene Proteins 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 210000002536 stromal cell Anatomy 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 230000006794 tachycardia Effects 0.000 description 1
- 230000002381 testicular Effects 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 208000015191 thyroid gland papillary and follicular carcinoma Diseases 0.000 description 1
- 230000036962 time dependent Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 108091006106 transcriptional activators Proteins 0.000 description 1
- 206010044412 transitional cell carcinoma Diseases 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 230000000381 tumorigenic effect Effects 0.000 description 1
- 210000003954 umbilical cord Anatomy 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 230000002861 ventricular Effects 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
Landscapes
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
Embodiments of the invention include methods and compositions wherein NK cells are artificially modified to express T cell receptors and CD3 co-receptors on NK cells that do not naturally express T cell receptors and CD3 co-receptors. The modified NK cells function effectively with bispecific or multispecific antibodies tailored to comprise anti-CD 3 antibodies that bind to the modified NK cells, thereby triggering signaling, activation, and cytotoxicity of target cells to which the antibodies also bind. Thus, NK cells are specifically configured to work effectively with bispecific NK cell binding molecules (bikes) as well as bispecific T cell binding molecules (bikes).
Description
The present application claims priority to U.S. provisional patent application Ser. No. 63/225,281 filed on 7.23 of 2021, and also claims priority to U.S. provisional patent application Ser. No. 63/310,526 filed on 2.15 of 2022, and also claims priority to U.S. provisional patent application Ser. No. 63/344,931 filed on 5.23 of 2022, each of which is incorporated herein by reference in its entirety.
Technical Field
The present invention relates to at least the fields of immunology, cell biology, molecular biology and medicine, including at least cancer medicine.
Background
Natural Killer (NK) cells have been investigated as potential anti-tumor effectors, but many obstacles limit their therapeutic utility, mainly related to their lack of antigen specificity. One approach to overcome this is to transduce NK cells with Chimeric Antigen Receptors (CARs) or engineered T Cell Receptors (TCRs) to target the desired antigen. In T cells, bispecific or multispecific antibodies, such as bispecific T cell engagement molecules (bites), may be utilized that bind CD3 on the T cell surface and also bind antigens on the cancer cell surface. CD3 consists of four distinct chains, in mammals, the complex comprises one CD3 gamma chain, one CD3 delta chain and two CD3 epsilon chains. These chains bind to the T Cell Receptor (TCR) and zeta chains (zeta chains) to generate activation signals in T lymphocytes. However, NK cells do not naturally express the CD3 receptor complex or TCR.
The present invention meets a long felt need in the art for improved immunotherapy, including immunotherapy with NK cells.
Disclosure of Invention
Embodiments of the invention include methods and compositions for treating individuals with cancer using adoptive cell therapies. In particular embodiments, a therapeutically effective amount of dichotomy therapy (bipartite therapy) is provided to an individual that includes modified NK cells and antibodies that are capable of binding NK cells to initiate signaling, activation, and killing of target cells. The present invention relates to NK cells that have been modified to express a variety of proteins that are not naturally expressed in NK cells and work together, including heterologous proteins that are not naturally present in NK cells on the surface of NK cells.
In particular embodiments, NK cells are engineered to express one or more proteins from the CD3 co-receptor complex and optionally the TCR receptor complex, and each protein is typically present on the T cell surface. Such engineering provides greater versatility for use of NK cells with a variety of bispecific or multispecific antibodies, including antibodies comprising anti-CD 3 antibodies (e.g., anti-CD 3 scFv). In particular embodiments, the modified NK cells are administered to an individual in need thereof with one or more bispecific or multispecific antibodies each having one antibody that targets CD3 and one antibody that binds a desired antigen (e.g., a cancer antigen). As a result, in certain cases, NK cells expressing CD3 are able to bind to the anti-CD 3 antibody portion of the bispecific or multispecific antibody, and antibodies that bind to the cancer antigen on the surface of the cancer cell. This coordinated binding between NK cells and antibodies results in activation of cytotoxicity against the target cancer antigen.
In particular embodiments, the invention relates to modified NK cells expressing all or part of the CD3 complex with or without a TCR, and in certain cases, a single CD3 chain is heterologously linked to an NK-associated signaling domain, all of which allow the use of modified NK cells with various bispecific antibodies.
Embodiments of the invention include compositions comprising NK cells modified to express a portion or all or any combination of single strands of cd3δ, cd3ε, cd3γ, or cd3ζ. In some cases, NK cells are modified to express a T Cell Receptor (TCR) αβ chain or a tcrγδ chain. NK cells may be modified to express some or all of cd3ζ, two cd3ε, cd3δ, and cd3γ. In some cases, NK cells are modified to express the full length: cd3ζ, cd3ε, cd3δ and/or cd3γ. In particular instances, any one or more of cd3ζ, cd3ε, cd3δ, and cd3γ is heterologously linked to one or more intracellular signaling domains. The intracellular signaling domain may be selected from the group consisting of CD16, NKG2D, DAP, DAP12, 2B4, 4-1BB, CD2, CD28, and combinations thereof. In some embodiments, the intracellular signaling domain is fused to cd3ζ. In some embodiments, the intracellular signaling domain is derived from DAP10. In some embodiments, the intracellular signaling domain is derived from CD28. In some embodiments, the intracellular signaling domain comprises a sequence derived from DAP10 and a sequence derived from CD28. In some embodiments, the intracellular signaling domain may also include other costimulatory signals related to NK cell function, such as but not limited to 2B4, DNA, 4-1BB, DAP12, NKG2D, and the like. In certain embodiments, the composition further comprises one or more bispecific or multispecific antibodies, wherein the bispecific or multispecific antibodies comprise an anti-CD 3 antibody. NK cells may express and/or complex with antibodies. In some embodiments, the TCR is directed against a cancer antigen or a viral antigen. In particular embodiments, the NK cells are derived from umbilical Cord Blood (CB), peripheral Blood (PB), bone marrow, stem cells, or mixtures thereof. In some embodiments, the TCR is directed against an NY-ESO antigen. In some embodiments, the TCR is directed against a PRAME antigen. NK cells may be pre-activated, for example with one or more cytokines including: such as IL-2, IL-7, IL-12, IL-15, IL-18, IL-21, or combinations thereof. In some embodiments, NK cells are expanded, for example in the presence of IL-2. In particular embodiments, NK cells are modified to express one or more heterologous proteins, such as one or more engineered antigen receptors, one or more cytokines, one or more homing receptors, and/or one or more chemokine receptors. In particular instances, the engineered antigen receptor is a chimeric antigen receptor and/or an engineered T cell receptor. In some cases, the heterologous protein is a cytokine, e.g., a cytokine selected from the group consisting of IL-15, IL-12, IL-2, IL-18, IL-21, IL-23, GMCSF, or a combination thereof. The cytokine may be membrane bound, and the membrane bound cytokine may comprise a transmembrane domain from CD8, CD28, CD27, B7H3, igG1, igG4, CD4, DAP10 or DAP 12. In certain instances, NK cells express chimeric antigen receptors and cytokines. In some cases, the bispecific antibody comprises an antibody that targets a cancer antigen.
Embodiments of the present invention include compositions comprising a complex comprising: (1) NK cells modified to express part or all of the CD3 receptor complex and optionally modified to express a T Cell Receptor (TCR) αβ chain or a tcrγδ chain; and (2) a bispecific or multispecific antibody, wherein the bispecific or multispecific antibody comprises an anti-CD 3 antibody which binds to CD3 on NK cells. In particular embodiments, the complex is contained in a pharmaceutically acceptable excipient. The complex may be contained in a delivery device.
In a particular embodiment, there is a method of treating cancer in an individual comprising the step of administering to the individual a therapeutically effective amount of any one of the compositions contemplated herein. In some embodiments, the NK cells and the antibody are administered to the individual simultaneously. NK cells and antibodies may or may not be administered in the same formulation. NK cells and antibodies may be pre-complexed prior to administration to an individual. In certain embodiments, NK cells and antibodies are administered to an individual at different times. NK cells and antibodies can be administered by infusion. In certain embodiments, the NK cells are autologous or allogeneic with respect to the individual.
Embodiments of the invention include a method of redirecting NK cells specific for a cancer antigen with a bispecific or multispecific anti-CD 3 antibody for use in treating an individual, the method comprising the step of administering the antibody and optionally NK cells expressing part or all of a CD3 receptor complex and optionally expressing part or all of a tcrαβ chain or tcrγδ chain to the individual. In certain embodiments, the method further comprises the step of modifying the NK cells to express part or all of the CD3 receptor complex. In particular embodiments, the method further comprises the step of modifying the NK cell to express a tcrαβ chain or a tcrγδ chain. In some cases, the method further comprises the step of modifying the NK cells to express one or more heterologous proteins.
Other objects, features and advantages of the present invention will become apparent from the following detailed description. It should be understood, however, that the detailed description and the specific examples, while indicating specific embodiments of the invention, are given by way of illustration only, since various changes and modifications within the spirit and scope of the invention will become apparent to those skilled in the art from this detailed description.
Drawings
The following drawings form a part of the present specification and are included to further demonstrate certain aspects of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
FIG. 1A shows various embodiments of NK cells engineered to express CD3, including use with various heterologous proteins such as cytokines, bispecific NK cell binding molecules, and engineered antigen receptors (CARs and/or TCRs). Figure 1B shows NK cells carrying CD3 and TCR for optimal cancer immunotherapy. FIG. 1C shows an example of a single chimeric CD3 construct.
FIG. 2A shows one example of an expression construct for the CD3 receptor complex component of transduced or transfected NK cells. FIG. 2B shows an example of a plasmid map of a representative expression construct.
FIG. 3 provides a table of various TCR/CD3 expression construct designs for NK-TCR engineering.
Figure 4 shows expression of CD3 on engineered NK cells on day 4 after transduction with one example of a CMV-guided TCR complex.
FIG. 5 shows expression of TCR on engineered NK cells on day 4 after CMV-directed TCR complex transduction.
FIG. 6 shows expression of TCR/CD3 on engineered NK cells on day 6 after CMV-directed TCR complex transduction into cells.
FIG. 7 shows the binding of one example of CD3-CD19 BiTE on NK cells at different concentrations by CD3/TCR complex on NK cells.
FIG. 8 shows TNF alpha and CD107a cytokine production of NK-TCR following stimulation with plate-bound CD3 antibody.
FIG. 9 shows the phosphorylation of CD3z in NK TCR/CD3 cells after crosslinking CD 3.
FIGS. 10A-10B show that pre-culturing NK cells expressing TCR/CD3 with CD3-CD19 BiTE increases their killing activity against Raji cells. FIG. 10A shows the effector to target ratio of 1:1, and FIG. 10B shows the effector to target ratio of 1:5.
FIG. 11 provides a schematic representation of the transduction of multiple retroviruses to produce NK cells expressing CD3, IL-15 and TCR complexes.
FIG. 12 shows expression of NY-ESO TCR on NK cells transduced with uTNK. WT refers to a wild-type CD3 molecule with IL-15; a refers to CD3-CD28 with IL-15; b is CD3-DAP10 with IL-15; c refers to CD3-CD28-Dap10 with IL-15.
FIG. 13 shows the number of TCR molecules expressed on NK cells (per cell). WT refers to a wild-type CD3 molecule with IL-15; a refers to CD3-CD28 with IL-15; b refers to CD3-DAP10 with IL-15; c refers to CD3-CD28-Dap10 with IL-15. Phycoerythrin fluorescent quantification kit (BD Biosciences) was used to determine the number of NY-ESO TCR molecules on NK cells.
FIG. 14 shows expression of NY-ESO TCR on T cells.
FIG. 15 shows that NK cells transduced with NY-ESO TCR kill NY-ESO peptide-loaded target cells in a dose-dependent manner. WT refers to a wild-type CD3 molecule with IL-15; a refers to CD3-CD28 with IL-15; b is CD3-DAP10 with IL-15; c refers to CD3-CD28-Dap10 with IL-15.
FIG. 16 shows the expression of endogenous NY-ESO on human tumor cell lines.
FIG. 17 shows that NY-ESO TCR transduced T cells kill tumor targets expressing NY-ESO.
FIG. 18 provides the results that NY-ESO TCR transduced NK cells can kill NY-ESO expressing tumor targets even at low E:T ratios. WT refers to a wild-type CD3 molecule with IL-15; a refers to CD3-CD28 with IL-15; b is CD3-DAP10 with IL-15; c refers to CD3-CD28-Dap10 with IL-15.
FIGS. 19A and 19B show that NY-ESO transduced NK cells have a similar phenotype (19A) and expression pattern (19B) as NT NK cells. WT refers to a wild-type CD3 molecule with IL-15; a refers to CD3-CD28 with IL-15; b is CD3-DAP10 with IL-15; c refers to CD3-CD28-Dap10 with IL-15.
FIG. 20 provides a table showing the cellular composition of the amplified uTNK products. WT refers to a wild-type CD3 molecule with IL-15; a refers to CD3-CD28 with IL-15; b refers to CD3-DAP10 with IL-15; c refers to CD3-CD28-Dap10 with IL-15.
Figure 21A shows that NK cells can be transduced successfully with CD3 and TCR constant α - β (TCRCab) (referred to as TCR6 construct) and engineered NK cells can bind Blinatumumab (figure 21B) and selectively kill cd19+ lymphoma targets (figure 21C).
FIGS. 22A-22C show in vivo activity of effector cells (e.g., NK cells or T cells) comprising NY-ESO targeted TCRs. Fig. 22A is a schematic diagram of experimental steps performed. FIG. 22B shows bioluminescence imaging over time (day 1, day 7, day 14 and day 21) of mice implanted with firefly luciferase (FFluc) -transduced U266B.1 cells with control, NY-ESO TCR NK cells or NY-ESO TCR T cells (NK cells containing WT, #A or #BUT-NK 15-NY ESO TCR constructs, respectively; WT refers to wild-type CD3 molecule with IL-15; #A refers to CD3-CD28 with IL-15; #B refers to CD3-DAP10 with IL-15). Fig. 22C is a graphical quantification of the bioluminescence mean radiation shown in fig. 22B. These results indicate that effector cells comprising the NY-ESO TCR constructs described herein strongly inhibit tumor growth in vivo.
FIGS. 23A-B show in vitro activity of effector cells (e.g., NK cells or T cells) comprising NY-ESO targeted TCR and UT-NK15 constructs. FIG. 23A is an image of a cell sphere formed by osteosarcoma tumor cell line Saos-2 stably transduced to express GFP, used to test the cytotoxic activity of NK cells and T cells expressing NY-ESO1 specific TCR. Fig. 23B is a graph showing the percent cytotoxicity (Y-axis) of representative images after 3 days of co-culture. NK cells were co-transduced with NY-ESO-TCR and UT-NK15 signaling complexes, with UT-NK15 signaling complexes co-expressing different co-stimulatory molecules fused to the CD3 zeta signaling chain or a TCR complex without IL-15. T cells were transduced with NY-ESO TCR alone. Abbreviations in the figures: 28 Cd3ζ fused to CD28 costimulatory domain; 10 Cd3ζ fused to Dap10 costimulatory domain; 8 = CD8 a/β co-receptor as part of NY ESO TCR construct; wo IL-15 = the construct contained only cd3ζ, ε, γ and δ TCR complexes, without co-stimulation or IL-15.
FIGS. 24A-D show in vivo activity of effector cells (e.g., NK cells or T cells) comprising NY-ESO targeted TCR and UT-NK15 constructs. FIG. 24A depicts a plan for in vivo studies to test the activity of different NY ESO TCR transduced NK cells and T cells. FIG. 24B depicts BLI imaging results from the test described and performed in FIG. 24A, mice were injected with U266 tumor cells, and three days later received T cells transduced with NY ESO-specific TCR or NK cells co-transduced with NY-ESO TCR and UT-NK15 (CD 3 zeta fused with CD28 in UT-NK15, labeled NY-ESO NK UT-NK15 CD28 or NY-ESO TCR UTNK-15CD28 NK cells). The tumor group alone served as a control. Fig. 24C depicts the average radiation intensity of a region of interest of an animal tested according to fig. 24A and imaged in fig. 24B. Fig. 24D is a graph depicting survival curves for the above-described animal groups.
FIG. 25 shows in vivo activity of effector cells (e.g., NK cells) engineered to express NY ESO TCR and CD3 complexes, either with or without IL-15 transgene in the constructs. NSG mice were irradiated (300 cGy) and the next day by tail vein injection of 500,000U 266 cells (HLA-A 2 positive, NY-ESO expressing myeloma cell line). Three days later, mice received 500 ten thousand TCR-transduced T cells or NK cells. Tumor control in mice was monitored by BLI imaging. NK cells were transduced with NY-ESO specific TCR (with or without expression of CD 8. Alpha./beta. Co-receptor), co-transduced with CD3 complex without IL-15 transgene, or co-transduced with UT-NK15 expressing CD3 zeta fused with CD28 co-stimulatory molecule (UT-NK 15 CD 28) or UT-NK15 expressing CD3 zeta fused with DAP10 co-stimulatory molecule (UT-NK 15 DAP 10).
Figures 26A-C show in vitro expression of antigens preferentially expressed in melanoma (PRAME) TCRs on effector cells (e.g., NK cells or T cells) and in vitro activity of the cells. FIG. 26A shows the expression of UT-NK15 (x-axis, CD 3) and PRAME-specific TCR (y-axis, TCR) in NK cells (TCR clone 46, 54 or DSK3, respectively), or PRAME-specific TCR in T cells transduced with the same (TCR clone 46 or 54). Figure 26B shows in vitro cytotoxicity of NK cells expressing PRAME-specific TCRs against the U266 myeloma cell line. Cytotoxicity of U266 myeloma cells on T cells transduced with PRAME-specific TCR and NK cells transduced with UT-NK15 and PRAME-specific TCR was measured using Incucyte live cell imaging. GFP-expressing U266 cells were co-cultured with PRAME-specific TCR-expressing T cells or NK cells at a 1:1 effector to target ratio. A decrease in GFP expression indicates cell death. After 26 hours, a second round of 50,000 tumor cells (referred to as "re-challenge") was added to each well for the tumor re-challenge assay. The open symbols represent T cells, while the filled symbols represent NK cells. Nt=untransduced. Figure 26C shows in vitro cytotoxicity of NK cells expressing PRAME-specific TCRs against UA375 melanoma cell lines. Cytotoxicity of UA375 melanoma cells with T cells transduced with PRAME-specific TCRs and NK cells transduced with UT-NK15 and PRAME-specific TCRs (PRAME-specific TCR clone 46 (TCR-46), PRAME-specific TCR clone 54 (TCR-54) or PRAME-specific TCR clone DSK3 (DSK)) was measured using intucyte live cell imaging. GFP-expressing UA375 cells were co-cultured with PRAME-expressing T cells or NK cells at a ratio of effector to target of 1:1. A decrease in GFP expression indicates cell death. After 26 hours, a second round of 50,000 tumor cells were added to each well for tumor re-challenge assays. The open symbols represent T cells, while the filled symbols represent NK cells. Nt=untransduced.
Detailed Description
The words "a" and "an" when used in this specification (including the claims) with the word "comprising" mean "one or more" in accordance with the long-standing patent law convention. Some embodiments of the present disclosure may consist of or consist essentially of one or more elements, method steps, and/or methods of the present disclosure. It is contemplated that any of the methods or compositions described herein may be practiced with respect to any other of the methods or compositions described herein, and that different embodiments may be combined.
Throughout this specification, unless the context requires otherwise, the words "comprise," "comprising," and "include" will be understood to imply the inclusion of a stated step or element or group of steps or elements but not the exclusion of any other step or element or group of steps or elements. "consisting of … …" is intended to include and be limited to anything in the middle of the phrase "consisting of … …". Thus, the phrase "consisting of … …" indicates that the listed elements are required or optional, and that no other elements may be present. "consisting essentially of … …" is intended to include any element listed in the middle of the phrase and is limited to other elements that do not interfere with or contribute to the activity or effect specified in the present invention. Thus, the phrase "consisting essentially of … …" indicates that the recited element is essential or optional, but that no other element is optional and may or may not be present depending on whether it affects the activity or action of the recited element.
Throughout this specification, reference to "one embodiment," "an embodiment," "a particular embodiment," "a related embodiment," "an additional embodiment," or "another embodiment," or a combination thereof, means that a particular feature, structure, or characteristic described in connection with the embodiment is included in at least one embodiment of the present invention. Thus, the appearances of the phrase above in various places throughout this specification are not necessarily all referring to the same embodiment. Furthermore, the particular features, structures, or characteristics may be combined in any suitable manner in one or more embodiments.
As used herein, the terms "or" and/or "are used to describe a plurality of components that are combined or are mutually exclusive. For example, "x, y, and/or z" may refer to "x" alone, "y" alone, "z," "x, y, and z," "x and y," or z, "" x or (y and z) "or" x or y, or z. It is specifically contemplated that x, y or z may be specifically excluded from embodiments.
In the present application, the term "about" is used in accordance with its ordinary and customary meaning in the art of cell and molecular biology to indicate the standard deviation of a value comprising the error of a device or method for determining the value.
As used herein, the term "CD3 receptor complex" or "CD3 co-receptor complex" refers to a protein complex that essentially acts as a T cell co-receptor and consists of a cd3ζ chain, a cd3γ chain, one cd3δ chain, and two cd3ε chains (although only one cd3ε chain is used in the alternative).
The term "engineered" as used herein refers to artificially created entities, including cells, nucleic acids, polypeptides, vectors, and the like. In at least some instances, the engineered entity is synthetic and contains elements that do not naturally occur or are configured in the manner in which they are used in the present disclosure. In certain embodiments, the vector is engineered by recombinant nucleic acid techniques and the cells are engineered by transfection or transduction of the engineered vector. The cell may be engineered to express a heterologous protein that the cell does not naturally express, either because the heterologous protein is recombinant or synthetic, or because the cell does not naturally express the protein.
The phrase "pharmaceutically or pharmacologically acceptable" refers to molecular entities and compositions that do not produce adverse, allergic, or other untoward reactions when properly administered to an animal (e.g., a human). In accordance with the present invention, the person skilled in the art will be aware of the preparation of pharmaceutical compositions comprising antibodies or additional active ingredients. Furthermore, for animal (e.g., human) administration, it is understood that the preparation should meet sterility, pyrogenicity, general safety and purity standards as required by the FDA office of biological standards.
As used herein, "pharmaceutically acceptable carrier" includes: any and all aqueous solvents (e.g., water, alcohol/water solutions, saline solutions, parenteral vehicles such as sodium chloride, ringer's dextrose, and the like), non-aqueous solvents (e.g., propylene glycol, polyethylene glycol, vegetable oils, and injectable organic esters such as ethyl oleate), dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial or antifungal agents, antioxidants, chelating agents, and inert gases), isotonic agents, absorption delaying agents, salts, drugs, drug stabilizers, gels, adhesives, excipients, disintegrants, lubricants, sweeteners, flavoring agents, dyes, liquids, and nutritional supplements, such as materials and combinations thereof, as known to those of ordinary skill in the art. The pH and precise concentration of the various components in the pharmaceutical composition are adjusted according to well known parameters.
The term "subject" as used herein generally refers to an individual having or suspected of having cancer. The subject may be any organism or animal subject as a method or material object, including mammals, such as humans, laboratory animals (e.g., primates, rats, mice, rabbits), livestock (e.g., cattle, sheep, goats, pigs, turkeys, and chickens), domestic pets (e.g., dogs, cats, and rodents), horses, and transgenic non-human animals. The subject may be a patient, e.g., suffering from or suspected of suffering from a disease (which may be referred to as a medical condition), e.g., benign or malignant tumor or cancer. The subject may be receiving or has received treatment. The subject may be asymptomatic. The subject may be a healthy individual, but it is desirable to prevent cancer. The term "individual" may be used interchangeably, at least in some instances. As used herein, a "subject" or "individual" may or may not be located in a medical facility, and may be treated as an outpatient to the medical facility. An individual may be receiving one or more pharmaceutical compositions via the internet. Individuals may include human or non-human animals of any age, and thus include adults and adolescents (i.e., children) as well as infants, and include intrauterine individuals. The term does not mean that medical treatment is required and thus, whether clinical or supporting basic scientific research, an individual may voluntarily or involuntarily become part of an experiment.
As used herein, "treating" or "treatment" includes any beneficial or desired effect on the symptoms or pathology of a disease or pathological condition, and may include even a minimal reduction in the amount of one or more measurable markers of the disease or condition being treated (e.g., cancer). Treatment may involve optionally alleviating or ameliorating a symptom of a disease or condition, or delaying the progression of a disease or condition. "treating" does not necessarily mean complete eradication or cure of a disease or condition or associated symptoms. Treatment may mean alleviation of at least one symptom of a disease or condition.
As used herein, "TCR/CD3 complex" refers to a protein complex naturally occurring on the surface of T cells and comprises T cell receptor alpha and beta chains and/or T cell receptor gamma and delta chains, as well as cd33ζ, cd3γ, cd3δ and cd3ε chains.
I. Embodiments of the invention
Natural Killer (NK) cells are an emerging cellular immunotherapy for hematological malignancies and solid tumor patients. The invention relates in particular to modified NK cells, which have enhanced function for use in immunotherapy compared to NK cells not so modified. These modifications allow NK cells to have greater versatility in use with other therapeutic agents and, at least in some embodiments, T cell-like activity by utilizing the CD3/TCR receptor complex. In particular embodiments, NK cells are modified to express: (i) A single CD3 chain (cd3ζ, cd3ε, cd3δ, or cd3γ) or a portion or all of a human CD3 receptor complex (including any combination of cd3δ, ε (one or two copies of ε), γ, and ζ); or (ii) a single CD3 chain or a human CD3 receptor complex (including any combination of cd3δ, ε (one or two molecules), γ, and ζ) as a full-length protein or as a partial protein, heterologously linked to one or more intracellular signaling domains; and (iii) the CD3 complex may or may not include a T cell receptor (αβ or γδ). The present invention relates to the use of NK cells expressing CD3 in the diagnosis and treatment of diseases comprising the use of cells in combination with bispecific or multispecific antibodies, wherein one epitope of the antibody binds CD3 on NK cells expressing CD3. NK cells expressing CD3 can be pre-complexed ex vivo with bispecific antibodies to redirect their specificity to a target antigen and/or combined in vivo. In diagnostic embodiments, the labeled NK cells may be loaded with any kind of bispecific or multispecific antibody, including antibodies comprising at least an anti-CD 3 antibody, and the loaded labeled NK cells may be monitored for trafficking to the site of the target antigen to which the other antibody on the bispecific or multispecific antibody binds.
II compositions of the invention
The present invention relates to a composition comprising at least modified NK cells expressing at least part of the TCR/CD3 complex. In some cases, the composition further includes bispecific or multispecific antibodies, including in the same formulation, although in alternative embodiments, NK cells and antibodies are used as physically separate compositions.
NK cell TCR/CD3 modification
In particular embodiments, provided herein are compositions comprising NK cells artificially modified to express part or all of a TCR receptor complex and part or all of a CD3 co-receptor complex. In particular embodiments, NK cells are modified to include all components of the CD3 complex, including cd3ζ, cd3ε, cd3γ, and cd3δ. Although in particular cases full length cd3ζ, cd3ε, cd3γ, and cd3δ are used, including their extracellular, transmembrane, and intracellular domains, in alternative embodiments only portions of one or more of cd3ζ, cd3ε, cd3γ, and cd3δ are used, each of which may or may not be combined with one or more intracellular signaling domains, such as CD16, NKG2D, DAP, DAP12, CD28, 41BB, 2B4, CD27, OX40, or any combination thereof. NK cells may also be modified to express TCR receptor complexes, although in alternative embodiments no component of the TCR receptor complex is used.
In certain embodiments, an amino acid sequence (e.g., a polypeptide) may comprise an amino acid represented by the single letter "X" or the three-letter code "Xaa". In some embodiments, the amino acid represented by "X" or "Xaa" is any naturally occurring amino acid, such as, but not limited to, arginine (Arg, R), histidine (His, H), lysine (Lys, K), aspartic acid (Asp, D), glutamic acid (Glu, E), serine (Ser, S), threonine (Thr, T), asparagine (Asn, N), glutamine (gin, Q), glycine (Gly, G), proline (Pro, P), cysteine (Cys, C), alanine (Ala, a), valine (Val, V), isoleucine (Ile, I), leucine (Leu, L), methionine (Met, M), phenylalanine (Phe, F), tyrosine (Tyr, Y) or tryptophan (Trp, W).
In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is arginine (Arg, R). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is histidine (His, H). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is lysine (Lys, K). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is aspartic acid (Asp, D). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is glutamic acid (Glu, E). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is serine (Ser, S). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is threonine (Thr, T). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is asparagine (Asn, N). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is glutamine (Gln, Q). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is glycine (Gly, G). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is proline (Pro, P). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is cysteine (Cys, C). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is alanine (Ala, A). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is valine (Val, V). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is isoleucine (Ile, I). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is leucine (Leu, L). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88, or SEQ ID NO:25 or SEQ ID NO:88, is methionine (Met, M). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is phenylalanine (Phe, F). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is tyrosine (Tyr, Y). In some embodiments, the amino acid represented by "X" or "Xaa" in SEQ ID NO:25 or SEQ ID NO:88 is tryptophan (Trp, W).
In certain embodiments, any specific sequence of a CD3 receptor component is used, including wild-type or mutant of the component, provided that the CD3 receptor with the mutant is capable of allowing signaling through the CD3 complex, thereby resulting in activation and killing of the target. In some cases, NK cells are modified using examples of the following sequences of CD3 epsilon, CD3 delta, CD3 gamma, and CD3 zeta.
CD3 ε (UniProtKB-P07766 (CD3E_human))
Signal peptides
Extracellular domain
sp|P07766|23-126
Transmembrane domain
sp|P07766|127-152
Intracellular domains
sp|P07766|153-207
One example of Homo sapiens CD3E molecule (CD 3E) mRNA is located in NCBI reference sequence: accession number NM-000733.4
Examples of the entirety of the respective nucleic acid and amino acid CD3 epsilon sequences are as follows (underlined refers to the signal peptide sequence):
CD3 delta (UniProtKB-P04234 (CD3D_human))
Signal peptides
Extracellular domain
sp|P04234|22-105
Transmembrane domain
sp|P04234|106-126
Intracellular domains
sp|P04234|127-171
Chile CD3d molecule, delta (CD 3-TCR complex), mRNA (cDNA clone MGC:88324IMAGE: 3041045), intact CDsBC070321.1
Examples of the entirety of the respective nucleic acid and amino acid CD3 delta sequences are as follows (underlined refers to the signal peptide sequence):
CD3 gamma (T cell surface glycoprotein CD3 gamma chain Gene CD3G P09693)
Signal peptides
Extracellular domain
sp|P09693|23-116
Transmembrane domain
sp|P09693|117-137
Intracellular domains
sp|P09693|138-182
/>
Homo sapiens CD3G molecule (CD 3G), mRNA; NM-000073.3:81-629 Chinesian CD3G molecule (CD 3G), mRNA
Examples of the entirety of the respective nucleic acid and amino acid CD3 gamma sequences are as follows (underlined refers to the signal peptide sequence):
CD3ζ
Signal peptides
sp|P20963|SP
Extracellular domain
sp|P20963|22-30ECD
Transmembrane domain
sp|P20963|31-51tmd
Intracellular domains
sp|P20963|52-164ICD
Examples of the entirety of the respective nucleic acid and amino acid cd3ζ sequences are as follows (underlined refers to the signal peptide sequences):
homo sapiens CD247 molecule (CD 247; also referred to as CD3 zeta), transcript variant 1, mRNA
NCBI reference sequence NM-198053.3
NM-198053.3:65-559 Chile CD247 molecule (CD 247), transcript variant 1, mRNA
In particular embodiments, NK cells are modified to express one or more of a TCR a chain, a TCR β chain, a TCR γ chain, and a TCR δ, and any combination thereof may be used. In particular cases, NK cells are modified to express a T Cell Receptor (TCR) αβ chain or a tcrγδ chain. In certain instances, NK cells are modified to express part or all of only the constant regions of one or more of the TCR α chain, TCR β chain, TCR γ chain, and TCR δ chain. NK cells may be modified to express part or all of the constant region only of the T Cell Receptor (TCR) αβ chain or tcrγδ chain. Where a partial constant region is used, the portion of the constant region can be at least 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, or 400 amino acids, including consecutive amino acids of any constant region. Portions of the constant region can comprise at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% of the amino acids of the constant region, including consecutive amino acids of the constant region.
In certain instances, any of the sequences contained herein are used to modify NK cells, although in other instances, sequences related to these in terms of identity are used. For example, related sequences that are at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% identical to any of the sequences contemplated herein may be used in the present invention.
Specific constructs for expressing various TCR/CD3 proteins in NK cells may be used, and may be used in various configurations. In particular instances, NK cells can be transduced or transfected with one or more vectors to express any of a variety of proteins encompassed herein, including at least one or more components of the TCR/CD3 complex. In certain cases, one or more of the vectors may or may not themselves be polycistronic, as they ultimately produce more than one isolated polypeptide. Where one or more polycistronic vectors are used, they may utilize one or more Internal Ribosome Entry Sites (IRES) and/or one or more sites for 2A self-cleaving peptides. Where one or more 2A sequences are used, the following sequences may be used, where GSG is an optional linker:
In the case of polycistronic vectors expressing multiple protein components, the order of the 5 'to 3' direction on the polynucleotide vector may be any order, although in the alternative they are present on the vector in a particular order. The polycistronic vector may express the multiple components of the CD3 receptor complex without expressing other heterologous proteins, or the polycistronic vector may express the multiple components of the CD3 receptor complex and one or more other heterologous proteins. The polycistronic vector may express the multiple components of the TCR receptor complex without expressing other heterologous proteins, or the polycistronic vector may express the multiple components of the TCR receptor complex and one or more other heterologous proteins. The polycistronic vector may or may not express one or more components of the TCR receptor complex and one or more components of the CD3 complex. In particular embodiments, the polycistronic vector comprises one or more components of a CD3 receptor complex and one or more heterologous proteins, such as cytokines and engineered antigen receptors, such as CARs.
An example of a polycistronic vector is shown in FIG. 2A, in which full-length CD3 epsilon, CD3 delta, CD3 gamma and CD3 zeta are present and separated by the same or different sites of the 2A self-cleaving peptide. As shown in the plasmid map of fig. 2B, the polycistronic vector may comprise signal peptides, extracellular domains, transmembrane domains, and intracellular domains for each of CD3 epsilon, CD3 delta, CD3 gamma, and CD3 zeta.
FIG. 3 provides a table showing examples of various TCR expression constructs for engineering NK cells expressing TCRs. In a particular embodiment of the invention, the CD3 receptor component and the TCR receptor component are expressed in NK cells by different vectors. In any case, the vector may express a TCR directed against a particular antigen (e.g., a cancer antigen or a viral antigen). The TCR may or may not comprise at least part of cd3ζ, including the intracellular domain of cd3ζ, except that NK cells also express cd3ζ as a separate molecule from the TCR and as part of the CD3 receptor complex. Likewise, the CAR may or may not contain at least part of cd3ζ, including the intracellular domain of cd3ζ, except that NK cells also express cd3ζ as part of the molecule and CD3 receptor complex that is separate from the TCR.
In particular embodiments, the TCR of the modified NK cell is not necessarily used as an aspect of the cell's therapy, but rather as a structural support or scaffold to facilitate the function or enhanced function of the CD3 receptor complex. That is, the TCR may be any TCR, and may not be used to target the ability of a particularly desired antigen. In this case, as an example, TCRs targeting viral antigens may be used for NK cells, which will be used for cancers not necessarily associated with that particular virus. In other cases, TCRs are selected for their ability to target a particular cancer antigen. Examples of antigens against which TCRs may be directed are provided elsewhere herein.
In fig. 3, an example of the following constructs is noted:
TCR1: refers to TCRpp65 (TCR for HLA-A2 restricted CMVpp 65) linked to the intracellular cd3ζ domain and full-length cd3γ, full-length cd3δ and full-length cd3ε, and this construct may also be referred to as TCRpp65ZicdGDEFL, which may comprise the following sequences:
MLEGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSPVTGGIYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRATNFSLLKQAGDVEENPGPMILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCARNTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDAYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGPMEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGPQCTNYALLKLAGDVESNPGPMRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS*(SEQ ID NO:39)
In TCRpp65ZicdGDEFL, the sequences of the corresponding components are as follows, although these specific sequences or other sequences may be used in this and/or other constructs:
TCRb ectodomain:
MLEGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSPVTGGIYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD(SEQ ID NO:40)
ATGCTCGAGGGAGTGACCCAGACCCCCAAGTTCCAGGTGCTGAAGACCGGACAGAGCATGACCCTGCAGTGCGCCCAGGACATGAACCACGAGTACATGAGCTGGTACCGGCAGGACCCCGGAATGGGACTGCGGCTGATCCACTACAGCGTGGGAGCCGGAATCACCGACCAGGGAGAGGTGCCCAACGGATACAACGTGAGCCGGAGCACCACCGAGGACTTCCCCCTGCGGCTGCTGAGCGCCGCCCCCAGCCAGACCAGCGTGTACTTCTGCGCCAGCAGCCCCGTGACCGGAGGAATCTACGGATACACCTTCGGAAGCGGAACCCGGCTGACCGTGGTGGAGGACCTGAACAAGGTGTTCCCCCCCGAGGTGGCCGTGTTCGAGCCCAGCGAGGCCGAGATCAGCCACACCCAGAAGGCCACCCTGGTGTGCCTGGCCACCGGATTCTTCCCCGACCACGTGGAGCTGAGCTGGTGGGTGAACGGAAAGGAGGTGCACAGCGGAGTGAGCACCGACCCCCAGCCCCTGAAGGAGCAGCCCGCCCTGAACGACAGCCGGTACTGCCTGAGCAGCCGGCTGCGGGTGAGCGCCACCTTCTGGCAGAACCCCCGGAACCACTTCCGGTGCCAGGTGCAGTTCTACGGACTGAGCGAGAACGACGAGTGGACCCAGGACCGGGCCAAGCCCGTGACCCAGATCGTGAGCGCCGAGGCCTGGGGACGGGCCGAC(SEQ ID NO:41)
cd3ζ intracellular domain (Z-ICD):
RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRATNFSLLKQAGDVEENPGP(SEQ ID NO:42)( Wherein the P2A sequence is located at the C-terminal end
AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCgccaccaacttctccctgctgaagcaggccggcgacgtggaggagaaccccggcccc(SEQ ID NO:43)( Wherein the lower case letter sequence is a P2A sequence
TCRa extracellular domain:
MILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCARNTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDAYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESS(SEQ ID NO:44)
ATGATCCTGAACGTGGAGCAGAGCCCCCAGAGCCTGCACGTGCAGGAGGGAGACAGCACCAACTTCACCTGCAGCTTCCCCAGCAGCAACTTCTACGCCCTGCACTGGTACCGGTGGGAGACCGCCAAGAGCCCCGAGGCCCTGTTCGTGATGACCCTGAACGGAGACGAGAAGAAGAAGGGACGGATCAGCGCCACCCTGAACACCAAGGAGGGATACAGCTACCTGTACATCAAGGGAAGCCAGCCCGAGGACAGCGCCACCTACCTGTGCGCCCGGAACACCGGAAACCAGTTCTACTTCGGAACCGGAACCAGCCTGACCGTGATCCCCAACATCCAGAACCCCGACCCCGCCGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGAGCCAGAGCAAGGACAGCGACGCCTACATCACCGACAAGACCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAACAGCGCCGTGGCCTGGAGCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATCATCCCCGAGGACACCTTCTTCCCCAGCCCCGAGAGCAGC(SEQ ID NO:45)
CD3γδε(CD3GDE):
MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGPQCTNYALLKLAGDVESNPGP(SEQ ID NO:46)( Wherein the E2A sequence is located at the C-terminal end
ATGGAACAGGGGAAGGGCCTGGCTGTCCTCATCCTGGCTATCATTCTTCTTCAAGGTACTTTGGCCCAGTCAATCAAAGGAAACCACTTGGTTAAGGTGTATGACTATCAAGAAGATGGTTCGGTACTTCTGACTTGTGATGCAGAAGCCAAAAATATCACATGGTTTAAAGATGGGAAGATGATCGGCTTCCTAACTGAAGATAAAAAAAAATGGAATCTGGGAAGTAATGCCAAGGACCCTCGTGGGATGTATCAGTGTAAAGGATCACAGAACAAGTCAAAACCACTCCAAGTGTATTACAGAATGTGTCAGAACTGCATTGAACTAAATGCAGCCACCATATCTGGCTTTCTCTTTGCTGAAATCGTCAGCATTTTCGTCCTTGCTGTTGGGGTCTACTTCATTGCTGGACAGGATGGAGTTCGCCAGTCGAGAGCTTCAGACAAGCAGACTCTGTTGCCCAATGACCAGCTCTACCAGCCCCTCAAGGATCGAGAAGATGACCAGTACAGCCACCTTCAAGGAAACCAGTTGAGGAGGAATGTGAAGCAGACCCTGAACTTCGACCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAGCACAGCACCTTCCTGAGCGGCCTGGTGCTGGCCACCCTGCTGAGCCAGGTGAGCCCCTTCAAGATCCCCATCGAGGAGCTGGAGGACAGAGTGTTCGTGAACTGCAACACCAGCATCACCTGGGTGGAGGGCACCGTGGGCACCCTGCTGAGCGACATCACCAGACTGGACCTGGGCAAGAGAATCCTGGACCCCAGAGGCATCTACAGATGCAACGGCACCGACATCTACAAGGACAAGGAGAGCACCGTGCAGGTGCACTACAGAATGTGCCAGAGCTGCGTGGAGCTGGACCCCGCCACCGTGGCCGGCATCATCGTGACCGACGTGATCGCCACCCTGCTGCTGGCCCTGGGCGTGTTCTGCTTCGCCGGCCACGAGACCGGCAGACTGAGCGGCGCCGCCGACACCCAGGCCCTGCTGAGAAACGACCAGGTGTACCAGCCCCTGAGAGACAGAGACGACGCCCAGTACAGCCACCTGGGCGGCAACTGGGCCAGAAACAAGGAGGGCAGAGGCAGCCTGCTGACCTGCGGCGACGTGGAGGAGAACCCCGGCCCCATGCAGAGCGGCACCCACTGGAGAGTGCTGGGCCTGTGCCTGCTGAGCGTGGGCGTGTGGGGCCAGGACGGCAACGAGGAGATGGGCGGCATCACCCAGACCCCCTACAAGGTGAGCATCAGCGGCACCACCGTGATCCTGACCTGCCCCCAGTACCCCGGCAGCGAGATCCTGTGGCAGCACAACGACAAGAACATCGGCGGCGACGAGGACGACAAGAACATCGGCAGCGACGAGGACCACCTGAGCCTGAAGGAGTTCAGCGAGCTGGAGCAGAGCGGCTACTACGTGTGCTACCCCAGAGGCAGCAAGCCCGAGGACGCCAACTTCTACCTGTACCTGAGAGCCAGAGTGTGCGAGAACTGCATGGAGATGGACGTGATGAGCGTGGCCACCATCGTGATCGTGGACATCTGCATCACCGGCGGCCTGCTGCTGCTGGTGTACTACTGGAGCAAGAACAGAAAGGCCAAGGCCAAGCCCGTGACCAGAGGCGCCGGCGCCGGCGGCAGACAGAGAGGCCAGAACAAGGAGAGACCCCCCCCCGTGCCCAACCCCGACTACGAGCCCATCAGAAAGGGCCAGAGAGACCTGTACAGCGGCCTGAACCAGAGAAGAATCGGACCGcagtgtactaattatgctctcttgaaattggctggagatgttgagagcaatcccgggccc(SEQ ID NO:47)( Wherein the lower case letter is an E2A sequence)
IL-15:
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS*(SEQ ID NO:48)
ATGCGCATTAGCAAGCCCCACCTGCGGAGCATCAGCATCCAGTGCTACCTGTGCCTGCTGCTGAACAGCCACTTCCTGACCGAGGCCGGCATCCACGTGTTCATCCTGGGCTGCTTCAGCGCCGGACTGCCCAAGACCGAGGCCAACTGGGTGAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCATGCACATCGACGCCACCCTGTACACCGAGAGCGACGTGCACCCCAGCTGCAAGGTGACCGCCATGAAGTGCTTTCTGCTGGAACTGCAGGTGATCAGCCTGGAAAGCGGCGACGCCAGCATCCACGACACCGTGGAGAACCTGATCATCCTGGCCAACAACAGCCTGAGCAGCAACGGCAACGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAGAAGAACATCAAAGAGTTTCTGCAGAGCTTCGTGCACATCGTGCAGATGTTCATCAACACCAGC(SEQ ID NO:49)
TCR2 is TCRpp attached to full length CD3 zeta, full length CD3 gamma, full length CD3 delta and full length CD3 epsilon; it lacks IL-15. Representative sequences are as follows:
CTCGAGGGAGTGACCCAGACCCCCAAGTTCCAGGTGCTGAAGACCGGACAGAGCATGACCCTGCAGTGCGCCCAGGACATGAACCACGAGTACATGAGCTGGTACCGGCAGGACCCCGGAATGGGACTGCGGCTGATCCACTACAGCGTGGGAGCCGGAATCACCGACCAGGGAGAGGTGCCCAACGGATACAACGTGAGCCGGAGCACCACCGAGGACTTCCCCCTGCGGCTGCTGAGCGCCGCCCCCAGCCAGACCAGCGTGTACTTCTGCGCCAGCAGCCCCGTGACCGGAGGAATCTACGGATACACCTTCGGAAGCGGAACCCGGCTGACCGTGGTGGAGGACCTGAACAAGGTGTTCCCCCCCGAGGTGGCCGTGTTCGAGCCCAGCGAGGCCGAGATCAGCCACACCCAGAAGGCCACCCTGGTGTGCCTGGCCACCGGATTCTTCCCCGACCACGTGGAGCTGAGCTGGTGGGTGAACGGAAAGGAGGTGCACAGCGGAGTGAGCACCGACCCCCAGCCCCTGAAGGAGCAGCCCGCCCTGAACGACAGCCGGTACTGCCTGAGCAGCCGGCTGCGGGTGAGCGCCACCTTCTGGCAGAACCCCCGGAACCACTTCCGGTGCCAGGTGCAGTTCTACGGACTGAGCGAGAACGACGAGTGGACCCAGGACCGGGCCAAGCCCGTGACCCAGATCGTGAGCGCCGAGGCCTGGGGACGGGCCGACGCCACCAACTTCAGCCTGCTGAAGCAGGCCGGCGACGTGGAGGAGAACCCCGGCCCCATGATCCTGAACGTGGAGCAGAGCCCCCAGAGCCTGCACGTGCAGGAGGGAGACAGCACCAACTTCACCTGCAGCTTCCCCAGCAGCAACTTCTACGCCCTGCACTGGTACCGGTGGGAGACCGCCAAGAGCCCCGAGGCCCTGTTCGTGATGACCCTGAACGGAGACGAGAAGAAGAAGGGACGGATCAGCGCCACCCTGAACACCAAGGAGGGATACAGCTACCTGTACATCAAGGGAAGCCAGCCCGAGGACAGCGCCACCTACCTGTGCGCCCGGAACACCGGAAACCAGTTCTACTTCGGAACCGGAACCAGCCTGACCGTGATCCCCAACATCCAGAACCCCGACCCCGCCGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGAGCCAGAGCAAGGACAGCGACGCCTACATCACCGACAAGACCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAACAGCGCCGTGGCCTGGAGCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATCATCCCCGAGGACACCTTCTTCCCCAGCCCCGAGAGCAGCGAGGGCAGAGGCAGCCTGCTGACCTGCGGCGACGTGGAGGAGAACCCCGGCCCCATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAACAGGGGAAGGGCCTGGCTGTCCTCATCCTGGCTATCATTCTTCTTCAAGGTACTTTGGCCCAGTCAATCAAAGGAAACCACTTGGTTAAGGTGTATGACTATCAAGAAGATGGTTCGGTACTTCTGACTTGTGATGCAGAAGCCAAAAATATCACATGGTTTAAAGATGGGAAGATGATCGGCTTCCTAACTGAAGATAAAAAAAAATGGAATCTGGGAAGTAATGCCAAGGACCCTCGTGGGATGTATCAGTGTAAAGGATCACAGAACAAGTCAAAACCACTCCAAGTGTATTACAGAATGTGTCAGAACTGCATTGAACTAAATGCAGCCACCATATCTGGCTTTCTCTTTGCTGAAATCGTCAGCATTTTCGTCCTTGCTGTTGGGGTCTACTTCATTGCTGGACAGGATGGAGTTCGCCAGTCGAGAGCTTCAGACAAGCAGACTCTGTTGCCCAATGACCAGCTCTACCAGCCCCTCAAGGATCGAGAAGATGACCAGTACAGCCACCTTCAAGGAAACCAGTTGAGGAGGAATGTGAAGCAGACCCTGAACTTCGACCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAGCACAGCACCTTCCTGAGCGGCCTGGTGCTGGCCACCCTGCTGAGCCAGGTGAGCCCCTTCAAGATCCCCATCGAGGAGCTGGAGGACAGAGTGTTCGTGAACTGCAACACCAGCATCACCTGGGTGGAGGGCACCGTGGGCACCCTGCTGAGCGACATCACCAGACTGGACCTGGGCAAGAGAATCCTGGACCCCAGAGGCATCTACAGATGCAACGGCACCGACATCTACAAGGACAAGGAGAGCACCGTGCAGGTGCACTACAGAATGTGCCAGAGCTGCGTGGAGCTGGACCCCGCCACCGTGGCCGGCATCATCGTGACCGACGTGATCGCCACCCTGCTGCTGGCCCTGGGCGTGTTCTGCTTCGCCGGCCACGAGACCGGCAGACTGAGCGGCGCCGCCGACACCCAGGCCCTGCTGAGAAACGACCAGGTGTACCAGCCCCTGAGAGACAGAGACGACGCCCAGTACAGCCACCTGGGCGGCAACTGGGCCAGAAACAAGGAGGGCAGAGGCAGCCTGCTGACCTGCGGCGACGTGGAGGAGAACCCCGGCCCCATGCAGAGCGGCACCCACTGGAGAGTGCTGGGCCTGTGCCTGCTGAGCGTGGGCGTGTGGGGCCAGGACGGCAACGAGGAGATGGGCGGCATCACCCAGACCCCCTACAAGGTGAGCATCAGCGGCACCACCGTGATCCTGACCTGCCCCCAGTACCCCGGCAGCGAGATCCTGTGGCAGCACAACGACAAGAACATCGGCGGCGACGAGGACGACAAGAACATCGGCAGCGACGAGGACCACCTGAGCCTGAAGGAGTTCAGCGAGCTGGAGCAGAGCGGCTACTACGTGTGCTACCCCAGAGGCAGCAAGCCCGAGGACGCCAACTTCTACCTGTACCTGAGAGCCAGAGTGTGCGAGAACTGCATGGAGATGGACGTGATGAGCGTGGCCACCATCGTGATCGTGGACATCTGCATCACCGGCGGCCTGCTGCTGCTGGTGTACTACTGGAGCAAGAACAGAAAGGCCAAGGCCAAGCCCGTGACCAGAGGCGCCGGCGCCGGCGGCAGACAGAGAGGCCAGAACAAGGAGAGACCCCCCCCCGTGCCCAACCCCGACTACGAGCCCATCAGAAAGGGCCAGAGAGACCTGTACAGCGGCCTGAACCAGAGAAGAATCGGACCG(SEQ ID NO:50)
LEGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSPVTGGIYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADATNFSLLKQAGDVEENPGPMILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCARNTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDAYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSEGRGSLLTCGDVEENPGPMKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGPMEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGP(SEQ ID NO:51)
TCR 3-TCRpp which is linked to the intracellular CD3z domain and IL-15-can also be referred to as TCRpp65 Zicd-its representative sequence is as follows:
MLEGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSPVTGGIYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRATNFSLLKQAGDVEENPGPMILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCARNTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDAYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRPGPQCTNYALLKLAGDVESNPGPMRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS*(SEQ ID NO:52)
In TCRpp65Zicd, the sequences of the corresponding components are as follows, although these specific sequences or other sequences may be used for this and/or other constructs:
TCRb ectodomain:
MLEGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSPVTGGIYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD(SEQ ID NO:40)
ATGCTCGAGGGAGTGACCCAGACCCCCAAGTTCCAGGTGCTGAAGACCGGACAGAGCATGACCCTGCAGTGCGCCCAGGACATGAACCACGAGTACATGAGCTGGTACCGGCAGGACCCCGGAATGGGACTGCGGCTGATCCACTACAGCGTGGGAGCCGGAATCACCGACCAGGGAGAGGTGCCCAACGGATACAACGTGAGCCGGAGCACCACCGAGGACTTCCCCCTGCGGCTGCTGAGCGCCGCCCCCAGCCAGACCAGCGTGTACTTCTGCGCCAGCAGCCCCGTGACCGGAGGAATCTACGGATACACCTTCGGAAGCGGAACCCGGCTGACCGTGGTGGAGGACCTGAACAAGGTGTTCCCCCCCGAGGTGGCCGTGTTCGAGCCCAGCGAGGCCGAGATCAGCCACACCCAGAAGGCCACCCTGGTGTGCCTGGCCACCGGATTCTTCCCCGACCACGTGGAGCTGAGCTGGTGGGTGAACGGAAAGGAGGTGCACAGCGGAGTGAGCACCGACCCCCAGCCCCTGAAGGAGCAGCCCGCCCTGAACGACAGCCGGTACTGCCTGAGCAGCCGGCTGCGGGTGAGCGCCACCTTCTGGCAGAACCCCCGGAACCACTTCCGGTGCCAGGTGCAGTTCTACGGACTGAGCGAGAACGACGAGTGGACCCAGGACCGGGCCAAGCCCGTGACCCAGATCGTGAGCGCCGAGGCCTGGGGACGGGCCGAC(SEQ ID NO:41)
Cd3ζ intracellular domain (Z-ICD):
RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRATNFSLLKQAGDVEENPGP(SEQ ID NO:42)( Wherein the P2A sequence is located at the C-terminal end
AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCgccaccaacttctccctgctgaagcaggccggcgacgtggaggagaaccccggcccc(SEQ ID NO:43)( Wherein the lower case letter sequence is a P2A sequence
TCRa extracellular domain:
MILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCARNTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDAYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESS(SEQ ID NO:44)
ATGATCCTGAACGTGGAGCAGAGCCCCCAGAGCCTGCACGTGCAGGAGGGAGACAGCACCAACTTCACCTGCAGCTTCCCCAGCAGCAACTTCTACGCCCTGCACTGGTACCGGTGGGAGACCGCCAAGAGCCCCGAGGCCCTGTTCGTGATGACCCTGAACGGAGACGAGAAGAAGAAGGGACGGATCAGCGCCACCCTGAACACCAAGGAGGGATACAGCTACCTGTACATCAAGGGAAGCCAGCCCGAGGACAGCGCCACCTACCTGTGCGCCCGGAACACCGGAAACCAGTTCTACTTCGGAACCGGAACCAGCCTGACCGTGATCCCCAACATCCAGAACCCCGACCCCGCCGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGAGCCAGAGCAAGGACAGCGACGCCTACATCACCGACAAGACCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAACAGCGCCGTGGCCTGGAGCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATCATCCCCGAGGACACCTTCTTCCCCAGCCCCGAGAGCAGC(SEQ ID NO:45)
Cd3ζ intracellular domain (Z-ICD) (in particular embodiments, two or more Z-ICD sequences may be used):
RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRPGPQCTNYALLKLAGDVESNPGP(SEQ ID NO:53)
AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCC(SEQ ID NO:54)
IL-15:
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS*(SEQ ID NO:48)
ATGCGCATTAGCAAGCCCCACCTGCGGAGCATCAGCATCCAGTGCTACCTGTGCCTGCTGCTGAACAGCCACTTCCTGACCGAGGCCGGCATCCACGTGTTCATCCTGGGCTGCTTCAGCGCCGGACTGCCCAAGACCGAGGCCAACTGGGTGAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCATGCACATCGACGCCACCCTGTACACCGAGAGCGACGTGCACCCCAGCTGCAAGGTGACCGCCATGAAGTGCTTTCTGCTGGAACTGCAGGTGATCAGCCTGGAAAGCGGCGACGCCAGCATCCACGACACCGTGGAGAACCTGATCATCCTGGCCAACAACAGCCTGAGCAGCAACGGCAACGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAGAAGAACATCAAAGAGTTTCTGCAGAGCTTCGTGCACATCGTGCAGATGTTCATCAACACCAGC(SEQ ID NO:49)
TCR 4-TCRpp-also known as TCRpp. Beta. Alpha., representative sequence is as follows :MLEGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSPVTGGIYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRATNFSLLKQAGDVEENPGPMILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCARNTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDAYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRPGPQCTNYALLKLAGDVESNPGPMRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS*(SEQ ID NO:55)
For TCRpp beta alpha, the sequences of the corresponding components are as follows, although these specific sequences or other sequences may be used for this and/or other constructs:
TCRb ectodomain
MLEGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSPVTGGIYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD(SEQ ID NO:40)
ATGCTCGAGGGAGTGACCCAGACCCCCAAGTTCCAGGTGCTGAAGACCGGACAGAGCATGACCCTGCAGTGCGCCCAGGACATGAACCACGAGTACATGAGCTGGTACCGGCAGGACCCCGGAATGGGACTGCGGCTGATCCACTACAGCGTGGGAGCCGGAATCACCGACCAGGGAGAGGTGCCCAACGGATACAACGTGAGCCGGAGCACCACCGAGGACTTCCCCCTGCGGCTGCTGAGCGCCGCCCCCAGCCAGACCAGCGTGTACTTCTGCGCCAGCAGCCCCGTGACCGGAGGAATCTACGGATACACCTTCGGAAGCGGAACCCGGCTGACCGTGGTGGAGGACCTGAACAAGGTGTTCCCCCCCGAGGTGGCCGTGTTCGAGCCCAGCGAGGCCGAGATCAGCCACACCCAGAAGGCCACCCTGGTGTGCCTGGCCACCGGATTCTTCCCCGACCACGTGGAGCTGAGCTGGTGGGTGAACGGAAAGGAGGTGCACAGCGGAGTGAGCACCGACCCCCAGCCCCTGAAGGAGCAGCCCGCCCTGAACGACAGCCGGTACTGCCTGAGCAGCCGGCTGCGGGTGAGCGCCACCTTCTGGCAGAACCCCCGGAACCACTTCCGGTGCCAGGTGCAGTTCTACGGACTGAGCGAGAACGACGAGTGGACCCAGGACCGGGCCAAGCCCGTGACCCAGATCGTGAGCGCCGAGGCCTGGGGACGGGCCGAC(SEQ ID NO:41)
Cd3ζ intracellular domain (Z-ICD):
RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRATNFSLLKQAGDVEENPGP(SEQ ID NO:42)AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCC(SEQ ID NO:54)
TCRa extracellular domain:
MILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCARNTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDAYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESS(SEQ ID NO:44)
ATGATCCTGAACGTGGAGCAGAGCCCCCAGAGCCTGCACGTGCAGGAGGGAGACAGCACCAACTTCACCTGCAGCTTCCCCAGCAGCAACTTCTACGCCCTGCACTGGTACCGGTGGGAGACCGCCAAGAGCCCCGAGGCCCTGTTCGTGATGACCCTGAACGGAGACGAGAAGAAGAAGGGACGGATCAGCGCCACCCTGAACACCAAGGAGGGATACAGCTACCTGTACATCAAGGGAAGCCAGCCCGAGGACAGCGCCACCTACCTGTGCGCCCGGAACACCGGAAACCAGTTCTACTTCGGAACCGGAACCAGCCTGACCGTGATCCCCAACATCCAGAACCCCGACCCCGCCGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGAGCCAGAGCAAGGACAGCGACGCCTACATCACCGACAAGACCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAACAGCGCCGTGGCCTGGAGCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATCATCCCCGAGGACACCTTCTTCCCCAGCCCCGAGAGCAGC(SEQ ID NO:45)
cd3ζ intracellular domain (Z-ICD):
RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRPGPQCTNYALLKLAGDVESNPGP(SEQ ID NO:53)
AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCC(SEQ ID NO:54)
IL-15:
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS*(SEQ ID NO:48)
ATGCGCATTAGCAAGCCCCACCTGCGGAGCATCAGCATCCAGTGCTACCTGTGCCTGCTGCTGAACAGCCACTTCCTGACCGAGGCCGGCATCCACGTGTTCATCCTGGGCTGCTTCAGCGCCGGACTGCCCAAGACCGAGGCCAACTGGGTGAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCATGCACATCGACGCCACCCTGTACACCGAGAGCGACGTGCACCCCAGCTGCAAGGTGACCGCCATGAAGTGCTTTCTGCTGGAACTGCAGGTGATCAGCCTGGAAAGCGGCGACGCCAGCATCCACGACACCGTGGAGAACCTGATCATCCTGGCCAACAACAGCCTGAGCAGCAACGGCAACGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAGAAGAACATCAAAGAGTTTCTGCAGAGCTTCGTGCACATCGTGCAGATGTTCATCAACACCAGC(SEQ ID NO:49)
Another representative sequence of TCRpp βα is as follows:
ATGGACTCCTGGACCTTCTGCTGTGTGTCCCTTTGCATCCTGGTAGCAAAGCACACAGATGCTGGAGTTATCCAGTCACCCCGGCACGAGGTGACAGAGATGGGACAAGAAGTGACTCTGAGATGTAAACCAATTTCAGGACACGACTACCTTTTCTGGTACAGACAGACCATGATGCGGGGACTGGAGTTGCTCATTTACTTTAACAACAACGTTCCGATAGATGATTCAGGGATGCCCGAGGATCGATTCTCAGCTAAGATGCCTAATGCATCATTCTCCACTCTGAAGATCCAGCCCTCAGAACCCAGGGACTCAGCTGTGTACTTCTGTGCCAGCAGTTCGGCAAACTATGGCTACACCTTCGGTTCGGGGACCAGGTTAACCGTTGTAGAGGACCTGAACAAGGTGTTCCCACCCGAGGTCGCTGTGTTTGAGCCATCAGAAGCAGAGATCTCCCACACCCAAAAGGCCACACTGGTGTGCCTGGCCACAGGCTTCTTCCCTGACCACGTGGAGCTGAGCTGGTGGGTGAATGGGAAGGAGGTGCACAGTGGGGTCAGCACGGACCCGCAGCCCCTCAAGGAGCAGCCCGCCCTCAATGACTCCAGATACTGCCTGAGCAGCCGCCTGAGGGTCTCGGCCACCTTCTGGCAGAACCCCCGCAACCACTTCCGCTGTCAAGTCCAGTTCTACGGGCTCTCGGAGAATGACGAGTGGACCCAGGATAGGGCCAAACCCGTCACCCAGATCGTCAGCGCCGAGGCCTGGGGTAGAGCAGACTGTGGCTTTACCTCGGTGTCCTACCAGCAAGGGGTCCTGTCTGCCACCATCCTCTATGAGATCCTGCTAGGGAAGGCCACCCTGTATGCTGTGCTGGTCAGCGCCCTTGTGTTGATGGCCATGGTCAAGAGAAAGGATTTCGAGGGCAGGGGAAGTCTTCTAACATGCGGGGACGTGGAGGAAAATCCCGGGCCCATGCTCCTTGAACATTTATTAATAATCTTGTGGATGCAGCTGACATGGGTCAGTGGTCAACAGCTGAATCAGAGTCCTCAATCTATGTTTATCCAGGAAGGAGAAGATGTCTCCATGAACTGCACTTCTTCAAGCATATTTAACACCTGGCTATGGTACAAGCAGGACCCTGGGGAAGGTCCTGTCCTCTTGATAGCCTTATATAAGGCTGGTGAATTGACCTCAAATGGAAGACTGACTGCTCAGTTTGGTATAACCAGAAAGGACAGCTTCCTGAATATCTCAGCATCCATACCCAGTGATGTAGGCATCTACTTCTGTGCTGGACCCATGAAAACCTCCTACGACAAGGTGATATTTGGGCCAGGGACAAGCTTATCAGTCATTCCAAATATCCAGAACCCTGACCCTGCCGTGTACCAGCTGAGAGACTCTAAATCCAGTGACAAGTCTGTCTGCCTATTCACCGATTTTGATTCTCAAACAAATGTGTCACAAAGTAAGGATTCTGATGTGTATATCACAGACAAAACTGTGCTAGACATGAGGTCTATGGACTTCAAGAGCAACAGTGCTGTGGCCTGGAGCAACAAATCTGACTTTGCATGTGCAAACGCCTTCAACAACAGCATTATTCCAGAAGACACCTTCTTCCCCAGCCCAGAAAGTTCCTGTGATGTCAAGCTGGTCGAGAAAAGCTTTGAAACAGATACGAACCTAAACTTTCAAAACCTGTCAGTGATTGGGTTCCGAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCTCATGACGCTGCGGCTGTGGTCCAGCTGA(SEQ ID NO:56)
MDSWTFCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSSANYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDFEGRGSLLTCGDVEENPGPMLLEHLLIILWMQLTWVSGQQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQDPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGPMKTSYDKVIFGPGTSLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS*(SEQ ID NO:57)
z1 refers to full length cd3ζ, full length cd3γ, full length cd3δ, and full length cd3ε (see fig. 2A and 2B), also referred to as CD3ZFLGDEFL15, linked to IL15, and representative sequences are as follows:
MLEMKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGPMEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGPQCTNYALLKLAGDVESNPGPMRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS(SEQ ID NO:58)
ATGCTCGAGATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAACAGGGGAAGGGCCTGGCTGTCCTCATCCTGGCTATCATTCTTCTTCAAGGTACTTTGGCCCAGTCAATCAAAGGAAACCACTTGGTTAAGGTGTATGACTATCAAGAAGATGGTTCGGTACTTCTGACTTGTGATGCAGAAGCCAAAAATATCACATGGTTTAAAGATGGGAAGATGATCGGCTTCCTAACTGAAGATAAAAAAAAATGGAATCTGGGAAGTAATGCCAAGGACCCTCGTGGGATGTATCAGTGTAAAGGATCACAGAACAAGTCAAAACCACTCCAAGTGTATTACAGAATGTGTCAGAACTGCATTGAACTAAATGCAGCCACCATATCTGGCTTTCTCTTTGCTGAAATCGTCAGCATTTTCGTCCTTGCTGTTGGGGTCTACTTCATTGCTGGACAGGATGGAGTTCGCCAGTCGAGAGCTTCAGACAAGCAGACTCTGTTGCCCAATGACCAGCTCTACCAGCCCCTCAAGGATCGAGAAGATGACCAGTACAGCCACCTTCAAGGAAACCAGTTGAGGAGGAATGTGAAGCAGACCCTGAACTTCGACCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAGCACAGCACCTTCCTGAGCGGCCTGGTGCTGGCCACCCTGCTGAGCCAGGTGAGCCCCTTCAAGATCCCCATCGAGGAGCTGGAGGACAGAGTGTTCGTGAACTGCAACACCAGCATCACCTGGGTGGAGGGCACCGTGGGCACCCTGCTGAGCGACATCACCAGACTGGACCTGGGCAAGAGAATCCTGGACCCCAGAGGCATCTACAGATGCAACGGCACCGACATCTACAAGGACAAGGAGAGCACCGTGCAGGTGCACTACAGAATGTGCCAGAGCTGCGTGGAGCTGGACCCCGCCACCGTGGCCGGCATCATCGTGACCGACGTGATCGCCACCCTGCTGCTGGCCCTGGGCGTGTTCTGCTTCGCCGGCCACGAGACCGGCAGACTGAGCGGCGCCGCCGACACCCAGGCCCTGCTGAGAAACGACCAGGTGTACCAGCCCCTGAGAGACAGAGACGACGCCCAGTACAGCCACCTGGGCGGCAACTGGGCCAGAAACAAGGAGGGCAGAGGCAGCCTGCTGACCTGCGGCGACGTGGAGGAGAACCCCGGCCCCATGCAGAGCGGCACCCACTGGAGAGTGCTGGGCCTGTGCCTGCTGAGCGTGGGCGTGTGGGGCCAGGACGGCAACGAGGAGATGGGCGGCATCACCCAGACCCCCTACAAGGTGAGCATCAGCGGCACCACCGTGATCCTGACCTGCCCCCAGTACCCCGGCAGCGAGATCCTGTGGCAGCACAACGACAAGAACATCGGCGGCGACGAGGACGACAAGAACATCGGCAGCGACGAGGACCACCTGAGCCTGAAGGAGTTCAGCGAGCTGGAGCAGAGCGGCTACTACGTGTGCTACCCCAGAGGCAGCAAGCCCGAGGACGCCAACTTCTACCTGTACCTGAGAGCCAGAGTGTGCGAGAACTGCATGGAGATGGACGTGATGAGCGTGGCCACCATCGTGATCGTGGACATCTGCATCACCGGCGGCCTGCTGCTGCTGGTGTACTACTGGAGCAAGAACAGAAAGGCCAAGGCCAAGCCCGTGACCAGAGGCGCCGGCGCCGGCGGCAGACAGAGAGGCCAGAACAAGGAGAGACCCCCCCCCGTGCCCAACCCCGACTACGAGCCCATCAGAAAGGGCCAGAGAGACCTGTACAGCGGCCTGAACCAGAGAAGAATCGGACCGCAGTGTACTAATTATGCTCTCTTGAAATTGGCTGGAGATGTTGAGAGCAATCCCGGGCCCATGCGCATTAGCAAGCCCCACCTGCGGAGCATCAGCATCCAGTGCTACCTGTGCCTGCTGCTGAACAGCCACTTCCTGACCGAGGCCGGCATCCACGTGTTCATCCTGGGCTGCTTCAGCGCCGGACTGCCCAAGACCGAGGCCAACTGGGTGAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCATGCACATCGACGCCACCCTGTACACCGAGAGCGACGTGCACCCCAGCTGCAAGGTGACCGCCATGAAGTGCTTTCTGCTGGAACTGCAGGTGATCAGCCTGGAAAGCGGCGACGCCAGCATCCACGACACCGTGGAGAACCTGATCATCCTGGCCAACAACAGCCTGAGCAGCAACGGCAACGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAGAAGAACATCAAAGAGTTTCTGCAGAGCTTCGTGCACATCGTGCAGATGTTCATCAACACCAGC(SEQ ID NO:59)
Z2: refers to full length cd3ζ, full length cd3γ, full length cd3δ, and full length cd3ε, also referred to as CD3ZGDEFLSP821CD28, linked to membrane-bound IL21 (membrane-bound IL21 has a CD8 transmembrane domain), representative sequences are as follows:
MLEMKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGPMEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGPQCTNYALLKLAGDVESNPGPMRICLTSDRLAPAAGLAAPRRQAVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDSTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDFWVLVVVGGVLACYSLLVTVAFIIFWV*(SEQ ID NO:60)
For CD3ZGDEFLSP821CD28, the sequences of the corresponding components are as follows, although these specific sequences or other sequences may be used for this and/or other constructs:
CD3:
MLEMKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGPMEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGPQCTNYALLKLAGDVESNPGP(SEQ ID NO:61)
ATGCTCGAGATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAACAGGGGAAGGGCCTGGCTGTCCTCATCCTGGCTATCATTCTTCTTCAAGGTACTTTGGCCCAGTCAATCAAAGGAAACCACTTGGTTAAGGTGTATGACTATCAAGAAGATGGTTCGGTACTTCTGACTTGTGATGCAGAAGCCAAAAATATCACATGGTTTAAAGATGGGAAGATGATCGGCTTCCTAACTGAAGATAAAAAAAAATGGAATCTGGGAAGTAATGCCAAGGACCCTCGTGGGATGTATCAGTGTAAAGGATCACAGAACAAGTCAAAACCACTCCAAGTGTATTACAGAATGTGTCAGAACTGCATTGAACTAAATGCAGCCACCATATCTGGCTTTCTCTTTGCTGAAATCGTCAGCATTTTCGTCCTTGCTGTTGGGGTCTACTTCATTGCTGGACAGGATGGAGTTCGCCAGTCGAGAGCTTCAGACAAGCAGACTCTGTTGCCCAATGACCAGCTCTACCAGCCCCTCAAGGATCGAGAAGATGACCAGTACAGCCACCTTCAAGGAAACCAGTTGAGGAGGAATGTGAAGCAGACCCTGAACTTCGACCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAGCACAGCACCTTCCTGAGCGGCCTGGTGCTGGCCACCCTGCTGAGCCAGGTGAGCCCCTTCAAGATCCCCATCGAGGAGCTGGAGGACAGAGTGTTCGTGAACTGCAACACCAGCATCACCTGGGTGGAGGGCACCGTGGGCACCCTGCTGAGCGACATCACCAGACTGGACCTGGGCAAGAGAATCCTGGACCCCAGAGGCATCTACAGATGCAACGGCACCGACATCTACAAGGACAAGGAGAGCACCGTGCAGGTGCACTACAGAATGTGCCAGAGCTGCGTGGAGCTGGACCCCGCCACCGTGGCCGGCATCATCGTGACCGACGTGATCGCCACCCTGCTGCTGGCCCTGGGCGTGTTCTGCTTCGCCGGCCACGAGACCGGCAGACTGAGCGGCGCCGCCGACACCCAGGCCCTGCTGAGAAACGACCAGGTGTACCAGCCCCTGAGAGACAGAGACGACGCCCAGTACAGCCACCTGGGCGGCAACTGGGCCAGAAACAAGGAGGGCAGAGGCAGCCTGCTGACCTGCGGCGACGTGGAGGAGAACCCCGGCCCCATGCAGAGCGGCACCCACTGGAGAGTGCTGGGCCTGTGCCTGCTGAGCGTGGGCGTGTGGGGCCAGGACGGCAACGAGGAGATGGGCGGCATCACCCAGACCCCCTACAAGGTGAGCATCAGCGGCACCACCGTGATCCTGACCTGCCCCCAGTACCCCGGCAGCGAGATCCTGTGGCAGCACAACGACAAGAACATCGGCGGCGACGAGGACGACAAGAACATCGGCAGCGACGAGGACCACCTGAGCCTGAAGGAGTTCAGCGAGCTGGAGCAGAGCGGCTACTACGTGTGCTACCCCAGAGGCAGCAAGCCCGAGGACGCCAACTTCTACCTGTACCTGAGAGCCAGAGTGTGCGAGAACTGCATGGAGATGGACGTGATGAGCGTGGCCACCATCGTGATCGTGGACATCTGCATCACCGGCGGCCTGCTGCTGCTGGTGTACTACTGGAGCAAGAACAGAAAGGCCAAGGCCAAGCCCGTGACCAGAGGCGCCGGCGCCGGCGGCAGACAGAGAGGCCAGAACAAGGAGAGACCCCCCCCCGTGCCCAACCCCGACTACGAGCCCATCAGAAAGGGCCAGAGAGACCTGTACAGCGGCCTGAACCAGAGAAGAATCGGACCGCAGTGTACTAATTATGCTCTCTTGAAATTGGCTGGAGATGTTGAGAGCAATCCCGGGCCC(SEQ ID NO:62)
SP CD8:
MRICLTSDRLAPAAGLAAPRRQAV(SEQ ID NO:63)
atgcgcatttgcctgaccagcgatcgcctggcgccggcggcgggcctggcggcgccgcgccgccaggcggtg(SEQ ID NO:64)
IL-21:
HKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS(SEQ ID NO:65)
CATAAATCTTCCTCTCAAGGTCAGGACCGCCATATGATTCGAATGCGGCAGCTGATTGACATAGTCGATCAACTGAAGAACTATGTGAATGATCTTGTGCCCGAGTTTTTGCCAGCCCCTGAAGACGTAGAAACTAATTGTGAGTGGAGTGCCTTTTCCTGCTTTCAAAAGGCACAGCTGAAATCCGCCAACACGGGCAATAACGAACGGATAATTAACGTATCCATTAAGAAGCTGAAGCGGAAGCCGCCCTCAACCAATGCGGGACGGCGGCAAAAGCATCGCTTGACCTGTCCGTCATGCGACAGCTACGAGAAAAAGCCCCCGAAGGAGTTCTTGGAACGCTTCAAGAGTCTCCTTCAGAAAATGATTCACCAGCACCTGTCCTCACGGACGCACGGAAGCGAGGACAGT(SEQ ID NO:66)
CD8 hinge:
TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD(SEQ ID NO:67)
ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGAT(SEQ ID NO:68)
CD28 transmembrane domain:
FWVLVVVGGVLACYSLLVTVAFIIFWV*(SEQ ID NO:69)
TTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCC TTTATTATTTTCTGGGTG(SEQ ID NO:70)
Z3: refers to full length cd3ζ, full length cd3γ, full length cd3δ, and full length cd3ε, also referred to as CD3ZGDEFL SP21CD8, linked to membrane bound IL21 (membrane bound IL21 has a CD28 transmembrane domain), which is represented by the following sequence:
MLEMKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGPMEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGPQCTNYALLKLAGDVESNPGPMRICLTSDRLAPAAGLAAPRRQAVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDSTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVIT(SEQ ID NO:71).
for CD3ZGDEFL8SP21CD8, the sequences of the corresponding components are as follows, although these specific sequences or other sequences may be used for this and/or other constructs:
CD3:
MLEMKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGPMEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGPQCTNYALLKLAGDVESNPGP(SEQ ID NO:61)ATGCTCGAGATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAACAGGGGAAGGGCCTGGCTGTCCTCATCCTGGCTATCATTCTTCTTCAAGGTACTTTGGCCCAGTCAATCAAAGGAAACCACTTGGTTAAGGTGTATGACTATCAAGAAGATGGTTCGGTACTTCTGACTTGTGATGCAGAAGCCAAAAATATCACATGGTTTAAAGATGGGAAGATGATCGGCTTCCTAACTGAAGATAAAAAAAAATGGAATCTGGGAAGTAATGCCAAGGACCCTCGTGGGATGTATCAGTGTAAAGGATCACAGAACAAGTCAAAACCACTCCAAGTGTATTACAGAATGTGTCAGAACTGCATTGAACTAAATGCAGCCACCATATCTGGCTTTCTCTTTGCTGAAATCGTCAGCATTTTCGTCCTTGCTGTTGGGGTCTACTTCATTGCTGGACAGGATGGAGTTCGCCAGTCGAGAGCTTCAGACAAGCAGACTCTGTTGCCCAATGACCAGCTCTACCAGCCCCTCAAGGATCGAGAAGATGACCAGTACAGCCACCTTCAAGGAAACCAGTTGAGGAGGAATGTGAAGCAGACCCTGAACTTCGACCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAGCACAGCACCTTCCTGAGCGGCCTGGTGCTGGCCACCCTGCTGAGCCAGGTGAGCCCCTTCAAGATCCCCATCGAGGAGCTGGAGGACAGAGTGTTCGTGAACTGCAACACCAGCATCACCTGGGTGGAGGGCACCGTGGGCACCCTGCTGAGCGACATCACCAGACTGGACCTGGGCAAGAGAATCCTGGACCCCAGAGGCATCTACAGATGCAACGGCACCGACATCTACAAGGACAAGGAGAGCACCGTGCAGGTGCACTACAGAATGTGCCAGAGCTGCGTGGAGCTGGACCCCGCCACCGTGGCCGGCATCATCGTGACCGACGTGATCGCCACCCTGCTGCTGGCCCTGGGCGTGTTCTGCTTCGCCGGCCACGAGACCGGCAGACTGAGCGGCGCCGCCGACACCCAGGCCCTGCTGAGAAACGACCAGGTGTACCAGCCCCTGAGAGACAGAGACGACGCCCAGTACAGCCACCTGGGCGGCAACTGGGCCAGAAACAAGGAGGGCAGAGGCAGCCTGCTGACCTGCGGCGACGTGGAGGAGAACCCCGGCCCCATGCAGAGCGGCACCCACTGGAGAGTGCTGGGCCTGTGCCTGCTGAGCGTGGGCGTGTGGGGCCAGGACGGCAACGAGGAGATGGGCGGCATCACCCAGACCCCCTACAAGGTGAGCATCAGCGGCACCACCGTGATCCTGACCTGCCCCCAGTACCCCGGCAGCGAGATCCTGTGGCAGCACAACGACAAGAACATCGGCGGCGACGAGGACGACAAGAACATCGGCAGCGACGAGGACCACCTGAGCCTGAAGGAGTTCAGCGAGCTGGAGCAGAGCGGCTACTACGTGTGCTACCCCAGAGGCAGCAAGCCCGAGGACGCCAACTTCTACCTGTACCTGAGAGCCAGAGTGTGCGAGAACTGCATGGAGATGGACGTGATGAGCGTGGCCACCATCGTGATCGTGGACATCTGCATCACCGGCGGCCTGCTGCTGCTGGTGTACTACTGGAGCAAGAACAGAAAGGCCAAGGCCAAGCCCGTGACCAGAGGCGCCGGCGCCGGCGGCAGACAGAGAGGCCAGAACAAGGAGAGACCCCCCCCCGTGCCCAACCCCGACTACGAGCCCATCAGAAAGGGCCAGAGAGACCTGTACAGCGGCCTGAACCAGAGAAGAATCGGACCGCAGTGTACTAATTATGCTCTCTTGAAATTGGCTGGAGATGTTGAGAGCAATCCCGGGCCC(SEQ ID NO:62)
SP CD8:
MRICLTSDRLAPAAGLAAPRRQAV(SEQ ID NO:63)
atgcgcatttgcctgaccagcgatcgcctggcgccggcggcgggcctggcggcgccgcgccgccaggcggtg(SEQ ID NO:64)
IL-21:
HKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS(SEQ ID NO:65)
cataaatcttcctctcaaggtcaggaccgccatatgattcgaatgcggcagctgattgacatagtcgatcaactgaagaactatgtgaatgatcttgtgcccgagtttttgccagcccctgaagacgtagaaactaattgtgagtggagtgccttttcctgctttcaaaaggcacagctgaaatccgccaacacgggcaataacgaacggataattaacgtatccattaagaagctgaagcggaagccgccctcaaccaatgcgggacggcggcaaaagcatcgcttgacctgtccgtcatgcgacagctacgagaaaaagcccccgaaggagttcttggaacgcttcaagagtctccttcagaaaatgattcaccagcacctgtcctcacggacgcacggaagcgaggacagt(SEQ ID NO:65)
CD8 hinge:
TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD(SEQ ID NO:67)
ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGAT(SEQ ID NO:68)
CD8 transmembrane domain:
IYIWAPLAGTCGVLLLSLVIT*(SEQ ID NO:72)
ATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACC(SEQ ID NO:73)
in certain embodiments, the CD3 constructs provided herein comprise fusions having intracellular co-stimulatory domains derived from CD16, NKG2D, DAP, DAP12, 2B4, 4-1BB, CD2, CD28, DNAM, or any combination thereof. In certain embodiments, the intracellular co-stimulatory domain is fused to cd3δ, cd3ε, cd3γ, and/or cd3ζ. In certain embodiments, such CD3 fusion constructs comprise cd3ζ fused to a DAP10 intracellular co-stimulatory domain. In certain embodiments, such a CD3 fusion construct comprises cd3ζ fused to a CD28 intracellular co-stimulatory domain. In certain embodiments, such CD3 fusion constructs comprise cd3ζ fused to DAP10 and CD28 intracellular co-stimulatory domains. In certain embodiments, CD3ζ fused to an intracellular co-stimulatory domain of DAP10 is represented by a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO. 106. In certain embodiments, CD3 zeta fused to the intracellular co-stimulatory domain of CD28 is represented by a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO. 107. In certain embodiments, the cd3ζ fused to the DAP10 intracellular co-stimulatory domain and the CD28 intracellular co-stimulatory domain is represented by a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID No. 108. In certain embodiments, CD3ζ fused to intracellular co-stimulatory domain of DAP10 is represented by an amino acid sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO. 109. In certain embodiments, CD3 zeta fused to the intracellular co-stimulatory domain of CD28 is represented by an amino acid sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO. 110. In certain embodiments, the cd3ζ fused to the DAP10 intracellular co-stimulatory domain and the CD28 intracellular co-stimulatory domain is represented by an amino acid sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID No. 111. In certain embodiments, the cd3ζ fused to the intracellular domain may not comprise the C-terminal 2A domain. In certain embodiments, the cd3ζ fused to the intracellular domain may not comprise an N-terminal signal peptide domain.
ATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGCTTTGCGCACGCCCACGCCGCAGCCCCGCCCAAGAAGATGGCAAAGTCTACATCAACATGCCAGGCAGGGGCAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCC(SEQ ID NO:106)
ATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCAAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCC(SEQ ID NO:107)ATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCACTTTGCGCACGCCCACGCCGCAGCCCCGCCCAAGAAGATGGCAAAGTCTACATCAACATGCCAGGCAGGGGCAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCC(SEQ ID NO:108)
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLLCARPRRSPAQEDGKVYINMPGRGRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGP(SEQ ID NO:109)
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGP(SEQ ID NO:110)
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSLCARPRRSPAQEDGKVYINMPGRGRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGP(SEQ ID NO:111)
In certain embodiments, the intracellular co-stimulatory domain of DAP10 is represented by a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO 112. In certain embodiments, the CD28 intracellular co-stimulatory domain is represented by a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 113. In certain embodiments, the DAP10 intracellular co-stimulatory domain and the CD28 intracellular co-stimulatory domain are represented by nucleotide sequences that are at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO. 114. In certain embodiments, the intracellular co-stimulatory domain of DAP10 is represented by an amino acid sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO. 115. In certain embodiments, the CD28 intracellular co-stimulatory domain is represented by an amino acid sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 116. In certain embodiments, the DAP10 intracellular co-stimulatory domain and the CD28 intracellular co-stimulatory domain are represented by amino acid sequences that are at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO. 117.
CTTTGCGCACGCCCACGCCGCAGCCCCGCCCAAGAAGATGGCAAAGTCTACATCAACATGCCAGGCAGGGGC(SEQ ID NO:112)
AGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCA(SEQ ID NO:113)
AGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCACTTTGCGCACGCCCACGCCGCAGCCCCGCCCAAGAAGATGGCAAAGTCTACATCAACATGCCAGGCAGGGGC(SEQ ID NO:114)
LCARPRRSPAQEDGKVYINMPGRG(SEQ ID NO:115)
RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS(SEQ ID NO:116)
RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSLCARPRRSPAQEDGKVYINMPGRG(SEQ ID NO:117)
UTNK15-DAP10: refers to a fusion of full length cd3ζ, comprising full length cd3δ, and full length cd3δ linked to IL15 with an intracellular co-stimulatory domain derived from DAP10, which can be represented by a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 118. In certain embodiments, UTNK-DAP 10 amino acid sequences can be represented by amino acid sequences that are at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO 119 .ATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGCTTTGCGCACGCCCACGCCGCAGCCCCGCCCAAGAAGATGGCAAAGTCTACATCAACATGCCAGGCAGGGGCAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAACAGGGGAAGGGCCTGGCTGTCCTCATCCTGGCTATCATTCTTCTTCAAGGTACTTTGGCCCAGTCAATCAAAGGAAACCACTTGGTTAAGGTGTATGACTATCAAGAAGATGGTTCGGTACTTCTGACTTGTGATGCAGAAGCCAAAAATATCACATGGTTTAAAGATGGGAAGATGATCGGCTTCCTAACTGAAGATAAAAAAAAATGGAATCTGGGAAGTAATGCCAAGGACCCTCGTGGGATGTATCAGTGTAAAGGATCACAGAACAAGTCAAAACCACTCCAAGTGTATTACAGAATGTGTCAGAACTGCATTGAACTAAATGCAGCCACCATATCTGGCTTTCTCTTTGCTGAAATCGTCAGCATTTTCGTCCTTGCTGTTGGGGTCTACTTCATTGCTGGACAGGATGGAGTTCGCCAGTCGAGAGCTTCAGACAAGCAGACTCTGTTGCCCAATGACCAGCTCTACCAGCCCCTCAAGGATCGAGAAGATGACCAGTACAGCCACCTTCAAGGAAACCAGTTGAGGAGGAATGTGAAGCAGACCCTGAACTTCGACCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAGCACAGCACCTTCCTGAGCGGCCTGGTGCTGGCCACCCTGCTGAGCCAGGTGAGCCCCTTCAAGATCCCCATCGAGGAGCTGGAGGACAGAGTGTTCGTGAACTGCAACACCAGCATCACCTGGGTGGAGGGCACCGTGGGCACCCTGCTGAGCGACATCACCAGACTGGACCTGGGCAAGAGAATCCTGGACCCCAGAGGCATCTACAGATGCAACGGCACCGACATCTACAAGGACAAGGAGAGCACCGTGCAGGTGCACTACAGAATGTGCCAGAGCTGCGTGGAGCTGGACCCCGCCACCGTGGCCGGCATCATCGTGACCGACGTGATCGCCACCCTGCTGCTGGCCCTGGGCGTGTTCTGCTTCGCCGGCCACGAGACCGGCAGACTGAGCGGCGCCGCCGACACCCAGGCCCTGCTGAGAAACGACCAGGTGTACCAGCCCCTGAGAGACAGAGACGACGCCCAGTACAGCCACCTGGGCGGCAACTGGGCCAGAAACAAGGAGGGCAGAGGCAGCCTGCTGACCTGCGGCGACGTGGAGGAGAACCCCGGCCCCATGCAGAGCGGCACCCACTGGAGAGTGCTGGGCCTGTGCCTGCTGAGCGTGGGCGTGTGGGGCCAGGACGGCAACGAGGAGATGGGCGGCATCACCCAGACCCCCTACAAGGTGAGCATCAGCGGCACCACCGTGATCCTGACCTGCCCCCAGTACCCCGGCAGCGAGATCCTGTGGCAGCACAACGACAAGAACATCGGCGGCGACGAGGACGACAAGAACATCGGCAGCGACGAGGACCACCTGAGCCTGAAGGAGTTCAGCGAGCTGGAGCAGAGCGGCTACTACGTGTGCTACCCCAGAGGCAGCAAGCCCGAGGACGCCAACTTCTACCTGTACCTGAGAGCCAGAGTGTGCGAGAACTGCATGGAGATGGACGTGATGAGCGTGGCCACCATCGTGATCGTGGACATCTGCATCACCGGCGGCCTGCTGCTGCTGGTGTACTACTGGAGCAAGAACAGAAAGGCCAAGGCCAAGCCCGTGACCAGAGGCGCCGGCGCCGGCGGCAGACAGAGAGGCCAGAACAAGGAGAGACCCCCCCCCGTGCCCAACCCCGACTACGAGCCCATCAGAAAGGGCCAGAGAGACCTGTACAGCGGCCTGAACCAGAGAAGAATCGGACCGCAGTGTACTAATTATGCTCTCTTGAAATTGGCTGGAGATGTTGAGAGCAATCCCGGGCCCATGCGCATTAGCAAGCCCCACCTGCGGAGCATCAGCATCCAGTGCTACCTGTGCCTGCTGCTGAACAGCCACTTCCTGACCGAGGCCGGCATCCACGTGTTCATCCTGGGCTGCTTCAGCGCCGGACTGCCCAAGACCGAGGCCAACTGGGTGAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCATGCACATCGACGCCACCCTGTACACCGAGAGCGACGTGCACCCCAGCTGCAAGGTGACCGCCATGAAGTGCTTTCTGCTGGAACTGCAGGTGATCAGCCTGGAAAGCGGCGACGCCAGCATCCACGACACCGTGGAGAACCTGATCATCCTGGCCAACAACAGCCTGAGCAGCAACGGCAACGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAGAAGAACATCAAAGAGTTTCTGCAGAGCTTCGTGCACATCGTGCAGATGTTCATCAACACCAGC(SEQ ID NO:118)
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLLCARPRRSPAQEDGKVYINMPGRGRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGPMEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQ.DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGPQCTNYALLKLAGDVESNPGPMRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS(SEQ ID NO:119)
UTNK15-28: refers to a fusion of full length cd3ζ comprising a full length cd3ζ and an intracellular co-stimulatory domain derived from CD28, full length cd3γ, full length cd3δ, and full length cd3ε linked to IL15, which may be represented by a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 120. In certain embodiments, the UTNK amino acid sequence may be represented by an amino acid sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 121.
ATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCAAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAACAGGGGAAGGGCCTGGCTGTCCTCATCCTGGCTATCATTCTTCTTCAAGGTACTTTGGCCCAGTCAATCAAAGGAAACCACTTGGTTAAGGTGTATGACTATCAAGAAGATGGTTCGGTACTTCTGACTTGTGATGCAGAAGCCAAAAATATCACATGGTTTAAAGATGGGAAGATGATCGGCTTCCTAACTGAAGATAAAAAAAAATGGAATCTGGGAAGTAATGCCAAGGACCCTCGTGGGATGTATCAGTGTAAAGGATCACAGAACAAGTCAAAACCACTCCAAGTGTATTACAGAATGTGTCAGAACTGCATTGAACTAAATGCAGCCACCATATCTGGCTTTCTCTTTGCTGAAATCGTCAGCATTTTCGTCCTTGCTGTTGGGGTCTACTTCATTGCTGGACAGGATGGAGTTCGCCAGTCGAGAGCTTCAGACAAGCAGACTCTGTTGCCCAATGACCAGCTCTACCAGCCCCTCAAGGATCGAGAAGATGACCAGTACAGCCACCTTCAAGGAAACCAGTTGAGGAGGAATGTGAAGCAGACCCTGAACTTCGACCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAGCACAGCACCTTCCTGAGCGGCCTGGTGCTGGCCACCCTGCTGAGCCAGGTGAGCCCCTTCAAGATCCCCATCGAGGAGCTGGAGGACAGAGTGTTCGTGAACTGCAACACCAGCATCACCTGGGTGGAGGGCACCGTGGGCACCCTGCTGAGCGACATCACCAGACTGGACCTGGGCAAGAGAATCCTGGACCCCAGAGGCATCTACAGATGCAACGGCACCGACATCTACAAGGACAAGGAGAGCACCGTGCAGGTGCACTACAGAATGTGCCAGAGCTGCGTGGAGCTGGACCCCGCCACCGTGGCCGGCATCATCGTGACCGACGTGATCGCCACCCTGCTGCTGGCCCTGGGCGTGTTCTGCTTCGCCGGCCACGAGACCGGCAGACTGAGCGGCGCCGCCGACACCCAGGCCCTGCTGAGAAACGACCAGGTGTACCAGCCCCTGAGAGACAGAGACGACGCCCAGTACAGCCACCTGGGCGGCAACTGGGCCAGAAACAAGGAGGGCAGAGGCAGCCTGCTGACCTGCGGCGACGTGGAGGAGAACCCCGGCCCCATGCAGAGCGGCACCCACTGGAGAGTGCTGGGCCTGTGCCTGCTGAGCGTGGGCGTGTGGGGCCAGGACGGCAACGAGGAGATGGGCGGCATCACCCAGACCCCCTACAAGGTGAGCATCAGCGGCACCACCGTGATCCTGACCTGCCCCCAGTACCCCGGCAGCGAGATCCTGTGGCAGCACAACGACAAGAACATCGGCGGCGACGAGGACGACAAGAACATCGGCAGCGACGAGGACCACCTGAGCCTGAAGGAGTTCAGCGAGCTGGAGCAGAGCGGCTACTACGTGTGCTACCCCAGAGGCAGCAAGCCCGAGGACGCCAACTTCTACCTGTACCTGAGAGCCAGAGTGTGCGAGAACTGCATGGAGATGGACGTGATGAGCGTGGCCACCATCGTGATCGTGGACATCTGCATCACCGGCGGCCTGCTGCTGCTGGTGTACTACTGGAGCAAGAACAGAAAGGCCAAGGCCAAGCCCGTGACCAGAGGCGCCGGCGCCGGCGGCAGACAGAGAGGCCAGAACAAGGAGAGACCCCCCCCCGTGCCCAACCCCGACTACGAGCCCATCAGAAAGGGCCAGAGAGACCTGTACAGCGGCCTGAACCAGAGAAGAATCGGACCGCAGTGTACTAATTATGCTCTCTTGAAATTGGCTGGAGATGTTGAGAGCAATCCCGGGCCCATGCGCATTAGCAAGCCCCACCTGCGGAGCATCAGCATCCAGTGCTACCTGTGCCTGCTGCTGAACAGCCACTTCCTGACCGAGGCCGGCATCCACGTGTTCATCCTGGGCTGCTTCAGCGCCGGACTGCCCAAGACCGAGGCCAACTGGGTGAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCATGCACATCGACGCCACCCTGTACACCGAGAGCGACGTGCACCCCAGCTGCAAGGTGACCGCCATGAAGTGCTTTCTGCTGGAACTGCAGGTGATCAGCCTGGAAAGCGGCGACGCCAGCATCCACGACACCGTGGAGAACCTGATCATCCTGGCCAACAACAGCCTGAGCAGCAACGGCAACGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAGAAGAACATCAAAGAGTTTCTGCAGAGCTTCGTGCACATCGTGCAGATGTTCATCAACACCAGC(SEQ ID NO:120)
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGPMEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQ.DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGPQCTNYALLKLAGDVESNPGPMRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS(SEQ ID NO:121)
UTNK15-28-DAP10: refers to a fusion of full length cd3ζ comprising a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 122 with an intracellular co-stimulatory domain derived from DAP10 and an intracellular co-stimulatory domain derived from CD28, full length cd3γ, full length cd3δ, and full length cd3ε linked to IL 15. In certain embodiments, UTNK-28-DAP 10 amino acid sequences can be represented by amino acid sequences that are at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO. 123.
ATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCACTTTGCGCACGCCCACGCCGCAGCCCCGCCCAAGAAGATGGCAAAGTCTACATCAACATGCCAGGCAGGGGCAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAACAGGGGAAGGGCCTGGCTGTCCTCATCCTGGCTATCATTCTTCTTCAAGGTACTTTGGCCCAGTCAATCAAAGGAAACCACTTGGTTAAGGTGTATGACTATCAAGAAGATGGTTCGGTACTTCTGACTTGTGATGCAGAAGCCAAAAATATCACATGGTTTAAAGATGGGAAGATGATCGGCTTCCTAACTGAAGATAAAAAAAAATGGAATCTGGGAAGTAATGCCAAGGACCCTCGTGGGATGTATCAGTGTAAAGGATCACAGAACAAGTCAAAACCACTCCAAGTGTATTACAGAATGTGTCAGAACTGCATTGAACTAAATGCAGCCACCATATCTGGCTTTCTCTTTGCTGAAATCGTCAGCATTTTCGTCCTTGCTGTTGGGGTCTACTTCATTGCTGGACAGGATGGAGTTCGCCAGTCGAGAGCTTCAGACAAGCAGACTCTGTTGCCCAATGACCAGCTCTACCAGCCCCTCAAGGATCGAGAAGATGACCAGTACAGCCACCTTCAAGGAAACCAGTTGAGGAGGAATGTGAAGCAGACCCTGAACTTCGACCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAGCACAGCACCTTCCTGAGCGGCCTGGTGCTGGCCACCCTGCTGAGCCAGGTGAGCCCCTTCAAGATCCCCATCGAGGAGCTGGAGGACAGAGTGTTCGTGAACTGCAACACCAGCATCACCTGGGTGGAGGGCACCGTGGGCACCCTGCTGAGCGACATCACCAGACTGGACCTGGGCAAGAGAATCCTGGACCCCAGAGGCATCTACAGATGCAACGGCACCGACATCTACAAGGACAAGGAGAGCACCGTGCAGGTGCACTACAGAATGTGCCAGAGCTGCGTGGAGCTGGACCCCGCCACCGTGGCCGGCATCATCGTGACCGACGTGATCGCCACCCTGCTGCTGGCCCTGGGCGTGTTCTGCTTCGCCGGCCACGAGACCGGCAGACTGAGCGGCGCCGCCGACACCCAGGCCCTGCTGAGAAACGACCAGGTGTACCAGCCCCTGAGAGACAGAGACGACGCCCAGTACAGCCACCTGGGCGGCAACTGGGCCAGAAACAAGGAGGGCAGAGGCAGCCTGCTGACCTGCGGCGACGTGGAGGAGAACCCCGGCCCCATGCAGAGCGGCACCCACTGGAGAGTGCTGGGCCTGTGCCTGCTGAGCGTGGGCGTGTGGGGCCAGGACGGCAACGAGGAGATGGGCGGCATCACCCAGACCCCCTACAAGGTGAGCATCAGCGGCACCACCGTGATCCTGACCTGCCCCCAGTACCCCGGCAGCGAGATCCTGTGGCAGCACAACGACAAGAACATCGGCGGCGACGAGGACGACAAGAACATCGGCAGCGACGAGGACCACCTGAGCCTGAAGGAGTTCAGCGAGCTGGAGCAGAGCGGCTACTACGTGTGCTACCCCAGAGGCAGCAAGCCCGAGGACGCCAACTTCTACCTGTACCTGAGAGCCAGAGTGTGCGAGAACTGCATGGAGATGGACGTGATGAGCGTGGCCACCATCGTGATCGTGGACATCTGCATCACCGGCGGCCTGCTGCTGCTGGTGTACTACTGGAGCAAGAACAGAAAGGCCAAGGCCAAGCCCGTGACCAGAGGCGCCGGCGCCGGCGGCAGACAGAGAGGCCAGAACAAGGAGAGACCCCCCCCCGTGCCCAACCCCGACTACGAGCCCATCAGAAAGGGCCAGAGAGACCTGTACAGCGGCCTGAACCAGAGAAGAATCGGACCGCAGTGTACTAATTATGCTCTCTTGAAATTGGCTGGAGATGTTGAGAGCAATCCCGGGCCCATGCGCATTAGCAAGCCCCACCTGCGGAGCATCAGCATCCAGTGCTACCTGTGCCTGCTGCTGAACAGCCACTTCCTGACCGAGGCCGGCATCCACGTGTTCATCCTGGGCTGCTTCAGCGCCGGACTGCCCAAGACCGAGGCCAACTGGGTGAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCATGCACATCGACGCCACCCTGTACACCGAGAGCGACGTGCACCCCAGCTGCAAGGTGACCGCCATGAAGTGCTTTCTGCTGGAACTGCAGGTGATCAGCCTGGAAAGCGGCGACGCCAGCATCCACGACACCGTGGAGAACCTGATCATCCTGGCCAACAACAGCCTGAGCAGCAACGGCAACGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAGAAGAACATCAAAGAGTTTCTGCAGAGCTTCGTGCACATCGTGCAGATGTTCATCAACACCAGC(SEQ ID NO:122)
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSLCARPRRSPAQEDGKVYINMPGRGRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGPMEQGKGLAVLILAI ILLQGTLAQS IKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATI SGFLFAEIVS IFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKI PIEELEDRVFVNCNTS ITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGI IVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQ.DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGPQCTNYALLKLAGDVESNPGPMRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS(SEQ ID NO:123)
As shown in FIG. 3 and described above, the term "linked" refers to the presence on the same polynucleotide vector and does not necessarily mean that two polypeptides are expressed as one polypeptide. For example, cytokines produced by the vectors of the invention may ultimately be produced as isolated molecules from components of any one or more of the TCR/CD3 receptor complexes. However, the term "fused" or "fusion" refers to two polypeptides comprising peptide bonds linking two molecules, i.e., the two polypeptides are covalently bound by an amide bond and are not separated by a cleavage element (e.g., a 2A element).
One specific example of a TCR that may be used in a cell is an NY-ESO TCR, specific examples of sequences include at least the following:
TCRα:
XQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPLYGGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:25)
TCRβ:
GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSYVGNTGELFFGEGSRLTVLEDLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG(SEQ ID NO:26)
In certain embodiments, the TCR may comprise a TCR a chain variable region encoded by a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 85.
In certain embodiments, the TCR may comprise a TCR a chain constant region encoded by a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 86.
/>
In certain embodiments, the TCR may comprise a TCR a chain encoded by a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 87.
In certain embodiments, the TCR may comprise a TCR a chain variable region amino acid sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 88.
In certain embodiments, a TCR may comprise an amino acid sequence of a TCR a chain constant region that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 89.
In certain embodiments, the TCR can comprise an amino acid sequence of the alpha chain CDR1 that is at least or exactly 80% or 100% identical to SEQ ID NO 90.
In certain embodiments, the TCR can comprise an amino acid sequence of the alpha chain CDR2 that is at least or exactly 80% or 100% identical to SEQ ID NO 91.
In certain embodiments, the TCR can comprise an amino acid sequence of the alpha chain CDR3 that is at least or exactly 80% or 100% identical to SEQ ID NO. 92.
In certain embodiments, the TCR may comprise a TCR β chain variable region encoded by a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 93.
In certain embodiments, the TCR may comprise a TCR β chain constant region encoded by a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 94.
In certain embodiments, the TCR may comprise a TCR β chain encoded by a nucleotide sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 95.
In certain embodiments, the TCR may comprise a TCR β chain variable region amino acid sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 96.
In certain embodiments, a TCR may comprise a TCR β chain constant region amino acid sequence that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 97.
In certain embodiments, the TCR can comprise an amino acid sequence of the β chain CDR1 that is at least or exactly 80% or 100% identical to SEQ ID NO 98.
In certain embodiments, the TCR can comprise an amino acid sequence of the β chain CDR2 that is at least or exactly 80% or 100% identical to SEQ ID NO 99.
In certain embodiments, the TCR can comprise an amino acid sequence of the β chain CDR3 that is at least or exactly 80% or 100% identical to SEQ ID NO. 100.
In certain embodiments, the TCR (e.g., TCR α, β, δ, and/or γ) chains can comprise a signal peptide. In certain embodiments, the signal peptide is encoded by a nucleic acid that is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO 101 or SEQ ID NO 102. In certain embodiments, the signal peptide is at least or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO. 103 or SEQ ID NO. 104.
In certain embodiments, the TCR recognizes a peptide corresponding to amino acid residues 157-165 of human cancer testis Ag NY-ESO-1 in the context of an HLA-A 02I allele. In certain embodiments, the TCR can target an epitope characterized by the amino acid sequence of SEQ ID NO. 105.
One specific example of a TCR that can be used in a cell is TCRpp65 a, and specific examples of sequences include at least the following (underlined refers to the sequence of the signal peptide):
One specific example of a TCR that can be used in a cell is TCRpp65 β, and specific examples of sequences include at least the following (underlined refers to the sequence of the signal peptide):
TCRpp65ZFLGDEFL15
In certain embodiments, constructs in which TCRpp is linked to full length cd3ζ, full length cd3γ, full length cd3δ, full length cd3ε, and also to IL-15 (and may be referred to as TCRpp65ZFLGDEFL 15) may be utilized. One representative sequence of such a construct is as follows:
MLEGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSPVTGGIYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADATNFSLLKQAGDVEENPGPMILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCARNTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDAYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSEGRGSLLTCGDVEENPGPMKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGPMEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGPQCTNYALLKLAGDVESNPGPMRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS*(SEQ ID NO:74).
In TCRpp65ZFLGDEFL, the sequences of the corresponding components are as follows, although these specific sequences or other sequences may be used for this other construct and/or other constructs:
TCRb ectodomain:
MLEGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSPVTGGIYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADATNFSLLKQAGDVEENPGP(SEQ ID NO:75)( And includes a P2A sequence at its C-terminus
ATGCTCGAGGGAGTGACCCAGACCCCCAAGTTCCAGGTGCTGAAGACCGGACAGAGCATGACCCTGCAGTGCGCCCAGGACATGAACCACGAGTACATGAGCTGGTACCGGCAGGACCCCGGAATGGGACTGCGGCTGATCCACTACAGCGTGGGAGCCGGAATCACCGACCAGGGAGAGGTGCCCAACGGATACAACGTGAGCCGGAGCACCACCGAGGACTTCCCCCTGCGGCTGCTGAGCGCCGCCCCCAGCCAGACCAGCGTGTACTTCTGCGCCAGCAGCCCCGTGACCGGAGGAATCTACGGATACACCTTCGGAAGCGGAACCCGGCTGACCGTGGTGGAGGACCTGAACAAGGTGTTCCCCCCCGAGGTGGCCGTGTTCGAGCCCAGCGAGGCCGAGATCAGCCACACCCAGAAGGCCACCCTGGTGTGCCTGGCCACCGGATTCTTCCCCGACCACGTGGAGCTGAGCTGGTGGGTGAACGGAAAGGAGGTGCACAGCGGAGTGAGCACCGACCCCCAGCCCCTGAAGGAGCAGCCCGCCCTGAACGACAGCCGGTACTGCCTGAGCAGCCGGCTGCGGGTGAGCGCCACCTTCTGGCAGAACCCCCGGAACCACTTCCGGTGCCAGGTGCAGTTCTACGGACTGAGCGAGAACGACGAGTGGACCCAGGACCGGGCCAAGCCCGTGACCCAGATCGTGAGCGCCGAGGCCTGGGGACGGGCCGAC(SEQ ID NO:76)
TCRa extracellular domain:
MILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCARNTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDAYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSEGRGSLLTCGDVEENPGP(SEQ ID NO:77)( And includes a T2A sequence at its C-terminus
ATGATCCTGAACGTGGAGCAGAGCCCCCAGAGCCTGCACGTGCAGGAGGGAGACAGCACCAACTTCACCTGCAGCTTCCCCAGCAGCAACTTCTACGCCCTGCACTGGTACCGGTGGGAGACCGCCAAGAGCCCCGAGGCCCTGTTCGTGATGACCCTGAACGGAGACGAGAAGAAGAAGGGACGGATCAGCGCCACCCTGAACACCAAGGAGGGATACAGCTACCTGTACATCAAGGGAAGCCAGCCCGAGGACAGCGCCACCTACCTGTGCGCCCGGAACACCGGAAACCAGTTCTACTTCGGAACCGGAACCAGCCTGACCGTGATCCCCAACATCCAGAACCCCGACCCCGCCGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGAGCCAGAGCAAGGACAGCGACGCCTACATCACCGACAAGACCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAACAGCGCCGTGGCCTGGAGCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATCATCCCCGAGGACACCTTCTTCCCCAGCCCCGAGAGCAGCGCCACCAACTTCTCCCTGCTGAAGCAGGCCGGCGACGTGGAGGAGAACCCCGGCCCC(SEQ ID NO:78)
TCR5: designated TCRCgdZFLGDEFL, is the constant region of tcrγ and δ linked to full length cdζ, full length cd3γ, full length cd3δ and full length cd3ε; IL-15. Representative sequences are as follows:
TCR constant gamma delta (TCRCgd)
ATGCGGTGGGCCCTACTGGTGCTTCTAGCTTTCCTGTCTCCTGCCAGTCAGGATAAACAACTTGATGCAGATGTTTCCCCCAAGCCCACTATTTTTCTTCCTTCGATTGCTGAAACAAAACTCCAGAAGGCTGGAACATACCTTTGTCTTCTTGAGAAATTTTTCCCAGATATTATTAAGATACATTGGCAAGAAAAGAAGAGCAACACGATTCTGGGATCCCAGGAGGGGAACACCATGAAGACTAACGACACATACATGAAATTTAGCTGGTTAACGGTGCCAGAAGAGTCACTGGACAAAGAACACAGATGTATCGTCAGACATGAGAATAATAAAAACGGAATTGATCAAGAAATTATCTTTCCTCCAATAAAGACAGATGTCACCACAGTGGATCCCAAATACAATTATTCAAAGGATGCAAATGATGTCATCACAATGGATCCCAAAGACAATTGGTCAAAAGATGCAAATGATACACTACTGCTGCAGCTCACAAACACCTCTGCATATTACACGTACCTCCTCCTGCTCCTCAAGAGTGTGGTCTATTTTGCCATCATCACCTGCTGTCTGCTTAGAAGAACGGCTTTCTGCTGCAATGGAGAGAAATCAGGAAGCGGAGCTACTAACTTTAGCCTGCTGAAGCAGGCTGGAGATGTGGAGGAGAACCCTGGACCTATGATTCTTACTGTGGGCTTTAGCTTTTTGTTTTTCTACAGGGGCACGCTGTGTAGTCAGCCTCATACCAAACCATCCGTTTTTGTCATGAAAAATGGAACAAATGTCGCTTGTCTGGTGAAGGAATTCTACCCCAAGGATATAAGAATAAATCTCGTGTCATCCAAGAAGATAACAGAGTTTGATCCTGCTATTGTCATCTCTCCCAGTGGGAAGTACAATGCTGTCAAGCTTGGTAAATATGAAGATTCAAATTCAGTGACATGTTCAGTTCAACACGACAATAAAACTGTGCACTCCACTGACTTTGAAGTGAAGACAGATTCTACAGATCACGTAAAACCAAAGGAAACTGAAAACACAAAGCAACCTTCAAAGAGCTGCCATAAACCCAAAGCCATAGTTCATACCGAGAAGGTGAACATGATGTCCCTCACAGTGCTTGGGCTACGAATGCTGTTTGCAAAGACTGTTGCCGTCAATTTTCTCTTGACTGCCAAGTTATTTTTCTTGTAA(SEQ ID NO:81)
MRWALLVLLAFLSPASQDKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDIIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGIDQEIIFPPIKTDVTTVDPKYNYSKDANDVITMDPKDNWSKDANDTLLLQLTNTSAYYTYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKSGSGATNFSLLKQAGDVEENPGPMILTVGFSFLFFYRGTLCSQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL(SEQ ID NO:82)
CD3:
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGPMEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGPQCTNYALLKLAGDVESNPGP(SEQ ID NO:79)
ATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAACAGGGGAAGGGCCTGGCTGTCCTCATCCTGGCTATCATTCTTCTTCAAGGTACTTTGGCCCAGTCAATCAAAGGAAACCACTTGGTTAAGGTGTATGACTATCAAGAAGATGGTTCGGTACTTCTGACTTGTGATGCAGAAGCCAAAAATATCACATGGTTTAAAGATGGGAAGATGATCGGCTTCCTAACTGAAGATAAAAAAAAATGGAATCTGGGAAGTAATGCCAAGGACCCTCGTGGGATGTATCAGTGTAAAGGATCACAGAACAAGTCAAAACCACTCCAAGTGTATTACAGAATGTGTCAGAACTGCATTGAACTAAATGCAGCCACCATATCTGGCTTTCTCTTTGCTGAAATCGTCAGCATTTTCGTCCTTGCTGTTGGGGTCTACTTCATTGCTGGACAGGATGGAGTTCGCCAGTCGAGAGCTTCAGACAAGCAGACTCTGTTGCCCAATGACCAGCTCTACCAGCCCCTCAAGGATCGAGAAGATGACCAGTACAGCCACCTTCAAGGAAACCAGTTGAGGAGGAATGTGAAGCAGACCCTGAACTTCGACCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAGCACAGCACCTTCCTGAGCGGCCTGGTGCTGGCCACCCTGCTGAGCCAGGTGAGCCCCTTCAAGATCCCCATCGAGGAGCTGGAGGACAGAGTGTTCGTGAACTGCAACACCAGCATCACCTGGGTGGAGGGCACCGTGGGCACCCTGCTGAGCGACATCACCAGACTGGACCTGGGCAAGAGAATCCTGGACCCCAGAGGCATCTACAGATGCAACGGCACCGACATCTACAAGGACAAGGAGAGCACCGTGCAGGTGCACTACAGAATGTGCCAGAGCTGCGTGGAGCTGGACCCCGCCACCGTGGCCGGCATCATCGTGACCGACGTGATCGCCACCCTGCTGCTGGCCCTGGGCGTGTTCTGCTTCGCCGGCCACGAGACCGGCAGACTGAGCGGCGCCGCCGACACCCAGGCCCTGCTGAGAAACGACCAGGTGTACCAGCCCCTGAGAGACAGAGACGACGCCCAGTACAGCCACCTGGGCGGCAACTGGGCCAGAAACAAGGAGGGCAGAGGCAGCCTGCTGACCTGCGGCGACGTGGAGGAGAACCCCGGCCCCATGCAGAGCGGCACCCACTGGAGAGTGCTGGGCCTGTGCCTGCTGAGCGTGGGCGTGTGGGGCCAGGACGGCAACGAGGAGATGGGCGGCATCACCCAGACCCCCTACAAGGTGAGCATCAGCGGCACCACCGTGATCCTGACCTGCCCCCAGTACCCCGGCAGCGAGATCCTGTGGCAGCACAACGACAAGAACATCGGCGGCGACGAGGACGACAAGAACATCGGCAGCGACGAGGACCACCTGAGCCTGAAGGAGTTCAGCGAGCTGGAGCAGAGCGGCTACTACGTGTGCTACCCCAGAGGCAGCAAGCCCGAGGACGCCAACTTCTACCTGTACCTGAGAGCCAGAGTGTGCGAGAACTGCATGGAGATGGACGTGATGAGCGTGGCCACCATCGTGATCGTGGACATCTGCATCACCGGCGGCCTGCTGCTGCTGGTGTACTACTGGAGCAAGAACAGAAAGGCCAAGGCCAAGCCCGTGACCAGAGGCGCCGGCGCCGGCGGCAGACAGAGAGGCCAGAACAAGGAGAGACCCCCCCCCGTGCCCAACCCCGACTACGAGCCCATCAGAAAGGGCCAGAGAGACCTGTACAGCGGCCTGAACCAGAGAAGAATCGGACCGCAGTGTACTAATTATGCTCTCTTGAAATTGGCTGGAGATGTTGAGAGCAATCCCGGGCCC(SEQ ID NO:80)
IL-15:
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS*(SEQ ID NO:48)
ATGCGCATTAGCAAGCCCCACCTGCGGAGCATCAGCATCCAGTGCTACCTGTGCCTGCTGCTGAACAGCCACTTCCTGACCGAGGCCGGCATCCACGTGTTCATCCTGGGCTGCTTCAGCGCCGGACTGCCCAAGACCGAGGCCAACTGGGTGAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCATGCACATCGACGCCACCCTGTACACCGAGAGCGACGTGCACCCCAGCTGCAAGGTGACCGCCATGAAGTGCTTTCTGCTGGAACTGCAGGTGATCAGCCTGGAAAGCGGCGACGCCAGCATCCACGACACCGTGGAGAACCTGATCATCCTGGCCAACAACAGCCTGAGCAGCAACGGCAACGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAGAAGAACATCAAAGAGTTTCTGCAGAGCTTCGTGCACATCGTGCAGATGTTCATCAACACCAGC(SEQ ID NO:49)
TCR6: also known as TCRCabZFLGDEFL, is the constant region of tcra and β, linked to full length cd3ζ, full length cd3γ, full length cd3δ and full length cd3ε; IL-15. Representative sequences are as follows:
TCR constant alpha-beta (TCRCab)
METLLGLLILWLQLQWVSSIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSSGSGATNFSLLKQAGDVEENPGPMSIGLLCCAALSLLWAGPVNADLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG(SEQ ID NO:83)
ATGGAGACCCTCTTGGGCCTGCTTATCCTTTGGCTGCAGCTGCAATGGGTGAGCAGCATCCAGAACCCTGACCCTGCCGTGTACCAGCTGAGAGACTCTAAATCCAGTGACAAGTCTGTCTGCCTATTCACCGATTTTGATTCTCAAACAAATGTGTCACAAAGTAAGGATTCTGATGTGTATATCACAGACAAAACTGTGCTAGACATGAGGTCTATGGACTTCAAGAGCAACAGTGCTGTGGCCTGGAGCAACAAATCTGACTTTGCATGTGCAAACGCCTTCAACAACAGCATTATTCCAGAAGACACCTTCTTCCCCAGCCCAGAAAGTTCCTGTGATGTCAAGCTGGTCGAGAAAAGCTTTGAAACAGATACGAACCTAAACTTTCAAAACCTGTCAGTGATTGGGTTCCGAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCTCATGACGCTGCGGCTGTGGTCCAGCGGAAGCGGAGCTACTAACTTTAGCCTGCTGAAGCAGGCTGGAGATGTGGAGGAGAACCCTGGACCTATGAGCATCGGCCTCCTGTGCTGTGCAGCCTTGTCTCTCCTGTGGGCAGGTCCAGTGAATGCTGACCTGAAAAACGTGTTCCCACCCAAGGTCGCTGTGTTTGAGCCATCAGAAGCAGAGATCTCCCACACCCAAAAGGCCACACTGGTATGCCTGGCCACAGGCTTCTACCCCGACCACGTGGAGCTGAGCTGGTGGGTGAATGGGAAGGAGGTGCACAGTGGGGTCAGCACAGACCCGCAGCCCCTCAAGGAGCAGCCCGCCCTCAATGACTCCAGATACTGCCTGAGCAGCCGCCTGAGGGTCTCGGCCACCTTCTGGCAGAACCCCCGCAACCACTTCCGCTGTCAAGTCCAGTTCTACGGGCTCTCGGAGAATGACGAGTGGACCCAGGATAGGGCCAAACCCGTCACCCAGATCGTCAGCGCCGAGGCCTGGGGTAGAGCAGACTGTGGCTTCACCTCCGAGTCTTACCAGCAAGGGGTCCTGTCTGCCACCATCCTCTATGAGATCTTGCTAGGGAAGGCCACCTTGTATGCCGTGCTGGTCAGTGCCCTCGTGCTGATGGCCATGGTCAAGAGAAAGGATTCCAGAGGCTAA(SEQ ID NO:84)
CD3:
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPGPMEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNVKQTLNFDLLKLAGDVESNPGPMEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEGRGSLLTCGDVEENPGPMQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGPQCTNYALLKLAGDVESNPGP(SEQ ID NO:79)
ATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAACAGGGGAAGGGCCTGGCTGTCCTCATCCTGGCTATCATTCTTCTTCAAGGTACTTTGGCCCAGTCAATCAAAGGAAACCACTTGGTTAAGGTGTATGACTATCAAGAAGATGGTTCGGTACTTCTGACTTGTGATGCAGAAGCCAAAAATATCACATGGTTTAAAGATGGGAAGATGATCGGCTTCCTAACTGAAGATAAAAAAAAATGGAATCTGGGAAGTAATGCCAAGGACCCTCGTGGGATGTATCAGTGTAAAGGATCACAGAACAAGTCAAAACCACTCCAAGTGTATTACAGAATGTGTCAGAACTGCATTGAACTAAATGCAGCCACCATATCTGGCTTTCTCTTTGCTGAAATCGTCAGCATTTTCGTCCTTGCTGTTGGGGTCTACTTCATTGCTGGACAGGATGGAGTTCGCCAGTCGAGAGCTTCAGACAAGCAGACTCTGTTGCCCAATGACCAGCTCTACCAGCCCCTCAAGGATCGAGAAGATGACCAGTACAGCCACCTTCAAGGAAACCAGTTGAGGAGGAATGTGAAGCAGACCCTGAACTTCGACCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGAGCACAGCACCTTCCTGAGCGGCCTGGTGCTGGCCACCCTGCTGAGCCAGGTGAGCCCCTTCAAGATCCCCATCGAGGAGCTGGAGGACAGAGTGTTCGTGAACTGCAACACCAGCATCACCTGGGTGGAGGGCACCGTGGGCACCCTGCTGAGCGACATCACCAGACTGGACCTGGGCAAGAGAATCCTGGACCCCAGAGGCATCTACAGATGCAACGGCACCGACATCTACAAGGACAAGGAGAGCACCGTGCAGGTGCACTACAGAATGTGCCAGAGCTGCGTGGAGCTGGACCCCGCCACCGTGGCCGGCATCATCGTGACCGACGTGATCGCCACCCTGCTGCTGGCCCTGGGCGTGTTCTGCTTCGCCGGCCACGAGACCGGCAGACTGAGCGGCGCCGCCGACACCCAGGCCCTGCTGAGAAACGACCAGGTGTACCAGCCCCTGAGAGACAGAGACGACGCCCAGTACAGCCACCTGGGCGGCAACTGGGCCAGAAACAAGGAGGGCAGAGGCAGCCTGCTGACCTGCGGCGACGTGGAGGAGAACCCCGGCCCCATGCAGAGCGGCACCCACTGGAGAGTGCTGGGCCTGTGCCTGCTGAGCGTGGGCGTGTGGGGCCAGGACGGCAACGAGGAGATGGGCGGCATCACCCAGACCCCCTACAAGGTGAGCATCAGCGGCACCACCGTGATCCTGACCTGCCCCCAGTACCCCGGCAGCGAGATCCTGTGGCAGCACAACGACAAGAACATCGGCGGCGACGAGGACGACAAGAACATCGGCAGCGACGAGGACCACCTGAGCCTGAAGGAGTTCAGCGAGCTGGAGCAGAGCGGCTACTACGTGTGCTACCCCAGAGGCAGCAAGCCCGAGGACGCCAACTTCTACCTGTACCTGAGAGCCAGAGTGTGCGAGAACTGCATGGAGATGGACGTGATGAGCGTGGCCACCATCGTGATCGTGGACATCTGCATCACCGGCGGCCTGCTGCTGCTGGTGTACTACTGGAGCAAGAACAGAAAGGCCAAGGCCAAGCCCGTGACCAGAGGCGCCGGCGCCGGCGGCAGACAGAGAGGCCAGAACAAGGAGAGACCCCCCCCCGTGCCCAACCCCGACTACGAGCCCATCAGAAAGGGCCAGAGAGACCTGTACAGCGGCCTGAACCAGAGAAGAATCGGACCGCAGTGTACTAATTATGCTCTCTTGAAATTGGCTGGAGATGTTGAGAGCAATCCCGGGCCC(SEQ ID NO:80)
IL-15:
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS*(SEQ ID NO:48)
ATGCGCATTAGCAAGCCCCACCTGCGGAGCATCAGCATCCAGTGCTACCTGTGCCTGCTGCTGAACAGCCACTTCCTGACCGAGGCCGGCATCCACGTGTTCATCCTGGGCTGCTTCAGCGCCGGACTGCCCAAGACCGAGGCCAACTGGGTGAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCATGCACATCGACGCCACCCTGTACACCGAGAGCGACGTGCACCCCAGCTGCAAGGTGACCGCCATGAAGTGCTTTCTGCTGGAACTGCAGGTGATCAGCCTGGAAAGCGGCGACGCCAGCATCCACGACACCGTGGAGAACCTGATCATCCTGGCCAACAACAGCCTGAGCAGCAACGGCAACGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAGAAGAACATCAAAGAGTTTCTGCAGAGCTTCGTGCACATCGTGCAGATGTTCATCAACACCAGC(SEQ ID NO:49)
In some embodiments, the TCR construct comprises an NY ESO-specific TCR and a CD8 a/β co-receptor molecule. In some embodiments, such constructs may comprise a TCR a chain variable region signal peptide, a TCR a chain variable region, a TCR a chain constant region, a 2A element (e.g., a P2A element), a TCR β chain variable region signal peptide, a TCR β chain variable region, a TCR β chain constant region, a 2A element (e.g., an E2A element), a CD8- β polypeptide, a 2A element (e.g., a T2A element), and a CD 8-a polypeptide. In some embodiments, a TCR construct comprising NY ESO-specific TCR and CD8 a/β co-receptor molecule nucleotide coding sequences is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 124. In some embodiments, a TCR construct comprising NY ESO-specific TCR and a CD8 a/β co-receptor molecule amino acid sequence is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID No. 125.
In some embodiments, the CD 8a co-receptor molecule is transcriptionally linked to any TCR molecule disclosed herein. In some embodiments, the nucleotide coding sequence of the CD 8. Alpha. Co-receptor molecule is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO. 126. In some embodiments, the nucleotide coding sequence of the CD8 beta co-receptor molecule is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO 127. In some embodiments, the amino acid sequence of the CD 8. Alpha. Co-receptor is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO 128. In some embodiments, the amino acid sequence of the CD8 beta co-receptor is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO. 129.
ATGGAGACCCTCTTGGGCCTGCTTATCCTTTGGCTGCAGCTGCAATGGGTGAGCAGCAAACAG
GAGGTGACACAGATTCCTGCAGCTCTGAGTGTCCCAGAAGGAGAAAACTTGGTTCTCAACTGC
AGTTTCACTGATAGCGCTATTTACAACCTCCAGTGGTTTAGGCAGGACCCTGGGAAAGGTCTC
ACATCTCTGTTGCTTATTCAGTCAAGTCAGAGAGAGCAAACAAGTGGAAGACTTAATGCCTCG
CTGGATAAATCATCAGGACGTAGTACTTTATACATTGCAGCTTCTCAGCCTGGTGACTCAGCC
ACCTACCTCTGTGCTGTGAGGCCCCTTTATGGAGGAAGCTACATACCTACATTTGGAAGAGGA
ACCAGCCTTATTGTTCATCCGTATATCCAGAACCCTGACCCTGCCGTGTACCAGCTGAGAGAC
TCTAAATCCAGTGACAAGTCTGTCTGCCTATTCACCGATTTTGATTCTCAAACAAATGTGTCA
CAAAGTAAGGATTCTGATGTGTATATCACAGACAAAACTGTGCTAGACATGAGGTCTATGGAC
TTCAAGAGCAACAGTGCTGTGGCCTGGAGCAACAAATCTGACTTTGCATGTGCAAACGCCTTC
AACAACAGCATTATTCCAGAAGACACCTTCTTCCCCAGCCCAGAAAGTTCCTGTGATGTCAAG
CTGGTCGAGAAAAGCTTTGAAACAGATACGAACCTAAACTTTCAAAACCTGTCAGTGATTGGG
TTCCGAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCTCATGACGCTGCGGCTGTGGTCC
AGCGGAAGCGGAGCTACTAACTTTAGCCTGCTGAAGCAGGCTGGAGATGTGGAGGAGAACCCT
GGACCTATGAGCATCGGCCTCCTGTGCTGTGCAGCCTTGTCTCTCCTGTGGGCAGGTCCAGTG
AATGCTGGTGTCACTCAGACCCCAAAATTCCAGGTCCTGAAGACAGGACAGAGCATGACACTG
CAGTGTGCCCAGGATATGAACCATGAATACATGTCCTGGTATCGACAAGACCCAGGCATGGGG
CTGAGGCTGATTCATTACTCAGTTGGTGCTGGTATCACTGACCAAGGAGAAGTCCCCAATGGC
TACAATGTCTCCAGATCAACCACAGAGGATTTCCCGCTCAGGCTGCTGTCGGCTGCTCCCTCC
CAGACATCTGTGTACTTCTGTGCCAGCAGTTACGTCGGGAACACCGGGGAGCTGTTTTTTGGA
GAAGGCTCTAGGCTGACCGTACTGGAGGACCTGAAAAACGTGTTCCCACCCAAGGTCGCTGTGTTTGAGCCATCAGAAGCAGAGATCTCCCACACCCAAAAGGCCACACTGGTATGCCTGGCCACAGGCTTCTACCCCGACCACGTGGAGCTGAGCTGGTGGGTGAATGGGAAGGAGGTGCACAGTGGGGTCAGCACAGACCCGCAGCCCCTCAAGGAGCAGCCCGCCCTCAATGACTCCAGATACTGCCTGAGCAGCCGCCTGAGGGTCTCGGCCACCTTCTGGCAGAACCCCCGCAACCACTTCCGCTGTCAAGTCCAGTTCTACGGGCTCTCGGAGAATGACGAGTGGACCCAGGATAGGGCCAAACCCGTCACCCAGATCGTCAGCGCCGAGGCCTGGGGTAGAGCAGACTGTGGCTTCACCTCCGAGTCTTACCAGCAAGGGGTCCTGTCTGCCACCATCCTCTATGAGATCTTGCTAGGGAAGGCCACCTTGTATGCCGTGCTGGTCAGTGCCCTCGTGCTGATGGCCATGGTCAAGAGAAAGGATTCCAGAGGCAGTGGACAGTGCACCAACTACGCCCTGCTGAAGCTGGCCGGCGACGTGGAGAGCAACCCCGGCCCCATGGCCTTGCCCGTCACTGCGCTTTTGCTCCCGCTCGCTCTTCTCCTGCATGCAGCCCGACCATCTCAATTTAGAGTTTCTCCACTCGACAGGACGTGGAACCTCGGCGAAACCGTCGAACTTAAATGTCAAGTACTTCTCTCAAATCCGACTTCTGGTTGCTCATGGCTCTTTCAGCCGAGAGGAGCAGCTGCCAGCCCCACCTTCCTGCTGTATCTCTCCCAGAACAAGCCGAAGGCCGCCGAAGGGCTCGATACTCAACGATTTAGCGGGAAGCGACTCGGGGACACGTTCGTTCTTACTCTCAGCGATTTTAGAAGAGAGAACGAGGGATATTATTTTTGTTCCGCACTCTCTAACAGCATCATGTACTTCAGTCATTTTGTACCAGTCTTTCTCCCTGCAAAACCAACGACTACTCCAGCACCAAGACCGCCCACTCCCGCACCTACTATTGCAAGCCAACCTTTGAGTCTCCGACCAGAGGCATGCAGACCTGCTGCTGGAGGTGCAGTACATACGCGAGGGTTGGATTTTGCCTGCGATATCTATATCTGGGCCCCCTTGGCCGGCACGTGCGGGGTGCTCCTGCTGAGTCTCGTAATTACTCTTTATTGTAATCATAGAAACCGCAGAAGGGTGTGTAAGTGTCCCCGGCCTGTCGTGAAAAGCGGGGATAAGCCCAGTTTGTCTGCTCGGTACGTCGGAAGCGGTGAGGGCAGGGGAAGTCTTCTAACATGCGGGGACGTGGAGGAAAATCCCGGACCCATGAGGCCACGACTTTGGCTGCTGCTCGCTGCACAGTTGACTGTACTGCATGGCAATAGTGTGTTGCAGCAGACACCTGCATACATCAAGGTTCAGACAAATAAGATGGTTATGCTGAGTTGCGAGGCAAAAATTAGTTTGAGCAATATGCGGATCTACTGGTTGCGACAGAGACAGGCTCCCAGTAGTGATAGTCACCACGAATTCCTGGCTCTTTGGGATTCCGCAAAAGGAACGATTCATGGGGAAGAAGTAGAGCAGGAGAAGATTGCGGTTTTCCGCGATGCATCTCGCTTTATCCTTAATCTTACATCCGTTAAGCCTGAGGACAGTGGGATCTATTTTTGTATGATTGTAGGGTCCCCCGAATTGACATTTGGGAAGGGTACGCAGCTCTCCGTAGTTGACTTTCTGCCCACAACGGCACAACCCACTAAGAAGTCCACCCTGAAGAAGCGCGTCTGTCGCTTGCCCAGACCTGAAACCCAAAAGGGTCCACTCTGTTCCCCTATAACCCTGGGGTTGTTGGTGGCGGGCGTCTTGGTCCTGCTTGTTAGCTTGGGCGTAGCCATTCATCTGTGTTGCCGAAGACGCAGAGCCCGACTTAGATTTATGAAGCAATTCTATAAGTGA(SEQ ID NO:124)
METLLGLLILWLQLQWVSSKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPLYGGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSSGSGATNFSLLKQAGDVEENPGPMSIGLLCCAALSLLWAGPVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSYVGNTGELFFGEGSRLTVLEDLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRGSGQCTNYALLKLAGDVESNPGPMALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYVGSGEGRGSLLTCGDVEENPGPMRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK*(SEQ ID NO:125)
ATGAGGCCACGACTTTGGCTGCTGCTCGCTGCACAGTTGACTGTACTGCATGGCAATAGTGTG
TTGCAGCAGACACCTGCATACATCAAGGTTCAGACAAATAAGATGGTTATGCTGAGTTGCGAG
GCAAAAATTAGTTTGAGCAATATGCGGATCTACTGGTTGCGACAGAGACAGGCTCCCAGTAGT
GATAGTCACCACGAATTCCTGGCTCTTTGGGATTCCGCAAAAGGAACGATTCATGGGGAAGAA
GTAGAGCAGGAGAAGATTGCGGTTTTCCGCGATGCATCTCGCTTTATCCTTAATCTTACATCC
GTTAAGCCTGAGGACAGTGGGATCTATTTTTGTATGATTGTAGGGTCCCCCGAATTGACATTT
GGGAAGGGTACGCAGCTCTCCGTAGTTGACTTTCTGCCCACAACGGCACAACCCACTAAGAAG
TCCACCCTGAAGAAGCGCGTCTGTCGCTTGCCCAGACCTGAAACCCAAAAGGGTCCACTCTGT
TCCCCTATAACCCTGGGGTTGTTGGTGGCGGGCGTCTTGGTCCTGCTTGTTAGCTTGGGCGTA
GCCATTCATCTGTGTTGCCGAAGACGCAGAGCCCGACTTAGATTTATGAAGCAATTCTATAAGTGA(SEQ ID NO:126)
ATGGCCTTGCCCGTCACTGCGCTTTTGCTCCCGCTCGCTCTTCTCCTGCATGCAGCCCGACCA
TCTCAATTTAGAGTTTCTCCACTCGACAGGACGTGGAACCTCGGCGAAACCGTCGAACTTAAA
TGTCAAGTACTTCTCTCAAATCCGACTTCTGGTTGCTCATGGCTCTTTCAGCCGAGAGGAGCA
GCTGCCAGCCCCACCTTCCTGCTGTATCTCTCCCAGAACAAGCCGAAGGCCGCCGAAGGGCTC
GATACTCAACGATTTAGCGGGAAGCGACTCGGGGACACGTTCGTTCTTACTCTCAGCGATTTT
AGAAGAGAGAACGAGGGATATTATTTTTGTTCCGCACTCTCTAACAGCATCATGTACTTCAGT
CATTTTGTACCAGTCTTTCTCCCTGCAAAACCAACGACTACTCCAGCACCAAGACCGCCCACT
CCCGCACCTACTATTGCAAGCCAACCTTTGAGTCTCCGACCAGAGGCATGCAGACCTGCTGCT
GGAGGTGCAGTACATACGCGAGGGTTGGATTTTGCCTGCGATATCTATATCTGGGCCCCCTTG
GCCGGCACGTGCGGGGTGCTCCTGCTGAGTCTCGTAATTACTCTTTATTGTAATCATAGAAAC
CGCAGAAGGGTGTGTAAGTGTCCCCGGCCTGTCGTGAAAAGCGGGGATAAGCCCAGTTTGTCTGCTCGGTACGTC(SEQ ID NO:127)
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSS
DSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTF
GKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK(SEQ ID NO:128)
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGA
AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFS
HFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV(SEQ ID NO:129)
In some embodiments, the TCR construct comprises a PRAME-specific TCR chain. In some embodiments, the TCR construct comprising a PRAME-specific TCR chain comprises TCR a and TCR β chains found in PRAME-specific TCR clone 46, clone 54, and/or clone DSK 3. In some embodiments, a TCR construct comprising a PRAME-specific TCR chain comprises TCR alpha and TCR beta chains that target PRAME epitope SLLQHLIGL (SEQ ID NO: 131) and/or QLLALLPSL (SEQ ID NO: 132).
In some embodiments, a TCR construct comprising a PRAME-specific TCR chain comprises a nucleotide coding sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO:133 (e.g., TCR clone 46 tcra) and/or SEQ ID NO:134 (e.g., TCR clone 46 tcra). In some embodiments, a TCR construct comprising a PRAME-specific TCR chain comprises an amino acid sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO:135 (e.g., TCR clone 46 tcra) and/or SEQ ID NO:136 (e.g., TCR clone 46 tcra).
ATGCTTCTGGAACACCTGCTGATTATCCTGTGGATGCAACTCACGTGGGTCTCCGGGCAACAACTGAATCAAAGCCCCCAATCCATGTTTATACAGGAGGGAGAGGACGTAAGTATGAATTGCACATCTTCATCTATCTTTAACACCTGGCTGTGGTACAAACAAGACCCCGGAGAAGGTCCTGTACTTCTCATCGCACTTTACAAAGCAGGTGAGCTTACCAGTAACGGGAGACTCACCGCACAGTTCGGTATTACAAGAAAGGATTCCTTTCTCAACATCTCCGCTTCTATCCCTTCAGACGTCGGAATTTATTTTTGTGCTGGTATCCCTCGAGACAATTACGGTCAAAACTTTGTATTTGGGCCTGGGACTCGGCTGTCAGTTTTGCCGTATATCCAGAACCCCGACCCCGCCGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGTCCCAGAGCAAGGACAGCGACGTGTACATCACCGATAAGTGCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAACAGCGCCGTGGCCTGGTCCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATCATCCCCGAGGACACATTCTTCCCAAGCCCCGAGAGCAGCTGCGACGTGAAGCTGGTGGAGAAGTCCTTCGAGACAGACACCAACCTGAACTTCCAGAACCTGTCCGTGATCGGCTTCAGAATCCTGCTGCTGAAAGTGGCCGGCTTCAACCTGCTGATGACCCTGCGGCTGTGGTCCAGC(SEQ ID NO:133)
ATGGGCATTAGGCTGCTGTGCAGAGTAGCATTTTGCTTTCTGGCAGTAGGATTGGTCGATGTAAAGGTTACACAGTCCTCACGGTACTTGGTAAAGCGCACTGGTGAAAAGGTCTTTCTGGAATGTGTACAAGATATGGATCACGAAAATATGTTTTGGTACAGGCAAGATCCCGGCCTTGGACTTAGACTGATATATTTCTCCTACGATGTTAAAATGAAGGAGAAGGGCGATATTCCAGAAGGATATTCCGTGAGCCGCGAAAAGAAGGAGCGATTCAGTTTGATACTCGAAAGTGCCTCCACAAACCAAACCTCTATGTACCTTTGCGCGTCAACGCCGTGGCTGGCCGGTGGCAATGAACAATTCTTCGGGCCGGGTACGCGCCTCACTGTCCTGGAGGACCTCAAGAATGTGTTTCCGCCCGAAGTCGCGGTTTTTGAACCATCAGAAGCCGAGATCTCTCATACACAAAAGGCGACGCTCGTATGCCTTGCGACGGGATTTTATCCGGACCACGTCGAGCTTTCCTGGTGGGTTAATGGAAAGGAGGTGCATTCCGGAGTTTGCACGGACCCTCAGCCATTGAAGGAACAGCCCGCACTGAACGACAGTAGGTATTGCCTTTCATCTCGCCTGCGCGTGTCTGCGACATTCTGGCAAAACCCAAGAAATCACTTCAGATGTCAAGTTCAGTTCTACGGTCTCAGCGAGAATGATGAGTGGACACAAGATAGGGCTAAACCCGTGACTCAAATAGTCTCTGCCGAGGCCTGGGGGAGGGCGGATTGCGGCTTCACATCAGAATCATACCAACAAGGAGTATTGAGCGCGACAATTCTTTACGAAATTCTGCTTGGGAAAGCGACTCTGTACGCGGTGCTCGTGTCCGCTTTGGTTCTTATGGCAATGGTTAAACGAAAGGATAGTAGGGGC(SEQ ID NO:134)
MLLEHLLIILWMQLTWVSGQQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQDPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGIPRDNYGQNFVFGPGTRLSVLPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:135)
MGIRLLCRVAFCFLAVGLVDVKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASTPWLAGGNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG(SEQ ID NO:136)
In some embodiments, a TCR construct comprising a PRAME-specific TCR chain comprises a nucleotide coding sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO:137 (e.g., TCR clone 54 tcra) and/or SEQ ID NO:138 (e.g., TCR clone 54 tcra). In some embodiments, a TCR construct comprising a PRAME-specific TCR chain comprises an amino acid sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO:139 (e.g., TCR clone 54 tcra) and/or SEQ ID NO:140 (e.g., TCR clone 54 tcra).
ATGCTGCTGCTGCTGGTGCCCGTGCTGGAAGTGATCTTCACCCTGGGCGGCACCAGAGCCCAGAGCGTGACACAGCTGGGCAGCCACGTGTCCGTGTCTGAGAGGGCCCTGGTGCTGCTGAGATGCAACTACTCTTCTAGCGTGCCCCCCTACCTGTTTTGGTACGTGCAGTACCCCAACCAGGGGCTGCAGCTGCTCCTGAAGTACACCAGCGCCGCCACACTGGTGAAGGGCATCAACGGCTTCGAGGCCGAGTTCAAGAAGTCCGAGACAAGCTTCCACCTGACCAAGCCCAGCGCCCACATGTCTGACGCCGCCGAGTACTTCTGTGCCGTGAGCGGCCAGACCGGCGCCAACAACCTGTTCTTCGGCACCGGCACCCGGCTGACAGTGATCCCTTACATCCAGAACCCCGACCCCGCCGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGTCCCAGAGCAAGGACAGCGACGTGTACATCACCGATAAGTGCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAACAGCGCCGTGGCCTGGTCCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATCATCCCCGAGGACACATTCTTCCCAAGCCCCGAGAGCAGCTGCGACGTGAAGCTGGTGGAGAAGTCCTTCGAGACAGACACCAACCTGAACTTCCAGAACCTGTCCGTGATCGGCTTCAGAATCCTGCTGCTGAAAGTGGCCGGCTTCAACCTGCTGATGACCCTGCGGCTGTGGTCCAGC(SEQ ID NO:137)ATGGGCTTCCGGCTGCTGTGCTGCGTGGCCTTTTGTCTGCTGGGAGCCGGACCTGTGGATAGCGGCGTGACCCAGACCCCCAAGCACCTGATCACCGCCACCGGCCAGAGAGTGACCCTGCGCTGCAGCCCTAGAAGCGGCGACCTGAGCGTGTACTGGTATCAGCAGAGCCTCGACCAGGGCCTGCAGTTCCTGATCCAGTACTACAACGGCGAGGAACGGGCCAAGGGCAACATCCTGGAACGGTTCAGCGCCCAGCAGTTCCCCGATCTGCACAGCGAGCTGAACCTGAGCAGCCTGGAACTGGGCGACAGCGCCCTGTACTTCTGCGCCAGCGCCAGATGGGATAGAGGCGGCGAGCAGTACTTCGGCCCTGGCACCAGACTGACCGTGACCGAGGACCTCAAGAATGTGTTTCCGCCCGAAGTCGCGGTTTTTGAACCATCAGAAGCCGAGATCTCTCATACACAAAAGGCGACGCTCGTATGCCTTGCGACGGGATTTTATCCGGACCACGTCGAGCTTTCCTGGTGGGTTAATGGAAAGGAGGTGCATTCCGGAGTTTGCACGGACCCTCAGCCATTGAAGGAACAGCCCGCACTGAACGACAGTAGGTATTGCCTTTCATCTCGCCTGCGCGTGTCTGCGACATTCTGGCAAAACCCAAGAAATCACTTCAGATGTCAAGTTCAGTTCTACGGTCTCAGCGAGAATGATGAGTGGACACAAGATAGGGCTAAACCCGTGACTCAAATAGTCTCTGCCGAGGCCTGGGGGAGGGCGGATTGCGGCTTCACATCAGAATCATACCAACAAGGAGTATTGAGCGCGACAATTCTTTACGAAATTCTGCTTGGGAAAGCGACTCTGTACGCGGTGCTCGTGTCCGCTTTGGTTCTTATGGCAATGGTTAAACGAAAGGATAGTAGGGGC(SEQ ID NO:138)
MLLLLVPVLEVIFTLGGTRAQSVTQLGSHVSVSERALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSGQTGANNLFFGTGTRLTVIPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:139)
MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASARWDRGGEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG(SEQ ID NO:140)
In some embodiments, a TCR construct comprising a PRAME-specific TCR chain comprises a nucleotide coding sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO:141 (e.g., TCR clone DSK3 tcra) and/or SEQ ID NO:142 (e.g., TCR clone DSK3 tcra). In some embodiments, a TCR construct comprising a PRAME-specific TCR chain comprises an amino acid sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO:143 (e.g., TCR clone DSK3 tcra) and/or SEQ ID NO:144 (e.g., TCR clone DSK3 tcra).
ATGAAGAGCCTGAGGGTACTGCTGGTGATATTGTGGCTTCAGCTTAGTTGGGTCTGGTCACAACAAAAGGAAGTTGAGCAAAACTCAGGACCACTGAGTGTACCCGAGGGCGCTATAGCATCACTGAACTGTACCTACTCAGATCGGGGAAGCCAATCCTTTTTCTGGTACAGACAGTATTCCGGGAAGAGTCCTGAGTTGATCATGTTTATATACTCCAATGGCGATAAGGAGGATGGACGCTTCACCGCTCAGCTTAATAAAGCGTCACAGTATGTATCCCTCCTGATTCGGGACTCACAACCATCTGACTCTGCAACATACCTTTGTGCCGTAAAGGACAACGCCGGGAACATGCTCACTTTTGGAGGAGGTACCCGGCTTATGGTAAAACCACATATCCAGAACCCCGACCCCGCCGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGTCCCAGAGCAAGGACAGCGACGTGTACATCACCGATAAGTGCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAACAGCGCCGTGGCCTGGTCCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATCATCCCCGAGGACACATTCTTCCCAAGCCCCGAGAGCAGCTGCGACGTGAAGCTGGTGGAGAAGTCCTTCGAGACAGACACCAACCTGAACTTCCAGAACCTGTCCGTGATCGGCTTCAGAATCCTGCTGCTGAAAGTGGCCGGCTTCAACCTGCTGATGACCCTGCGGCTGTGGTCCAGC(SEQ ID NO:141)
MKSLRVLLVILWLQLSWVWSQQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVKDNAGNMLTFGGGTRLMVKPHIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:142)
ATGGGATTCCGGCTTCTTTGTTGTGTGGCATTTTGTCTGTTGGGTGCGGGTCCAGTCGATAGTGGTGTAACTCAGACACCAAAACACCTTATCACGGCAACTGGGCAACGAGTGACGCTCCGCTGTAGCCCGAGGTCCGGTGATTTGAGTGTGTACTGGTACCAGCAATCTTTGGACCAGGGCTTGCAGTTCCTCATACAGTATTACAATGGTGAAGAAAGAGCGAAGGGTAATATCCTGGAAAGATTCTCCGCACAACAGTTTCCTGATCTCCACAGCGAACTGAACCTGAGTTCTCTCGAGCTCGGGGATAGTGCTTTGTACTTCTGCGCGTCATCCGACGGTGGCGGAGTCTATGAACAATATTTCGGCCCAGGGACTAGGCTTACGGTGACGGAGGACCTCAAGAATGTGTTTCCGCCCGAAGTCGCGGTTTTTGAACCATCAGAAGCCGAGATCTCTCATACACAAAAGGCGACGCTCGTATGCCTTGCGACGGGATTTTATCCGGACCACGTCGAGCTTTCCTGGTGGGTTAATGGAAAGGAGGTGCATTCCGGAGTTTGCACGGACCCTCAGCCATTGAAGGAACAGCCCGCACTGAACGACAGTAGGTATTGCCTTTCATCTCGCCTGCGCGTGTCTGCGACATTCTGGCAAAACCCAAGAAATCACTTCAGATGTCAAGTTCAGTTCTACGGTCTCAGCGAGAATGATGAGTGGACACAAGATAGGGCTAAACCCGTGACTCAAATAGTCTCTGCCGAGGCCTGGGGGAGGGCGGATTGCGGCTTCACATCAGAATCATACCAACAAGGAGTATTGAGCGCGACAATTCTTTACGAAATTCTGCTTGGGAAAGCGACTCTGTACGCGGTGCTCGTGTCCGCTTTGGTTCTTATGGCAATGGTTAAACGAAAGGATAGTAGGGGC(SEQ ID NO:143)
MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSDGGGVYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG(SEQ ID NO:144)
In some embodiments, a TCR construct comprising a PRAME-specific TCR chain comprises a nucleotide coding sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to one or more of SEQ ID NOS 145-152. In some embodiments, a TCR construct comprising a PRAME-specific TCR chain comprises TCR a and TCR β chains found in PRAME-specific TCR clones T116-49 and/or T402-93 and/or modified versions thereof. In some embodiments, a TCR construct comprising a PRAME-specific TCR chain comprises TCR alpha and TCR beta chains that target PRAME epitope LYVDSLFFL (SEQ ID NO: 167). In some embodiments, PRAME-specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in international patent application publication WO 2022/063966 A1, which is incorporated herein by reference for the purposes described herein. In some embodiments, a TCR construct comprising a PRAME-specific TCR chain comprises an amino acid sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to one or more of SEQ ID NOS 153-166.
ATGGAGACACTGCTGAAGGTGCTGTCTGGCACACTGCTGTGGCAGCTGACCTGGGTCCGATCT
CAGCAGCCTGTTCAGTCTCCTCAGGCCGTGATCCTGAGAGAAGGCGAGGACGCCGTGATCAAC
TGCAGCAGCTCTAAGGCCCTGTACAGCGTGCACTGGTACAGACAGAAGCACGGCGAGGCCCCT
GTGTTCCTGATGATCCTGCTGAAAGGCGGCGAGCAGAAGGGCCACGAGAAGATCAGCGCCAGC
TTCAACGAGAAGAAGCAGCAGTCCAGCCTGTACCTGACAGCCAGCCAGCTGAGCTACAGCGGC
ACCTACTTTTGCGGCACAGCCAATAGCGGCGGCAGCAACTACAAGCTGACCTTCGGCAAGGGCACCCTGCTGACCGTGAATCCCAAT(SEQ ID NO:145)
ATGCTGCTGATCACCTCCATGCTGGTGCTGTGGATGCAGCTGAGCCAAGTGAACGGCCAGCAA
GTGATGCAGATCCCTCAGTACCAGCACGTGCAAGAAGGCGAGGACTTCACCACCTACTGCAAC
AGCAGCACCACACTGAGCAACATCCAGTGGTACAAGCAGCGGCCTGGCGGACACCCTGTGTTT
CTGATCCAGCTGGTCAAGTCCGGCGAAGTGAAGAAGCAGAAGCGGCTGACCTTCCAGTTCGGC
GAGGCCAAGAAGAACAGCAGCCTGCACATCACCGCCACACAGACCACCGATGTGGGCACCTAC
TTTTGTGCTGGCGCCCTGCCTAGAGCCGGCAGCTATCAACTGACATTCGGCAAGGGCACCAAGCTGAGCGTGATCCCCAAC(SEQ ID NO:146)
ATGGAGACACTGCTGAAGGTGCTGTCTGGCACACTGCTGTGGCAGCTGACCTGGGTCCGATCT
CAGCAGCCTGTTCAGTCTCCTCAGGCCGTGATCCTGAGAGAAGGCGAGGACGCCGTGATCAAC
TGCAGCAGCTCTAAGGCCCTGTACAGCGTGCACTGGTACAGACAGAAGCACGGCGAGGCCCCT
GTGTTCCTGATGATCCTGCTGAAAGGCGGCGAGCAGAAGGGCCACGAGAAGATCAGCGCCAGC
TTCAACGAGAAGAAGCAGCAGTCCAGCCTGTACCTGACAGCCAGCCAGCTGAGCTACAGCGGC
ACCTACTTTTGCGGCACAGCCAATAGCGGCGGCAGCAACTACAAGCTGACCTTCGGCAAGGGC
ACCCTGCTGACCGTGAATCCCAATATCCAGAATCCGGAGCCCGCCGTATACCAGCTGAAGGAC
CCTAGAAGCCAGGACAGCACCCTGTGCCTGTTCACCGACTTCGACAGCCAGATCAACGTGCCC
AAGACCATGGAAAGCGGCACCTTCATCACCGACAAGACAGTGCTGGACATGAAGGCCATGGAC
AGCAAGTCCAACGGCGCAATCGCCTGGTCCAACCAGACCAGCTTCACATGCCAGGACATCTTC
AAAGAGACAAACGCCACATACCCCAGCAGCGACGTGCCCTGTGATGCCACCCTGACAGAGAAG
TCCTTCGAGACAGACATGAACCTGAACTTCCAGAATCTGTCCGTGATGGGCCTGAGAATCCTGCTGCTGAAGGTGGCCGGCTTCAATCTGCTGATGACCCTGCGGCTGTGGTCCAGC(SEQ ID NO:147)
ATGCTGCTGATCACCTCCATGCTGGTGCTGTGGATGCAGCTGAGCCAAGTGAACGGCCAGCAAGTGATGCAGATCCCTCAGTACCAGCACGTGCAAGAAGGCGAGGACTTCACCACCTACTGCAACAGCAGCACCACACTGAGCAACATCCAGTGGTACAAGCAGCGGCCTGGCGGACACCCTGTGTTTCTGATCCAGCTGGTCAAGTCCGGCGAAGTGAAGAAGCAGAAGCGGCTGACCTTCCAGTTCGGCGAGGCCAAGAAGAACAGCAGCCTGCACATCACCGCCACACAGACCACCGATGTGGGCACCTACTTTTGTGCTGGCGCCCTGCCTAGAGCCGGCAGCTATCAACTGACATTCGGCAAGGGCACCAAGCTGAGCGTGATCCCCAACATCCAGAATCCGGAGCCCGCCGTATACCAGCTGAAGGACCCTAGAAGCCAGGACAGCACCCTGTGCCTGTTCACCGACTTCGACAGCCAGATCAACGTGCCCAAGACCATGGAAAGCGGCACCTTCATCACCGACAAGACAGTGCTGGACATGAAGGCCATGGACAGCAAGTCCAACGGCGCAATCGCCTGGTCCAACCAGACCAGCTTCACATGCCAGGACATCTTCAAAGAGACAAACGCCACATACCCCAGCAGCGACGTGCCCTGTGATGCCACCCTGACAGAGAAGTCCTTCGAGACAGACATGAACCTGAACTTCCAGAATCTGTCCGTGATGGGCCTGAGAATCCTGCTGCTGAAGGTGGCCGGCTTCAATCTGCTGATGACCCTGCGGCTGTGGTCCAGC(SEQ ID NO:148)
ATGGGCACCAGACTGTTCTTCTACGTGGCCCTGTGTCTGCTGTGGACAGGCCATGTGGATGCCGGAATCACACAGAGCCCCAGACACAAAGTGACCGAGACAGGCACCCCTGTGACACTGAGATGTCACCAGACCGAGAACCATCGGTACATGTATTGGTACAGACAGGACCCCGGCCACGGCCTGAGACTGATCCACTATAGCTACGGCGTGAAGGACACCGACAAGGGCGAAGTGTCTGACGGCTACAGCGTGTCCAGAAGCAAGACCGAGGACTTCCTGCTGACCCTGGAAAGCGCCACAAGCAGCCAGACCAGCGTGTACTTCTGCGCCATCAGCGACTACGAGGGCACCGAGGCCTTTTTTGGCCAAGGCACAAGACTGACCGTGGTG(SEQ ID NO:149)
ATGCTGTGTTCTCTGCTGGCTCTGCTGCTGGGCACCTTTTTTGGCGTCAGAAGCCAGACCATCCACCAGTGGCCTGCTACACTGGTGCAGCCTGTTGGAAGCCCTCTGAGCCTGGAATGTACCGTGGAAGGCACCAGCAATCCCAACCTGTACTGGTACAGACAGGCCGCTGGAAGAGGACTGCAGCTGCTGTTTTACAGCGTCGGCATCGGCCAGATCAGCAGCGAGGTTCCACAGAATCTGAGCGCCAGCAGACCCCAGGACAGACAGTTTATCCTGAGCAGCAAGAAGCTGCTGCTGAGCGACAGCGGCTTCTACCTGTGTGCTTGGAGCCTCGGAGCCGGCTACACCGACACACAGTATTTTGGCCCTGGCACCAGACTGACCGTGCTG(SEQ ID NO:150)
ATGGGCACCAGACTGTTCTTCTACGTGGCCCTGTGTCTGCTGTGGACAGGCCATGTGGATGCCGGAATCACACAGAGCCCCAGACACAAAGTGACCGAGACAGGCACCCCTGTGACACTGAGATGTCACCAGACCGAGAACCATCGGTACATGTATTGGTACAGACAGGACCCCGGCCACGGCCTGAGACTGATCCACTATAGCTACGGCGTGAAGGACACCGACAAGGGCGAAGTGTCTGACGGCTACAGCGTGTCCAGAAGCAAGACCGAGGACTTCCTGCTGACCCTGGAAAGCGCCACAAGCAGCCAGACCAGCGTGTACTTCTGCGCCATCAGCGACTACGAGGGCACCGAGGCCTTTTTTGGCCAAGGCACAAGACTGACCGTGGTGGAAGATCTCCGGAACGTGACCCCCCCTAAAGTGACCCTGTTCGAACCCAGCAAGGCCGAGATCGCCAACAAGCAGAAAGCCACCCTCGTGTGCCTGGCCAGAGGCTTCTTCCCCGACCATGTGGAACTGTCTTGGTGGGTCAACGGCAAAGAGGTGCACAGCGGAGTGTCCACCGACCCTCAGGCCTACAAAGAGAGCAACTACAGCTACTGCCTGAGCAGCAGACTGCGGGTGTCCGCCACCTTCTGGCACAACCCCCGGAACCACTTCAGATGCCAGGTGCAGTTTCACGGCCTGAGCGAAGAGGACAAGTGGCCCGAAGGCTCCCCCAAGCCCGTGACCCAGAATATCTCTGCCGAGGCCTGGGGCAGAGCCGACTGTGGAATTACCAGCGCCAGCTACCACCAGGGCGTGCTGTCTGCCACCATCCTGTACGAGATCCTGCTGGGCAAGGCCACCCTGTACGCCGTGCTGGTGTCTGGCCTGGTGCTGATGGCCATGGTCAAGAAGAAGAACAGC(SEQ ID NO:151)
ATGCTGTGTTCTCTGCTGGCTCTGCTGCTGGGCACCTTTTTTGGCGTCAGAAGCCAGACCATCCACCAGTGGCCTGCTACACTGGTGCAGCCTGTTGGAAGCCCTCTGAGCCTGGAATGTACCGTGGAAGGCACCAGCAATCCCAACCTGTACTGGTACAGACAGGCCGCTGGAAGAGGACTGCAGCTGCTGTTTTACAGCGTCGGCATCGGCCAGATCAGCAGCGAGGTTCCACAGAATCTGAGCGCCAGCAGACCCCAGGACAGACAGTTTATCCTGAGCAGCAAGAAGCTGCTGCTGAGCGACAGCGGCTTCTACCTGTGTGCTTGGAGCCTCGGAGCCGGCTACACCGACACACAGTATTTTGGCCCTGGCACCAGACTGACCGTGCTGGAAGATCTCCGGAACGTGACCCCCCCTAAAGTGACCCTGTTCGAACCCAGCAAGGCCGAGATCGCCAACAAGCAGAAAGCCACCCTCGTGTGCCTGGCCAGAGGCTTCTTCCCCGACCATGTGGAACTGTCTTGGTGGGTCAACGGCAAAGAGGTGCACAGCGGAGTGTCCACCGACCCTCAGGCCTACAAAGAGAGCAACTACAGCTACTGCCTGAGCAGCAGACTGCGGGTGTCCGCCACCTTCTGGCACAACCCCCGGAACCACTTCAGATGCCAGGTGCAGTTTCACGGCCTGAGCGAAGAGGACAAGTGGCCCGAAGGCTCCCCCAAGCCCGTGACCCAGAATATCTCTGCCGAGGCCTGGGGCAGAGCCGACTGTGGAATTACCAGCGCCAGCTACCACCAGGGCGTGCTGTCTGCCACCATCCTGTACGAGATCCTGCTGGGCAAGGCCACCCTGTACGCCGTGCTGGTGTCTGGCCTGGTGCTGATGGCCATGGTCAAGAAGAAGAACAGC(SEQ ID NO:152])
METLLKVLSGTLLWQLTWVRSQQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKGHEKISASFNEKKQQSSLYLTASQLSYSGTYFCGTANSGGSNYKLTFGKGTLLTVNPN(SEQ ID NO:153)
MLLITSMLVLWMQLSQVNGQQVMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCAGALPRAGSYQLTFGKGTKLSVIPN(SEQ ID NO:154)
IQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:155)
IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSI IPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:156)
IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSI IPEDTFFPSSDVPCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:157)
METLLKVLSGTLLWQLTWVRSQQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKGHEKISASFNEKKQQSSLYLTASQLSYSGTYFCGTANSGGSNYKLTFGKGTLLTVNPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:158)MLLITSMLVLWMQLSQVNGQQVMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCAGALPRAGSYQLTFGKGTKLSVIPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:159)
MGTRLFFYVALCLLWTGHVDAGITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISDYEGTEAFFGQGTRLTVV(SEQ ID NO:160)
MLCSLLALLLGTFFGVRSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSLGAGYTDTQYFGPGTRLTVL(SEQ ID NO:161)
EDLRNVTPPKVTLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGLVLMAMVKKKNS(SEQ ID NO:162)
DLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF(SEQ ID NO:163)
EDLNKVFPPEVAVFEPSKAEIAHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF(SEQ ID NO:164)
MGTRLFFYVALCLLWTGHVDAGITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISDYEGTEAFFGQGTRLTVVEDLRNVTPPKVTLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGLVLMAMVKKKNS(SEQ ID NO:165)
MLCSLLALLLGTFFGVRSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSLGAGYTDTQYFGPGTRLTVLEDLRNVTPPKVTLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGLVLMAMVKKKNS(SEQ ID NO:166)
In some embodiments, the TCR construct comprises a gp 100-specific TCR chain. In some embodiments, the TCR construct comprising a gp 100-specific TCR chain comprises TCR a and TCR β chains found in gp 100-specific TCR clone Sp (0.01) a and/or modified versions thereof. In some embodiments, a TCR construct comprising a gp 100-specific TCR chain comprises TCR alpha and TCR beta chains targeting the gp100 epitope KTWGQYWQV (SEQ ID NO: 168). In some embodiments, gp 100-specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in patent publication US 8,216,565 B2, which publication is incorporated herein by reference for the purposes described herein.
In some embodiments, a TCR construct comprising a gp 100-specific TCR chain comprises a nucleotide coding sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to one or more of SEQ ID NO:169 and/or SEQ ID NO: 170. In some embodiments, a TCR construct comprising a gp 100-specific TCR chain comprises an amino acid sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to one or more of SEQ ID NOS 171-174.
ATGAAATCCTTGAGTGTTTCCCTAGTGGTCCTGTGGCTCCAGTTAAACTGGGTGAACAGCCAG
CAGAAGGTGCAGCAGAGCCCAGAATCCCTCATTGTCCCAGAGGGAGCCATGACCTCTCTCAAC
TGCACTTTCAGCGACAGTGCTTCTCAGTATTTTGCATGGTACAGACAGCATTCTGGGAAAGCC
CCCAAGGCACTGATGTCCATCTTCTCCAATGGTGAAAAAGAAGAAGGCAGATTCACAATTCAC
CTCAATAAAGCCAGTCTGCATTTCTCGCTACACATCAGAGACTCCCAGCCCAGTGACTCTGCT
CTCTACCTCTGTGCAGCCAATAACTATGCCCAGGGATTAACCTTCGGTCTTGGCACCAGAGTA
TCTGTGTTTCCCTACATCCAGAACCCAGAACCTGCTGTGTACCAGTTAAAAGATCCTCGGTCT
CAGGACAGCACCCTCTGCCTGTTCACCGACTTTGACTCCCAAATCAATGTGCCGAAAACCATG
GAATCTGGAACGTTCATCACTGACAAAACTGTGCTGGACATGAAAGCTATGGATTCCAAGAGC
AATGGGGCCATTGCCTGGAGCAACCAGACAAGCTTCACCTGCCAAGATATCTTCAAAGAGACC
AACGCCACCTACCCCAGTTCAGACGTTCCCTGTGATGCCACGTTGACTGAGAAAAGCTTTGAA
ACAGATATGAACCTAAACTTTCAAAACCTGTCAGTTATGGGACTCCGAATCCTCCTGCTGAAAGTAGCCGGATTTAACCTGCTCATGACGCTGAGGCTGTGGTCCAGTTGA(SEQ ID NO:169)ATGGGCTCCAGACTCTTCTTTGTGGTTTTGATTCTCCTGTGTGCAAAACACATGGAGGCTGCAGTCACCCAAAGTCCAAGAAGCAAGGTGGCAGTAACAGGAGGAAAGGTGACATTGAGCTGTCACCAGACTAATAACCATGACTATATGTACTGGTATCGGCAGGACACGGGGCATGGGCTGAGGCTGATCCATTACTCATATGTCGCTGACAGCACGGAGAAAGGAGATATCCCTGATGGGTACAAGGCCTCCAGACCAAGCCAAGAGAATTTCTCTCTCATTCTGGAGTTGGCTTCCCTTTCTCAGACAGCTGTATATTTCTGTGCCAGCAGCCCTGGGGGGGGGGGGGAACAGTACTTCGGTCCCGGCACCAGGCTCACGGTTTTAGAGGATCTGAGAAATGTGACTCCACCCAAGGTCTCCTTGTTTGAGCCATCAAAAGCAGAGATTGCAAACAAACGAAAGGCTACCCTCGTGTGCTTGGCCAGGGGCTTCTTCCCTGACCACGTGGAGCTGAGCTGGTGGGTGAATGGCAAGGAGGTCCACAGTGGGGTCAGCACGGACCCTCAGGCCTACAAGGAGAGCAATTATAGCTACTGCCTGAGCAGCCGCCTGAGGGTCTCTGCTACCTTCTGGCACAATCCTCGAAACCACTTCCGCTGCCAAGTGCAGTTCCATGGGCTTTCAGAGGAGGACAAGTGGCCAGAGGGCTCACCCAAACCTGTCACACAGAACATCAGTGCAGAGGCCTGGGGCCGAGCAGACTGTGGGATTACCTCAGCATCCTATCAACAAGGGGTCTTGTCTGCCACCATCCTCTATGAGATCCTGCTAGGGAAAGCCACCCTGTATGCTGTGCTTGTCAGTACACTGGTGGTGATGGCTATGGTCAAAAGAAAGAATTCATGA(SEQ ID NO:170)
MKSLSVSLVVLWLQLNWVNSQQKVQQSPESLIVPEGAMTSLNCTFSDSASQYFAWYRQHSGKAPKALMSIFSNGEKEEGRFTIHLNKASLHFSLHIRDSQPSDSALYLCAANNYAQGLTFGLGTRVSVFPYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:171)
MGSRLFFVVLILLCAKHMEAAVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDTGHGLRLIHYSYVADSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASSPGGGGEQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKRKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS(SEQ ID NO:172)
QQKVQQSPESLIVPEGAMTSLNCTFSDSASQYFAWYRQHSGKAPKALMSIFSNGEKEEGRFTIHLNKASLHFSLHIRDSQPSDSALYLCAANNYAQGLTFGLGTRVSVFPY(SEQ ID NO:173)
EAAVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDTGHGLRLIHYSYVADSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASSPGGGGEQYFGPGTRLTVL(SEQ ID NO:174)
In some embodiments, the TCR construct comprises a MART-1 specific TCR chain. In some embodiments, a TCR construct comprising a MART-1 specific TCR chain comprises TCR a and TCR β chains found in MART-1 specific TCR clone F4 and/or F5 and/or modified versions thereof. In some embodiments, a TCR construct comprising a MART-1 specific TCR chain comprises TCR alpha and TCR beta chains targeting MART-1 epitope AAGIGILTV (SEQ ID NO: 175). In some embodiments, MART-1 specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in patent publication US 9,128,080 B2, which publication is incorporated herein by reference for the purposes described herein.
In some embodiments, a TCR construct comprising a MART-1 specific TCR chain comprises a nucleotide coding sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to one or more of SEQ ID NOS: 176-179. In some embodiments, a TCR construct comprising a MART-1 specific TCR chain comprises an amino acid sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to one or more of SEQ ID NOS.
ATGTTGCTTGAACATTTATTAATAATCTTGTGGATGCAGCTGACATGGGTCAGTGGTCAACAG
CTGAATCAGAGTCCTCAATCTATGTTTATCCAGGAAGGAGAAGATGTCTCCATGAACTGCACT
TCTTCAAGCATATTTAACACCTGGCTATGGTACAAGCAGGACCCTGGGGAAGGTCCTGTCCTC
TTGATAGCCTTATATAAGGCTGGTGAATTGACCTCAAATGGAAGACTGACTGCTCAGTTTGGT
ATAACCAGAAAGGACAGCTTCCTGAATATCTCAGCATCCATACCTAGTGATGTAGGCATCTAC
TTCTGTGCTGGTGGGACCGGTAACCAGTTCTATTTTGGGACAGGGACAAGTTTGACGGTCATT
CCAAATATCCAGAACCCTGACCCTGCCGTGTACCAGCTGAGAGACTCTAAATCCAGTGACAAG
TCTGTCTGCCTATTCACCGATTTTGATTCTCAAACAAATGTGTCACAAAGTAAGGATTCTGAT
GTGTATATCACAGACAAAACTGTGCTAGACATGAGGTCTATGGACTTCAAGAGCAACAGTGCT
GTGGCCTGGAGCAACAAATCTGACTTTGCATGTGCAAACGCCTTCAACAACAGCATTATTCCA
GAAGACACCTTCTTCCCCAGCCCAGAAAGTTCCTGTGATGTCAAGCTGGTCGAGAAAAGCTTT
GAAACAGATACGAACCTAAACTTTCAAAACCTGTCAGTGATTGGGTTCCGAATCCTCCTCCTG
AAGGTGGCCGGGTTTAATCTGCTCATGACGCTGCGGCTGTGGTCCAGC(SEQ ID NO:176)
ATGGGCACAAGGTTGTTCTTCTATGTGGCCCTTTGTCTCCTGTGGACAGGACACATGGATGCT
GGAATCACCCAGAGCCCAAGACACAAGGTCACAGAGACAGGAACACCAGTGACTCTGAGATGT
CACCAGACTGAGAACCACCGCTATATGTACTGGTATCGACAAGACCCGGGGCATGGGCTGAGG
CTGATCCATTACTCATATGGTGTTAAAGATACTGACAAAGGAGAAGTCTCAGATGGCTATAGT
GTCTCTAGATCAAAGACAGAGGATTTCCTCCTCACTCTGGAGTCCGCTACCAGCTCCCAGACA
TCTGTGTACTTCTGTGCCATCAGTGAGGTAGGGGTTGGGCAGCCCCAGCATTTTGGTGATGGG
ACTCGACTCTCCATCCTAGAGGACCTGAACAAGGTGTTCCCACCCGAGGTCGCTGTGTTTGAG
CCATCAGAAGCAGAGATCTCCCACACCCAAAAGGCCACACTGGTGTGCCTGGCCACAGGCTTC
TTCCCCGACCACGTGGAGCTGAGCTGGTGGGTGAATGGGAAGGAGGTGCACAGTGGGGTCAGC
ACGGACCCGCAGCCCCTCAAGGAGCAGCCCGCCCTCAATGACTCCAGATACTGCCTGAGCAGC
CGCCTGAGGGTCTCGGCCACCTTCTGGCAGAACCCCCGCAACCACTTCCGCTGTCAAGTCCAG
TTCTACGGGCTCTCGGAGAATGACGAGTGGACCCAGGATAGGGCCAAACCCGTCACCCAGATC
GTCAGCGCCGAGGCCTGGGGTAGAGCATGTGGCTTTACCTCGTCCTACCAGCAAGGGGTCCTG
TCTGCCACCATCCTCTATGAGATCCTGCTAGGGAAGGCCACCCTGTATGCTGTGCTGGTCAGC
GCCCTTGTGTTGATGGCCATGGTCAAGAGAAAGGATTTC(SEQ ID NO:177)
ATGATGAAATCCTTGAGAGTTTTACTAGTGATCCTGTGGCTTCAGTTGAGCTGGGTTTGGAGC
CAACAGAAGGAGGTGGAGCAGAATTCTGGACCCCTCAGTGTTCCAGAGGGAGCCATTGCCTCT
CTCAACTGCACTTACAGTGACCGAGGTTCCCAGTCCTTCTTCTGGTACAGACAATATTCTGGG
AAAAGCCCTGAGTTGATAATGTTCATATACTCCAATGGTGACAAAGAAGATGGAAGGTTTACA
GCACAGCTCAATAAAGCCAGCCAGTATGTTTCTCTGCTCATCAGAGACTCCCAGCCCAGTGAT
TCAGCCACCTACCTCTGTGCCGTGAACTTCGGAGGAGGAAAGCTTATCTTCGGACAGGGAACG
GAGTTATCTGTGAAACCCAATATCCAGAACCCTGACCCTGCCGTGTACCAGCTGAGAGACTCT
AAATCCAGTGACAAGTCTGTCTGCCTATTCACCGATTTTGATTCTCAAACAAATGTGTCACAA
AGTAAGGATTCTGATGTGTATATCACAGACAAAACTGTGCTAGACATGAGGTCTATGGACTTC
AAGAGCAACAGTGCTGTGGCCTGGAGCAACAAATCTGACTTTGCATGTGCAAACGCCTTCAAC
AACAGCATTATTCCAGAAGACACCTTCTTCCCCAGCCCAGAAAGTTCCTGTGATGTCAAGCTG
GTCGAGAAAAGCTTTGAAACAGATACGAACCTAAACTTTCAAAACCTGTCAGTGATTGGGTTC
CGAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCTCATGACGCTGCGGCTGTGGTCCAGC
TGA(SEQ ID NO:178)
ATGAGAATCAGGCTCCTGTGCTGTGTGGCCTTTTCTCTCCTGTGGGCAGGTCCAGTGATTGCT
GGGATCACCCAGGCACCAACATCTCAGATCCTGGCAGCAGGACGGCGCATGACACTGAGATGT
ACCCAGGATATGAGACATAATGCCATGTACTGGTATAGACAAGATCTAGGACTGGGGCTAAGG
CTCATCCATTATTCAAATACTGCAGGTACCACTGGCAAAGGAGAAGTCCCTGATGGTTATAGT
GTCTCCAGAGCAAACACAGATGATTTCCCCCTCACGTTGGCGTCTGCTGTACCCTCTCAGACA
TCTGTGTACTTCTGTGCCAGCAGCCTAAGTTTCGGCACTGAAGCTTTCTTTGGACAAGGCACC
AGACTCACAGTTGTAGAGGACCTGAACAAGGTGTTCCCACCCGAGGTCGCTGTGTTTGAGCCA
TCAGAAGCAGAGATCTCCCACACCCAAAAGGCCACACTGGTGTGCCTGGCCACAGGCTTCTTC
CCCGACCACGTGGAGCTGAGCTGGTGGGTGAATGGGAAGGAGGTGCACAGTGGGGTCAGCACG
GACCCGCAGCCCCTCAAGGAGCAGCCCGCCCTCAATGACTCCAGATACTGCCTGAGCAGCCGC
CTGAGGGTCTCGGCCACCTTCTGGCAGAACCCCCGCAACCACTTCCGCTGTCAAGTCCAGTTC
TACGGGCTCTCGGAGAATGACGAGTGGACCCAGGATAGGGCCAAACCCGTCACCCAGATCGTC
AGCGCCGAGGCCTGGGGTAGAGCATGTGGCTTTACCTCGTCCTACCAGCAAGGGGTCCTGTCT
GCCACCATCCTCTATGAGATCCTGCTAGGGAAGGCCACCCTGTATGCTGTGCTGGTCAGCGCCCTTGTGTTGATGGCCATGGTCAAGAGAAAGGATTTC(SEQ ID NO:179)
GQQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQDPGEGPVLLIALYKAGELTSNGRLTA
QFGITRKDSFLNISASIPSDVGIYFCAGGTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKS
SDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNS
IIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:180)
DAGITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDG
YSVSRSKTEDFLLTLESATSSQTSVYFCAISEVGVGQPQHFGDGTRLSILEDLNKVFPPEVAV
FEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCL
SSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRACGFTSSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF(SEQ ID NO:181)
QKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTA
QLNKASQYVSLLIRDSQPSDSATYLCAVNFGGGKLIFGQGTELSVKPNIQNPDPAVYQLRDSK
SSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNN
SIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:182)
IAGITQAPTSQILAAGRRMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDG
YSVSRANTDDFPLTLASAVPSQTSVYFCASSLSFGTEAFFGQGTRLTVVEDLNKVFPPEVAVF
EPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLS
SRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRACGFTSSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF(SEQ ID NO:183)
In some embodiments, the TCR construct comprises a tyrosinase-specific TCR chain. In some embodiments, the TCR construct comprising a tyrosinase-specific TCR chain comprises TCR a and TCR β chains found in tyrosinase-specific TCR clone TIL 1383I and/or modified versions thereof. In some embodiments, a TCR construct comprising a tyrosinase-specific TCR chain comprises TCR a and TCR β chains that target a tyrosinase epitope represented by amino acids 368-376 of tyrosinase (reactive towards MHC class I (HLA-A 2) restriction epitopes (368-376) of tyrosinase). In some embodiments, tyrosinase-specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in publication Roszkowski et al, cancer Res.65 (4): 1570-6 (2005), which is incorporated herein by reference for the purposes described herein.
In some embodiments, the TCR construct comprises a MAGE-A3 specific TCR chain. In some embodiments, a TCR construct comprising a MAGE-A3 specific TCR chain comprises TCR alpha and TCR beta chains targeting amino acids 271-279 of MAGE-A3, such as epitope FLWGPRALV (SEQ ID NO: 184). In some embodiments, a TCR construct comprising a MAGE-A3 specific TCR chain comprises TCR alpha and TCR beta chains targeting amino acids 112-120 of MAGE-A3, such as epitope KVAELVHFL (SEQ ID NO: 185). In some embodiments, MAGE-A3 specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in international patent application publication WO 2012/054825 A1, which is incorporated herein by reference for the purposes described herein. In certain embodiments, the anti-MAGE-A3112-120 TCR comprises an A118T substitution relative to wild type (wherein threonine is at position 118 in the alpha chain). In certain embodiments, the anti-MAGE-A3 112-120TCR comprises an A118V substitution relative to wild type (wherein valine is at position 118 in the alpha chain).
In some embodiments, a TCR construct comprising a MAGE-A3 specific TCR chain comprises a nucleotide coding sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to one or more of SEQ ID NOS: 186-193. In some embodiments, a TCR construct comprising a MAGE-A3 specific TCR chain comprises an amino acid sequence at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to one or more of SEQ ID NOS 194-201.
ATGGGTCCTGTCACCTGCTCAGTTCTTGTGCTCCTCCTAATGCTCAGGAGGAGCAATGGCGAT
GGAGACTCCGTGACCCAGACAGAAGGCCTGGTCACTCTCACAGAAGGGTTGCCTGTGATGCTG
AACTGCACCTATCAGACTATTTACTCAAATCCTTTCCTTTTCTGGTATGTGCAACATCTCAAT
GAATCCCCTCGGCTACTCCTGAAGAGCTTCACAGACAACAAGAGGACCGAGCACCAAGGGTTC
CACGCCACTCTCCATAAGAGCAGCAGCTCCTTCCATCTGCAGAAGTCCTCAGCGCAGCTGTCAGACTCTGCCCTGTACTACTGTGCTTTCGACACAAATGCTTACAAAGTCATCTTT(SEQ ID NO:186)
ATGAGAGTTAGGCTCATCTCTGCTGTGGTGCTGTGTTCCCTAGGAACAGGCCTTGTGGACATG
AAAGTAACCCAGATGCCAAGATACCTGATCAAAAGAATGGGAGAGAATGTTTTGCTGGAATGTGGACAGGACATGAGCCATGAAACAATGTACTGGTATCGACAAGACCCTGGTCTGGGGCTACAGCTGATTTATATCTCATACGATGTTGATAGTAACAGCGAAGGAGACATCCCTAAAGGATACAGGGTCTCACGGAAGAAGCGGGAGCATTTCTCCCTGATTCTGGATTCTGCTAAAACAAACCAGACATCTGTGTACTTCTGTGCTAGCAGTTCAACAAACACAGAAGTCTTCTTT(SEQ ID NO:187)
ATGGGTCCTGTCACCTGCTCAGTTCTTGTGCTCCTCCTAATGCTCAGGAGGAGCAATGGCGATGGAGACTCCGTGACCCAGACAGAAGGCCTGGTCACTCTCACAGAAGGGTTGCCTGTGATGCTGAACTGCACCTATCAGACTATTTACTCAAATCCTTTCCTTTTCTGGTATGTGCAACATCTCAATGAATCCCCTCGGCTACTCCTGAAGAGCTTCACAGACAACAAGAGGACCGAGCACCAAGGGTTCCACGCCACTCTCCATAAGAGCAGCAGCTCCTTCCATCTGCAGAAGTCCTCAGCGCAGCTGTCAGACTCTGCCCTGTACTACTGTGCTTTCGACACAAATGCTTACAAAGTCATCTTTGGAAAAGGGACACATCTTCATGTTCTCCCTAACATCCAGAACCCAGAACCTGCTGTGTACCAGTTAAAAGATCCTCGGTCTCAGGACAGCACCCTCTGCCTGTTCACCGACTTTGACTCCCAAATCAATGTGCCGAAAACCATGGAATCTGGAACGTTCATCACTGACAAAACTGTGCTGGACATGAAAGCTATGGATTCCAAGAGCAATGGGGCCATTGCCTGGAGCAACCAGACAAGCTTCACCTGCCAAGATATCTTCAAAGAGACCAACACCACCTACCCCAGTTCAGACGTTCCCTGTGATGCCACGTTGACTGAGAAAAGCTTTGAAACAGATATGAACCTAAACTTTCAAAACCTGTCAGTTATGGGACTCCGAATCCTCCTGCTGAAAGTAGCCGGATTTAACCTGCTCATGACGCTGAGGCTGTGGTCCAGTTGA(SEQ ID NO:188)
ATGAGAGTTAGGCTCATCTCTGCTGTGGTGCTGTGTTCCCTAGGAACAGGCCTTGTGGACATGAAAGTAACCCAGATGCCAAGATACCTGATCAAAAGAATGGGAGAGAATGTTTTGCTGGAATGTGGACAGGACATGAGCCATGAAACAATGTACTGGTATCGACAAGACCCTGGTCTGGGGCTACAGCTGATTTATATCTCATACGATGTTGATAGTAACAGCGAAGGAGACATCCCTAAAGGATACAGGGTCTCACGGAAGAAGCGGGAGCATTTCTCCCTGATTCTGGATTCTGCTAAAACAAACCAGACATCTGTGTACTTCTGTGCTAGCAGTTCAACAAACACAGAAGTCTTCTTTGGTAAAGGAACCAGACTCACAGTTGTAGAGGATCTGAGAAATGTGACTCCACCCAAGGTCTCCTTGTTTGAGCCATCAAAAGCAGAGATTGCAAACAAACAAAAGGCTACCCTCGTGTGCTTGGCCAGGGGCTTCTTCCCTGACCACGTGGAGCTGAGCTGGTGGGTGAATGGCAAGGAGGTCCACAGTGGGGTCAGCACGGACCCTCAGGCCTACAAGGAGAGCAATTATAGCTACTGCCTGAGCAGCCGCCTGAGGGTCTCTGCTACCTTCTGGCACAATCCTCGCAACCACTTCCGCTGCCAAGTGCAGTTCCATGGGCTTTCAGAGGAGGACAAGTGGCCAGAGGGCTCACCCAAACCTGTCACACAGAACATCAGTGCAGAGGCCTGGGGCCGAGCAGACTGTGGGATTACCTCAGCATCCTATCAACAAGGGGTCTTGTCTGCCACCATCCTCTATGAGATCCTGCTAGGGAAAGCCACCCTGTATGCTGTGCTTGTCAGTACACTGGTGGTGATGGCTATGGTCAAAAGAAAGAACTCGTGA(SEQ ID NO:189)
ATGGTCCTAGTGACCATTCTGCTGCTCAGCGCGTTCTTCTCACTGAGAGGAAACAGTGCCCAGTCCGTGGACCAGCCTGATGCTCATGTCACGCTCTCTGAAGGAGCCTCCCTGGAGCTCAGATGCAGTTATTCATACAGTGCAGCACCTTACCTCTTCTGGTACGTGCAGTATCCTGGCCAGAGCCTCCAGTTTCTCCTCAAATACATCACAGGAGACACCGTTGTTAAAGGCACCAAGGGCTTTGAGGCCGAGTTTAGGAAGAGTAACTCCTCTTTCAACCTGAAGAAATCCCCAGCCCATTGGAGCGACTCAGCCAAGTACTTCTGTGCACTGGAGGGCCCGGATACAGGAAACTACAAATACGTCTT(SEQ ID NO:190)ATGGGCATCCAGACCCTCTGTTGTGTGATCTTTTATGTTCTGATAGCAAATCACACAGATGCTGGAGTTACCCAGACACCCAGACATGAGGTGGCAGAGAAAGGACAAACAATAATCCTGAAGTGTGAGCCAGTTTCAGGCCACAATGACCTTTTCTGGTACAGACAGACCAAGATACAGGGACTAGAGTTGCTGAGCTACTTCCGCAGCAAGTCTCTTATGGAAGATGGTGGGGCTTTCAAGGATCGATTCAAAGCTGAGATGCTAAATTCATCCTTCTCCACTCTGAAGATTCAACCTACAGAACCCAGGGACTCAGCTGTGTATCTGTGTGCCAGCAGTTTTGGGACAGCTAGTGCAGAAACGCTGTATTTT(SEQ ID NO:191)
ATGGTCCTAGTGACCATTCTGCTGCTCAGCGCGTTCTTCTCACTGAGAGGAAACAGTGCCCAGTCCGTGGACCAGCCTGATGCTCATGTCACGCTCTCTGAAGGAGCCTCCCTGGAGCTCAGATGCAGTTATTCATACAGTGCAGCACCTTACCTCTTCTGGTACGTGCAGTATCCTGGCCAGAGCCTCCAGTTTCTCCTCAAATACATCACAGGAGACACCGTTGTTAAAGGCACCAAGGGCTTTGAGGCCGAGTTTAGGAAGAGTAACTCCTCTTTCAACCTGAAGAAATCCCCAGCCCATTGGAGCGACTCAGCCAAGTACTTCTGTGCACTGGAGGGCCCGGATACAGGAAACTACAAATACGTCTTTGGAGCAGGTACCAGACTGAAGGTTATAGCACACATCCAGAACCCAGAACCTGCTGTGTACCAGTTAAAAGATCCTCGGTCTCAGGACAGCACCCTCTGCCTGTTCACCGACTTTGACTCCCAAATCAATGTGCCGAAAACCATGGAATCTGGAACGTTCATCACTGACAAAACTGTGCTGGACATGAAAGCTATGGATTCCAAGAGCAATGGGGCCATTGCCTGGAGCAACCAGACAAGCTTCACCTGCCAAGATATCTTCAAAGAGACCAACGCCACCTACCCCAGTTCAGACGTTCCCTGTGATGCCACGTTGACTGAGAAAAGCTTTGAAACAGATATGAACCTAAACTTCCAAAACCTGTCAGTTATGGGACTCCGAATCCTCCTGCTGAAAGTAGCCGGATTTAACCTGCTCATGACGCTGAGGCTGTGGTCCAGTTGA(SEQ ID NO:192)
ATGGGCATCCAGACCCTCTGTTGTGTGATCTTTTATGTTCTGATAGCAAATCACACAGATGCTGGAGTTACCCAGACACCCAGACATGAGGTGGCAGAGAAAGGACAAACAATAATCCTGAAGTGTGAGCCAGTTTCAGGCCACAATGACCTTTTCTGGTACAGACAGACCAAGATACAGGGACTAGAGTTGCTGAGCTACTTCCGCAGCAAGTCTCTTATGGAAGATGGTGGGGCTTTCAAGGATCGATTCAAAGCTGAGATGCTAAATTCATCCTTCTCCACTCTGAAGATTCAACCTACAGAACCCAGGGACTCAGCTGTGTATCTGTGTGCCAGCAGTTTTGGGACAGCTAGTGCAGAAACGCTGTATTTTGGCTCAGGAACCAGACTGACTGTTCTCGAGGATCTGAGAAATGTGACTCCACCCAAGGTCTCCTTGTTTGAGCCATCAAAAGCAGAGATTGCAAACAAACAAAAGGCTACCCTCGTGTGCTTGGCCAGGGGCTTCTTCCCCTGACACGTGGAGCTGAGCTGGTGGGTGAATGGCAAGGAGGTCCACAGTGGGGTCAGCACGGACCCTCAGGCCTACAAGGAGAGCAATTATAGCTACTGCCTGAGCAGCCGCCTGAGGGTCTCTGCTACCTTCTGGCACAATCCTCGAAACCACTTCCGCTGTCAAGTGCAGTTCCATGGGCTTTCAGAGGAGGACAAGTGGCCAGAGGGCTCACCCAAACCTGTCACACAGAACATCAGTGCAGAGGCCTGGGGCCGAGCAGACTGTGGAATCACTTCAGCATCCTATCATCAGGGGGTTCTGTCTGCAACCATCCTCTATGAGATCCTACTGGGGAAGGCCACCCTATATGCTGTGCTGGTCAGTGGCCTGGTGCTGATGGCCATGGTCAAGAAAAAAAATTCCTGA(SEQ ID NO:193)
MGPVTCSVLVLLLMLRRSNGDGDSVTQTEGLVTLTEGLPVMLNCTYQTIYSNPFLFWYVQHLNESPRLLLKSFTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCAFDTNAYKVIF(SEQ ID NO:194)MRVRLISAVVLCSLGTGLVDMKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSSTNTEVF(SEQ ID NO:195)
MGPVTCSVLVLLLMLRRSNGDGDSVTQTEGLVTLTEGLPVMLNCTYQTIYSNPFLFWYVQHLNESPRLLLKSFTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCAFDTNAYKVIFGKGTHLHVLPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNTTYPSSDVPCDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSSL(SEQ ID NO:196)
MRVRLISAVVLCSLGTGLVDMKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSSTNTEVFFGKGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVM(SEQ ID NO:197)
MVLVTILLLSAFFSLRGNSAQSVDQPDAHVTLSEGASLELRCSYSYSAAPYLFWYVQYPGQSLQFLLKYITGDTVVKGTKGFEAEFRKSNSSFNLKKSPAHWSDSAKYFCALEGPDTGNYKYV(SEQ ID NO:198)
MGIQTLCCVIFYVLIANHTDAGVTQTPRHEVAEKGQTIILKCEPVSGHNDLFWYRQTKIQGLELLSYFRSKSLMEDGGAFKDRFKAEMLNSSFSTLKIQPTEPRDSAVYLCASSFGTASAETLY(SEQ ID NO:199)
MVLVTILLLSAFFSLRGNSAQSVDQPDAHVTLSEGASLELRCSYSYSAAPYLFWYVQYPGQSLQFLLKYITGDTVVKGTKGFEAEFRKSNSSFNLKKSPAHWSDSAKYFCALEGPDTGNYKYVFGAGTRLKVIAHIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:200)
MGIQTLCCVIFYVLIANHTDAGVTQTPRHEVAEKGQTIILKCEPVSGHNDLFWYRQTKIQGLELLSYFRSKSLMEDGGAFKDRFKAEMLNSSFSTLKIQPTEPRDSAVYLCASSFGTASAETLYFGSGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGLVLMAMVKKKNS(SEQ ID NO:201)
In some embodiments, the TCR construct comprises a MAGE-A4 specific TCR chain. In some embodiments, a TCR construct comprising a MAGE-A4 specific TCR chain comprises TCR alpha and TCR beta chains targeting epitope GVYDGREHTV (SEQ ID NO: 202). In some embodiments, a TCR construct comprising a MAGE-A4 specific TCR chain comprises TCR alpha and TCR beta chains targeting epitope FMNKFIYEI (SEQ ID NO: 203). In some embodiments, MAGE-A4 specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in international patent application publications WO 2017/174824 A1 and WO 2021/229212 A1, each of which is incorporated herein by reference for the purposes described herein. In certain embodiments, the anti-MAGE-A4 TCR alpha chain variable domain can have M4V or M4L amino acid substitutions. In certain embodiments, the anti-MAGE-A4 TCR β chain variable domain can have N10E amino acid substitutions.
In some embodiments, a TCR construct comprising a MAGE-A4 specific TCR chain comprises a nucleotide coding sequence that is at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to one or more of SEQ ID NOS: 204-205. In some embodiments, a TCR construct comprising a MAGE-A4 specific TCR chain comprises an amino acid sequence at least or exactly 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to one or more of SEQ ID NOS: 206-214.
ATGAAGAAGCACCTGACCACCTTTCTCGTGATCCTGTGGCTGTACTTCTACCGGGGCAACGGCAAGAACCAGGTGGAACAGAGCCCCCAGAGCCTGATCATCCTGGAAGGCAAGAACTGCACCCTGCAGTGCAACTACACCGTGTCCCCCTTCAGCAACCTGCGGTGGTACAAGCAGGACACCGGCAGAGGCCCTGTGTCCCTGACCATCCTGACCTTCAGCGAGAACACCAAGAGCAACGGCCGGTACACCGCCACCCTGGACGCCGATACAAAGCAGAGCAGCCTGCACATCACCGCCAGCCAGCTGAGCGATAGCGCCAGCTACATCTGCGTGGTGTCCGGCGGCACAGACAGCTGGGGCAAGCTGCAGTTTGGCGCCGGAACACAGGTGGTCGTGACCCCCGACATCCAGAACCCTGACCCTGCCGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGTCCCAGAGCAAGGACAGCGACGTGTACATCACCGACAAGACCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAATAGCGCCGTGGCCTGGTCCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATTATCCCCGAGGACACATTCTTCCCAAGCCCCGAGAGCAGCTGCGACGTCAAGCTGGTGGAAAAGAGCTTCGAGACAGACACCAACCTGAACTTCCAGAACCTGAGCGTGATCGGCTTCAGAATCCTGCTGCTGAAGGTGGCCGGCTTCAACCTGCTGATGACCCTGAGACTGTGGTCCAGCGGCAGCCGGGCCAAGAGA(SEQ ID NO:204)
ATGGCCAGCCTGCTGTTCTTCTGCGGCGCCTTCTACCTGCTGGGCACCGGCTCTATGGATGCCGACGTGACCCAGACCCCCCGGAACAGAATCACCAAGACCGGCAAGCGGATCATGCTGGAATGCTCCCAGACCAAGGGCCACGACCGGATGTACTGGTACAGACAGGACCCTGGCCTGGGCCTGCGGCTGATCTACTACAGCTTCGACGTGAAGGACATCAACAAGGGCGAGATCAGCGACGGCTACAGCGTGTCCAGACAGGCTCAGGCCAAGTTCAGCCTGTCCCTGGAAAGCGCCATCCCCAACCAGACCGCCCTGTACTTTTGTGCCACAAGCGGCCAGGGCGCCTACGAGGAGCAGTTCTTTGGCCCTGGCACCCGGCTGACAGTGCTGGAAGATCTGAAGAACGTGTTCCCCCCAGAGGTGGCCGTGTTCGAGCCTTCTGAGGCCGAAATCAGCCACACCCAGAAAGCCACACTCGTGTGTCTGGCCACCGGCTTCTACCCCGACCACGTGGAACTGTCTTGGTGGGTCAACGGCAAAGAGGTGCACAGCGGCGTGTCCACCGATCCCCAGCCTCTGAAAGAACAGCCCGCCCTGAACGACAGCCGGTACTGCCTGAGCAGCAGACTGAGAGTGTCCGCCACCTTCTGGCAGAACCCCAGAAACCACTTCAGATGCCAGGTGCAGTTTTACGGCCTGAGCGAGAACGACGAGTGGACCCAGGACAGAGCCAAGCCCGTGACACAGATCGTGTCTGCCGAAGCTTGGGGGCGCGCCGATTGTGGCTTTACCAGCGAGAGCTACCAGCAGGGCGTGCTGAGCGCCACCATCCTGTACGAGATCCTGCTGGGAAAGGCCACACTGTACGCCGTGCTGGTGTCTGCCCTGGTGCTGATGGCCATGGTCAAGCGGAAGGACAGCCGGGGC(SEQ ID NO:205)
MKKHLTTFLVILWLYFYRGNGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTILTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVSGGTDSWGKLQFGAGTQVVVTPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSSGSRAKR(SEQ ID NO:206)
MKKHLTTFLVILWLYFYRGNGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTILTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVSGGTDSWGKLQFGAGTQVVVTPD(SEQ ID NO:207)
MASLLFFCGAFYLLGTGSMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSGQGAYEEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG(SEQ ID NO:208)
MASLLFFCGAFYLLGTGSMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSGQGAYEEQFFGPGTRLTVLE(SEQ ID NO:209)
MKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVSGGTDSWGKLQF(SEQ ID NO:210)
MKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTIVTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVSGGTDSWGKLQF(SEQ ID NO:211)
MKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTILTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVSGGTDSWGKLQF(SEQ ID NO:212)
MASLLFFCGAFYLLGTGSMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSGQGAYNEQFF(SEQ ID NO:213)
MASLLFFCGAFYLLGTGSMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSGQGAYEEQFF(SEQ ID NO:214)
In some embodiments, the TCR construct comprises a Wilms tumor antigen (WT 1) WT 1-specific TCR chain. In some embodiments, a TCR construct comprising a WT1 specific TCR chain comprises TCR alpha and TCR beta chains targeting epitope VLDFAPPGA (SEQ ID NO: 215). In some embodiments, a TCR construct comprising a WT1 specific TCR chain comprises TCR alpha and TCR beta chains targeting the epitope RMFPNAPYL (SEQ ID NO: 216). In some embodiments, WT 1-specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in international patent application publications WO 2020/185796 A1 and WO 2021/034976A1, each of which is incorporated by reference herein for the purposes described herein. In some embodiments, the leader sequence and/or signal peptide may be removed from the TCR amino acid sequence, and the percentage of sequence identity may be calculated based on the TCR amino acid sequence without the leader sequence and/or signal peptide.
In some embodiments, a TCR construct comprising a WT1 specific TCR chain comprises a nucleotide coding sequence that is at least or exactly 85%,86%,87%,88%,89%,90%,91%,92%,93%,94%,95%,96%,97%,98%,99% or 100% identical to one or more of SEQ ID NOS 217-256. In some embodiments, a TCR construct comprising a WT1 specific TCR chain comprises an amino acid sequence that is at least or exactly 85%,86%,87%,88%,89%,90%,91%,92%,93%,94%,95%,96%,97%,98%,99% or 100% identical to one or more of SEQ ID NOS: 257-291.
ATGGAGACACTGCTGGGACTACTGATTCTGTGGCTGCAACTGCAATGGGTGAGCAGCAAACAGGAGGTTACCCAGATTCCTGCTGCTCTGTCTGTTCCTGAAGGCGAGAATCTGGTGCTGAACTGCAGCTTCACAGATAGCGCCATCTACAACCTGCAGTGGTTCAGACAGGATCCTGGAAAAGGCCTGACAAGCCTGCTGCTGATTCAGAGCTCTCAGAGAGAGCAGACATCTGGAAGACTGAATGCTAGCCTGGACAAGTCTAGCGGCAGAAGCACCCTGTATATTGCCGCCTCTCAACCTGGAGATTCTGCCACATACCTGTGTGCTGTGAAGGAGACATCTGGCTCTAGACTGACCTTTGGCGAGGGAACACAACTGACCGTGAATCCTGAC(SEQ ID NO:217)
ATGACCAGAGTTAGCCTGTTATGGGCTGTGGTGGTGAGCACATGTCTGGAATCTGGAATGGCCCAGACAGTGACACAGTCTCAGCCTGAAATGTCTGTGCAGGAAGCCGAAACCGTTACACTGAGCTGCACCTACGATACAAGCGAGAACAACTACTACCTGTTCTGGTACAAGCAGCCCCCCTCTAGGCAGATGATCCTGGTGATCAGACAGGAGGCCTATAAACAGCAGAATGCCACAGAGAACCGGTTCAGCGTGAACTTCCAGAAAGCCGCCAAGAGCTTCAGCCTGAAGATCTCTGATTCTCAGCTGGGCGATACAGCCATGTACTTTTGCGCCTTCATCTACCCCAGCTACACAAGCGGCACATACAAGTACATCTTCGGCACCGGCACAAGACTGAAGGTTCTGGCCAAC(SEQ ID NO:218)
ATGGCCATGTTACTAGGAGCGAGCGTGCTGATTCTGTGGTTACAGCCTGATTGGGTGAACTCTCAGCAGAAGAACGATGATCAGCAGGTGAAGCAGAACAGCCCCTCTCTGTCTGTGCAGGAAGGCAGAATCAGCATCCTGAATTGCGATTACACCAACAGCATGTTCGACTACTTCCTGTGGTACAAGAAGTACCCCGCCGAGGGCCCTACCTTTCTGATCAGCATCTCTAGCATCAAGGACAAGAACGAAGATGGCAGATTCACCGTGTTCCTGAACAAGAGCGCCAAGCACCTGAGCCTGCACATTGTGCCTTCTCAACCTGGAGATTCTGCCGTGTACTTTTGTGCTGCCTCTGGAACAGGCGGAAGCTATATCCCCACATTTGGAAGAGGAACAAGCCTGATCGTGCACCCTTAC(SEQ ID NO:219)
ATGGCCATGTTACTAGGAGCGAGCGTGCTGATTCTGTGGTTACAGCCTGATTGGGTGAACTCTCAGCAGAAGAACGATGATCAGCAGGTGAAGCAGAACAGCCCCTCTCTGTCTGTGCAGGAAGGCAGAATCAGCATCCTGAATTGCGATTACACCAACAGCATGTTCGACTACTTCCTGTGGTACAAGAAGTACCCCGCCGAGGGCCCTACCTTTCTGATCAGCATCTCTAGCATCAAGGACAAGAACGAAGATGGCAGATTCACCGTGTTCCTGAACAAGAGCGCCAAGCACCTGAGCCTGCACATTGTGCCTTCTCAACCTGGAGATTCTGCCGTGTACTTTTGTGCTGCCTCTGGCATTGGCGACTACAAACTGAGCTTTGGAGCCGGCACAACAGTGACCGTTAGAGCCAAT(SEQ ID NO:220)
ATGGTGAAGATCCGGCAGTTCCTCCTGGCTATTCTGTGGCTGCAACTGTCTTGTGTGTCTGCTGCCAAGAATGAAGTGGAGCAGTCTCCCCAGAACCTTACAGCCCAGGAAGGCGAGTTTATCACCATCAACTGCAGCTATTCTGTGGGCATTAGCGCCCTGCATTGGCTGCAGCAACACCCTGGAGGAGGAATTGTGTCTCTGTTTATGCTGTCTTCTGGCAAGAAGAAGCACGGCCGGCTGATTGCCACCATCAACATCCAGGAGAAGCACTCTTCTCTGCACATTACAGCCTCTCATCCCAGGGATTCTGCCGTGTACATCTGTGCCGTGAGAACCAGCTACGATAAGGTGATTTTCGGACCAGGCACCTCTCTGAGCGTGATCCCCAAT(SEQ ID NO:221)
ATGAAGAGCCTGAGAGTCCTGCTGGTGATTTTGTGGCTGCAGCTGTCTTGGGTTTGGTCTCAGCAGAAAGAAGTGGAGCAGAATAGCGGCCCTCTGTCTGTTCCTGAAGGCGCTATTGCTAGCCTGAATTGCACATACAGCGATAGAGGATCTCAGAGCTTCTTCTGGTACCGGCAGTACAGCGGCAAGAGCCCAGAACTGATCATGTTCATCTACAGCAATGGCGACAAGGAGGATGGCAGGTTTACAGCCCAGCTGAACAAGGCCAGCCAGTATGTTTCTCTGCTGATCAGAGATAGCCAGCCTAGCGATTCTGCCACCTACCTGTGTGCCGTGAACTTACTTGGAGCTACAGGATACTCTACACTGACCTTCGGCAAAGGCACCATGCTGCTGGTGAGCCCTGAT(SEQ ID NO:222)
ATGTGGGGCGTTTTCCTTCTGTATGTGAGCATGAAGATGGGCGGCACAACAGGCCAGAACATCGATCAGCCTACCGAGATGACAGCCACAGAAGGAGCTATTGTTCAGATCAACTGCACCTACCAGACAAGCGGCTTCAACGGCCTGTTCTGGTACCAGCAGCATGCTGGAGAAGCTCCTACATTTCTGAGCTACAATGTGCTGGATGGCCTGGAGGAGAAAGGCAGGTTTAGCAGCTTCCTGAGCAGGTCTAAGGGCTATTCTTATCTGCTGCTGAAGGAGCTGCAGATGAAGGATTCCGCCAGCTACCTGTGTGCCGTTAGGGGCATCAATGATTACAAGCTGAGCTTTGGAGCCGGAACAACAGTGACCGTGAGAGCCAAC(SEQ ID NO:223)
ATGGAGAAGATGCTGGAGTGTGCGTTCATCGTTCTGTGGCTGCAACTTGGATGGCTGTCTGGAGAGGATCAGGTTACACAGTCTCCTGAAGCCCTGAGACTGCAAGAAGGAGAAAGCTCTAGCCTGAACTGCAGCTACACAGTGTCTGGACTGAGAGGCCTGTTCTGGTACAGACAGGATCCTGGAAAAGGCCCAGAGTTCCTGTTTACCCTGTATTCTGCCGGCGAGGAGAAGGAGAAAGAGAGACTGAAAGCTACCCTGACCAAGAAGGAGAGCTTCCTGCACATTACCGCCCCCAAACCTGAGGATTCTGCCACATATCTGTGTGCCGTGATTACCGGCTTTCAGAAGCTGGTGTTTGGCACAGGCACCAGACTGCTGGTTTCTCCCAAT(SEQ ID NO:224)
ATGAGACTGGTGGCACGCGTAACTGTGTTTCTGACCTTTGGCACCATCATCGATGCCAAGACAACCCAGCCTACAAGCATGGACTGTGCCGAGGGAAGAGCTGCTAATCTGCCATGTAATCACAGCACAATCAGCGGCAACGAGTACGTGTACTGGTACCGGCAGATCCACTCTCAAGGACCTCAGTACATCATTCATGGCCTGAAGAACAACGAGACCAACGAGATGGCCAGCCTGATCATCACCGAGGACAGGAAGTCTTCTACCCTGATTCTGCCTCATGCTACACTGAGAGATACCGCCGTGTACTACTGCATTGCCGGAGTGGGAAGAGGCCAGAATTTCGTGTTTGGACCTGGAACAAGACTGAGCGTTCTGCCCTAT(SEQ ID NO:225)
ATGGAGAAGAACCCCTTGGCAGCACCTCTGCTTATTCTGTGGTTCCACCTGGATTGTGTGAGCAGCATCCTGAATGTGGAGCAGTCTCCTCAGAGCCTGCATGTGCAAGAAGGCGATAGCACCAATTTCACCTGCAGCTTTCCAAGCAGCAACTTCTACGCCCTGCACTGGTACAGATGGGAAACCGCCAAATCTCCTGAAGCCCTGTTTGTGATGACCCTGAATGGCGACGAGAAGAAGAAGGGCAGAATTAGCGCCACCCTGAATACCAAGGAGGGCTACAGCTACCTGTACATCAAGGGCTCTCAACCTGAGGATTCTGCCACCTACCTTTGCGCCTTTCACCCCAATTTCGGCAACGAGAAACTGACCTTTGGAACCGGAACAAGGCTGACCATCATCCCCAAC(SEQ ID NO:226)
ATGGAGAAGATGCTGGAGTGTGCGTTCATCGTTCTGTGGCTGCAACTTGGATGGCTGTCTGGAGAGGATCAGGTTACACAGTCTCCTGAAGCCCTGAGACTGCAAGAAGGAGAAAGCTCTAGCCTGAACTGCAGCTACACAGTGTCTGGACTGAGAGGCCTGTTCTGGTACAGACAGGATCCTGGAAAAGGCCCAGAGTTCCTGTTTACCCTGTATTCTGCCGGCGAGGAGAAGGAGAAAGAGAGACTGAAAGCTACCCTGACCAAGAAGGAGAGCTTCCTGCACATTACCGCCCCCAAACCTGAGGATTCTGCCACATATCTGTGTGCTGTTCAGCCTAGAGGAGATGGCTCTAGCAATACCGGCAAGCTGATCTTTGGCCAGGGAACAACACTGCAGGTGAAGCCTGAT(SEQ ID NO:227)
ATCCAGAATCCCGATCCTGCTGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGTCCCAGAGCAAGGACAGCGACGTGTACATCACCGATAAGTGCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAACAGCGCCGTGGCCTGGTCCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATTATCCCCGAGGACACATTCTTCCCAAGCCCCGAGAGCAGCTGCGACGTGAAGCTGGTGGAAAAGAGCTTCGAGACAGACACCAACCTGAACTTCCAGAACCTCAGCGTGATCGGCTTCCGGATCCTGCTGCTGAAGGTGGCCGGCTTCAACCTGCTGATGACCCTGCGGCTGTGGTCCAGCTGA(SEQ ID NO:228)
CTCAATAAAAGAGCCCACAACCCCTCACTCGGCGCGCCACCATGGGCACATCTCTTCTCTGTTGGGTGGTTCTGGGCTTTCTGGGCACAGATCATACAGGAGCTGGAGTTAGCCAGTCTCCTAGGTATAAGGTGACCAAGAGGGGACAGGATGTGGCTCTGAGATGTGACCCTATTAGCGGACATGTGAGCCTGTACTGGTACAGACAAGCTCTGGGACAAGGACCCGAGTTTCTGACCTACTTCAACTATGAGGCCCAGCAGGACAAATCTGGACTGCCCAACGACAGATTCAGCGCCGAAAGACCAGAAGGCTCTATTAGCACACTGACCATCCAGAGAACAGAGCAGAGGGATTCTGCCATGTACAGATGCGCCAGCAGCTTAACAGGCTCTTACGAGCAGTACTTTGGACCTGGCACAAGACTGACAGTGACAGAG(SEQ ID NO:229)
CTCAATAAAAGAGCCCACAACCCCTCACTCGGCGCGCCACCATGCTGCTTCTTCTCCTCCTTCTCGGACCTGCTGGATCTGGATTAGGAGCTGTTGTGTCTCAGCACCCTTCTTGGGTGATCTGTAAAAGCGGCACAAGCGTGAAGATCGAGTGCAGAAGCCTGGACTTTCAGGCCACAACCATGTTCTGGTATAGGCAGTTCCCCAAGCAGTCTCTGATGCTGATGGCCACCTCTAATGAGGGCTCTAAGGCCACATATGAACAGGGAGTGGAGAAGGACAAGTTCCTGATCAACCACGCCTCTCTGACCCTGTCTACCCTGACAGTTACATCTGCCCACCCTGAGGATAGCAGCTTTTACATCTGTAGCGCCACACCTGAAGCCTCTAGCCCATATGAGCAGTACTTTGGCCCTGGCACCAGATTAACAGTGACAGAG(SEQ ID NO:230)
CTCAATAAAAGAGCCCACAACCCCTCACTCGGCGCGCCACCATGGGACCTGGACTGCTTCATTGGATGGCTCTGTGTTTGCTGGGAACAGGACATGGAGATGCTATGGTGATCCAGAACCCCAGGTATCAGGTGACCCAGTTTGGCAAACCAGTGACACTGAGCTGTTCTCAGACCCTGAACCACAACGTGATGTACTGGTACCAGCAGAAGTCTTCTCAGGCCCCTAAGCTGCTGTTCCACTACTACGACAAGGACTTCAACAACGAGGCCGATACCCCTGACAATTTCCAGAGCAGGAGGCCCAATACCAGCTTCTGTTTCCTGGACATTAGAAGCCCTGGACTGGGAGATGCTGCCATGTACCTGTGTGCCACCAGCAATTTACAGGGAAGACAACCTCAGCACTTTGGCGATGGCACAAGGCTGTCTATCCTGGAG(SEQ ID NO:231)
CTCAATAAAAGAGCCCACAACCCCTCACTCGGCGCGCCACCATGCTGAGCCCTGATCTCCCTGATTCTGCCTGGAATACCAGACTGCTGTGTCATGTGATGCTGTGTCTGCTTGGAGCCGTTTCTGTGGCTGCTGGCGTGATTCAATCTCCTAGACACCTGATCAAGGAGAAGAGAGAAACAGCCACCCTGAAGTGCTACCCCATCCCCAGACACGATACAGTGTACTGGTATCAGCAAGGACCTGGACAAGATCCCCAGTTCCTGATCAGCTTCTACGAGAAGATGCAGAGCGACAAAGGCAGCATCCCAGACAGATTTAGCGCCCAGCAGTTTAGCGACTATCACTCTGAGCTGAACATGAGCAGCCTGGAACTGGGCGATTCTGCTCTGTACTTCTGTGCCTCTTCTCTGAGACTGGGAAGAGAAACCCAGTACTTTGGACCCGGCACAAGACTGCTGGTTCTTGAG(SEQ ID NO:232)
CTCAATAAAAGAGCCCACAACCCCTCACTCGGCGCGCCACCATGGGCACAAGACTTCTCTGCTGGGTGGTGCTTGGATTTCTGGGCACAGATCATACAGGAGCTGGAGTTAGCCAGTCTCCTAGGTACAAAGTGGCCAAGAGAGGACAGGATGTGGCTCTGAGATGTGACCCTATTAGCGGACATGTGAGCCTGTTTTGGTACCAGCAAGCTCTGGGACAAGGACCCGAGTTTCTGACCTACTTCCAGAATGAAGCCCAGCTGGATAAATCTGGACTGCCTAGCGACCGGTTCTTCGCCGAAAGACCTGAAGGATCTGTTAGCACCCTGAAGATTCAGAGAACACAGCAGGAGGACTCTGCCGTGTACCTGTGTGCCTCTTCTTTAGGACAGGCCTATGAGCAGTATTTTGGACCTGGCACCAGACTGACCGTGACAGAG(SEQ ID NO:233)
CTCAATAAAAGAGCCCACAACCCCTCACTCGGCGCGCCACCATGGGCACAAGACTTCTCTGCTGGGTGGCCTTTTGTCTGCTGGTGGAAGAGCTGATTGAAGCTGGAGTTGTGCAGTCTCCTAGGTACAAGATCATCGAGAAGAAGCAGCCCGTGGCCTTCTGGTGTAATCCCATTTCTGGCCACAACACCCTGTACTGGTATCTGCAGAATCTGGGACAGGGCCCTGAACTGCTGATCAGATACGAGAACGAAGAAGCCGTGGACGATTCTCAACTGCCTAAGGACCGCTTTTCTGCCGAGAGGCTGAAAGGAGTGGATTCTACCCTGAAGATCCAACCTGCTGAACTGGGCGATTCTGCTGTGTACCTGTGCGCTTCTAGCCTGACAAGAGGAGCTGAAGCCTTTTTTGGACAGGGCACAAGACTGACAGTGGTGGAG(SEQ ID NO:234)
CTCAATAAAAGAGCCCACAACCCCTCACTCGGCGCGCCACCATGGGACCTCAGCTTCTTGGATACGTTGTGCTGTGTCTGCTTGGAGCTGGACCTCTTGAAGCTCAGGTTACCCAGAACCCCAGATACCTGATTACCGTGACAGGCAAAAAGCTGACCGTGACATGTAGCCAGAACATGAACCACGAGTACATGAGCTGGTACCGGCAGGATCCTGGATTAGGCCTGAGACAGATCTACTACAGCATGAACGTGGAGGTGACCGATAAAGGCGACGTGCCTGAGGGATACAAGGTGAGCAGAAAGGAGAAGAGGAATTTCCCCCTGATCCTGGAAAGCCCAAGCCCCAATCAGACAAGCCTGTACTTTTGTGCCAGCAGCTTTTCTGGCGGCACATATGAGCAGTACTTCGGCCCTGGCACAAGACTGACAGTTACAGAG(SEQ ID NO:235)
CTCAATAAAAGAGCCCACAACCCCTCACTCGGCGCGCCACCATGCTGAGCCCTGATCTCCCTGATTCTGCCTGGAATACCAGACTGCTGTGTCATGTGATGCTGTGTCTGCTTGGAGCCGTTTCTGTGGCTGCTGGCGTGATTCAATCTCCTAGACACCTGATCAAGGAGAAGAGAGAAACAGCCACCCTGAAGTGCTACCCCATCCCCAGACACGATACAGTGTACTGGTATCAGCAAGGACCTGGACAAGATCCCCAGTTCCTGATCAGCTTCTACGAGAAGATGCAGAGCGACAAAGGCAGCATCCCAGACAGATTTAGCGCCCAGCAGTTTAGCGACTATCACTCTGAGCTGAACATGAGCAGCCTGGAACTGGGCGATTCTGCTCTGTACTTCTGTGCCAGCAGCTATAGAGGAGGCAGCACATATGAGCAGTACTTTGGCCCTGGCACAAGACTGACAGTGACAGAG(SEQ ID NO:236)
CTCAATAAAAGAGCCCACAACCCCTCACTCGGCGCGCCACCATGAGCACCAGACTCCTTTGCTGGATGGCTTTGTGTCTGCTTGGAGCTGAGCTGTCTGAAGCTGAAGTTGCCCAGTCTCCCAGATACAAGATCACCGAGAAATCTCAGGCTGTGGCCTTCTGGTGTGACCCTATTTCTGGACACGCCACCCTGTACTGGTATAGGCAAATTCTGGGACAAGGCCCTGAACTGCTGGTGCAATTTCAGGATGAGAGCGTGGTGGACGATTCTCAACTGCCTAAGGACAGGTTTTCTGCCGAGCGGCTGAAAGGAGTTGATAGCACCCTGAAGATCCAACCTGCTGAACTGGGCGATTCTGCTATGTACCTGTGCGCCTCTTCTCAGAGAGATAGCCCTAACGAGAAGCTGTTCTTTGGCTCTGGAACCCAGCTGTCTGTGCTGGAG(SEQ ID NO:237)
CTCAATAAAAGAGCCCACAACCCCTCACTCGGCGCGCCACCATGGGCTGTAGACTGTTGTGTTGTGCTGTGCTGTGTCTGTTGGGAGCTGTGCCTATGGAAACAGGCGTTACCCAGACACCTAGACATCTGGTTATGGGCATGACCAACAAGAAGAGCCTGAAGTGCGAGCAGCATCTGGGCCATAACGCCATGTACTGGTATAAGCAGAGCGCCAAGAAACCACTGGAACTGATGTTCGTGTACAGCCTGGAGGAGAGGGTGGAGAATAATAGCGTGCCCAGCAGATTTAGCCCTGAGTGCCCAAATTCTTCTCACCTGTTCCTGCACCTGCACACATTACAGCCCGAGGATTCTGCCCTGTACCTGTGTGCTTCTTCTCAAGACCCTTACAAGCTGAGCGGCAATACCATCTACTTCGGCGAAGGCTCTTGGCTGACAGTGGTTGAA(SEQ ID NO:238)
GATCTGAACAAGGTGTTCCCCCCAGAGGTGGCCGTGTTCGAGCCTTCTGAGGCCGAGATCTCCCACACCCAGAAAGCCACCCTCGTGTGCCTGGCCACCGGCTTTTTCCCCGACCACGTGGAACTGTCTTGGTGGGTCAACGGCAAAGAGGTGCACTCCGGCGTGTGCACCGATCCCCAGCCTCTGAAAGAACAGCCCGCCCTGAACGACAGCCGGTACTGCCTGAGCAGCAGACTGAGAGTGTCCGCCACCTTCTGGCAGAACCCCCGGAACCACTTCAGATGCCAGGTGCAGTTCTACGGCCTGAGCGAGAACGACGAGTGGACCCAGGACAGAGCCAAGCCCGTGACACAGATCGTGTCTGCCGAAGCCTGGGGCAGAGCCGATTGCGGCTTTACCTCCGTGTCCTATCAGCAGGGCGTGCTGAGCGCCACAATCCTGTACGAGATCCTGCTGGGCAAGGCCACCCTGTACGCCGTGCTGGTGTCTGCCCTGGTGCTGATGGCCATGGTCAAGCGGAAGGACTTC(SEQ ID NO:239)
GACCTGAAGAACGTGTTCCCCCCAGAGGTGGCCGTGTTCGAGCCTAGCGAGGCCGAGATCAGCCACACCCAGAAAGCCACCCTCGTGTGCCTGGCCACCGGCTTTTACCCCGACCACGTGGAACTGTCTTGGTGGGTCAACGGCAAAGAGGTGCACAGCGGCGTCTGCACCGACCCCCAGCCCCTGAAAGAGCAGCCCGCCCTGAACGACAGCCGGTACTGTCTGAGCAGCAGACTGAGAGTGTCCGCCACCTTCTGGCAGAACCCCCGGAACCACTTCAGATGCCAGGTGCAGTTCTACGGCCTGAGCGAGAACGACGAGTGGACCCAGGACCGGGCCAAGCCCGTGACCCAGATCGTGTCTGCTGAGGCCTGGGGCAGAGCCGATTGCGGCTTCACCAGCGAGAGCTACCAGCAGGGCGTGCTGAGCGCCACCATCCTGTACGAGATCCTGCTGGGCAAGGCCACCCTGTACGCCGTGCTGGTGTCCGCCCTGGTGCTGATGGCCATGGTCAAGCGGAAGGACAGCCGGGGC(SEQ ID NO:240)
ATGAAATCCTTGAGAGTTTTACTAGTGATCCTGTGGCTTCAGTTGAGCTGGGTTTGGAGCCAACAGAAGGAGGTGGAGCAGAATTCTGGACCCCTCAGTGTTCCAGAGGGAGCCATTGCCTCTCTCAACTGCACTTACAGTGACCGAGGTTCCCAGTCCTTCTTCTGGTACAGACAATATTCTGGGAAAAGCCCTGAGTTGATAATGTTCATATACTCCAATGGTGACAAAGAAGATGGAAGGTTTACAGCACAGCTCAATAAAGCCAGCCAGTATGTTTCTCTGCTCATCAGAGACTCCCAGCCCAGTGATTCAGCCACCTACCTCTGTGCCGTGAACATAGGAAACCATGACATGCGCTTTGGAGCAGGGACCAGACTGACAGTAAAACCAAATATCCAGAACCCTGACCCTGCCGTGTACCAGCTGAGAGACTCTAAATCCAGTGACAAGTCTGTCTGCCTATTCACCGATTTTGATTCTCAAACAAATGTGTCACAAAGTAAGGATTCTGATGTGTATATCACAGACAAAACTGTGCTAGACATGAGGTCTATGGACTTCAAGAGCAACAGTGCTGTGGCCTGGAGCAACAAATCTGACTTTGCATGTGCAAACGCCTTCAACAACAGCATTATTCCAGAAGACACCTTCTTCCCCAGCCCAGAAAGTTCCTGTGATGTCAAGCTGGTCGAGAAAAGCTTTGAAACAGATACGAACCTAAACTTTCAAAACCTGTCAGTGATTGGGTTCCGAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCTCATGACGCTGCGGCTGTGGTCCAGCTGA(SEQ ID NO:241)
ATGGAGAAAATGTTGGAGTGTGCATTCATAGTCTTGTGGCTTCAGCTTGGCTGGTTGAGTGGAGAAGACCAGGTGACGCAGAGTCCCGAGGCCCTGAGACTCCAGGAGGGAGAGAGTAGCAGTCTCAACTGCAGTTACACAGTCAGCGGTTTAAGAGGGCTGTTCTGGTATAGGCAAGATCCTGGGAAAGGCCCTGAATTCCTCTTCACCCTGTATTCAGCTGGGGAAGAAAAGGAGAAAGAAAGGCTAAAAGCCACATTAACAAAGAAGGAAAGCTTTCTGCACATCACAGCCCCTAAACCTGAAGACTCAGCCACTTATCTCTGTGCTGTGCAGACCATGGACGGTAACCAGTTCTATTTTGGGACAGGGACAAGTTTGACGGTCATTCCAAATATCCAGAACCCTGACCCTGCCGTGTACCAGCTGAGAGACTCTAAATCCAGTGACAAGTCTGTCTGCCTATTCACCGATTTTGATTCTCAAACAAATGTGTCACAAAGTAAGGATTCTGATGTGTATATCACAGACAAAACTGTGCTAGACATGAGGTCTATGGACTTCAAGAGCAACAGTGCTGTGGCCTGGAGCAACAAATCTGACTTTGCATGTGCAAACGCCTTCAACAACAGCATTATTCCAGAAGACACCTTCTTCCCCAGCCCAGAAAGTTCCTGTGATGTCAAGCTGGTCGAGAAAAGCTTTGAAACAGATACGAACCTAAACTTTCAAAACCTGTCAGTGATTGGGTTCCGAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCTCATGACGCTGCGGCTGTGGTCCAGCTGA(SEQ ID NO:242)
ATGGCATGCCCTGGCTTCCTGTGGGCACTTGTGATCTCCACCTGTCTTGAATTTAGCATGGCTCAGACAGTCACTCAGTCTCAACCAGAGATGTCTGTGCAGGAGGCAGAGACCGTGACCCTGAGCTGCACATATGACACCAGTGAGAGTGATTATTATTTATTCTGGTACAAGCAGCCTCCCAGCAGGCAGATGATTCTCGTTATTCGCCAAGAAGCTTATAAGCAACAGAATGCAACAGAGAATCGTTTCTCTGTGAACTTCCAGAAAGCAGCCAAATCCTTCAGTCTCAAGATCTCAGACTCACAGCTGGGGGATGCCGCGATGTATTTCTGTGCTTCCAGTCCAGGAACCTACAAATACATCTTTGGAACAGGCACCAGGCTGAAGGTTTTAGCAAATATCCAGAACCCTGACCCTGCCGTGTACCAGCTGAGAGACTCTAAATCCAGTGACAAGTCTGTCTGCCTATTCACCGATTTTGATTCTCAAACAAATGTGTCACAAAGTAAGGATTCTGATGTGTATATCACAGACAAAACTGTGCTAGACATGAGGTCTATGGACTTCAAGAGCAACAGTGCTGTGGCCTGGAGCAACAAATCTGACTTTGCATGTGCAAACGCCTTCAACAACAGCATTATTCCAGAAGACACCTTCTTCCCCAGCCCAGAAAGTTCCTGTGATGTCAAGCTGGTCGAGAAAAGCTTTGAAACAGATACGAACCTAAACTTTCAAAACCTGTCAGTGATTGGGTTCCGAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCTCATGACGCTGCGGCTGTGGTCCAGCTGA(SEQ ID NO:243)
ATGACACGAGTTAGCTTGCTGTGGGCAGTCGTGGTCTCCACCTGTCTTGAATCCGGCATGGCCCAGACAGTCACTCAGTCTCAACCAGAGATGTCTGTGCAGGAGGCAGAGACTGTGACCCTGAGTTGCACATATGACACCAGTGAGAGTAATTATTATTTGTTCTGGTACAAACAGCCTCCCAGCAGGCAGATGATTCTCGTTATTCGCCAAGAAGCTTATAAGCAACAGAATGCAACGGAGAATCGTTTCTCTGTGAACTTCCAGAAAGCAGCCAAATCCTTCAGTCTCAAGATCTCAGACTCACAGCTGGGGGACACTGCGATGTATTTCTGTGCTTTCAACCCTTGGGAGAACTATGGTCAGAATTTTGTCTTTGGTCCCGGAACCAGATTGTCCGTGCTGCCCTATATCCAGAACCCTGACCCTGCCGTGTACCAGCTGAGAGACTCTAAATCCAGTGACAAGTCTGTCTGCCTATTCACCGATTTTGATTCTCAAACAAATGTGTCACAAAGTAAGGATTCTGATGTGTATATCACAGACAAAACTGTGCTAGACATGAGGTCTATGGACTTCAAGAGCAACAGTGCTGTGGCCTGGAGCAACAAATCTGACTTTGCATGTGCAAACGCCTTCAACAACAGCATTATTCCAGAAGACACCTTCTTCCCCAGCCCAGAAAGTTCCTGTGATGTCAAGCTGGTCGAGAAAAGCTTTGAAACAGATACGAACCTAAACTTTCAAAACCTGTCAGTGATTGGGTTCCGAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCTCATGACGCTGCGGCTGTGGTCCAGCTGA(SEQ ID NO:244)
ATGAAGAGCCTGAGAGTCCTGCTGGTGATTTTGTGGCTGCAGCTGTCTTGGGTTTGGTCTCAGCAGAAAGAAGTGGAGCAGAATAGCGGCCCTCTGTCTGTTCCTGAAGGCGCTATTGCTAGCCTGAATTGCACATACAGCGATAGAGGATCTCAGAGCTTCTTCTGGTACCGGCAGTACAGCGGCAAGAGCCCAGAACTGATCATGTTCATCTACAGCAATGGCGACAAGGAGGATGGCAGGTTTACAGCCCAGCTGAACAAGGCCAGCCAGTATGTTTCTCTGCTGATCAGAGATAGCCAGCCTAGCGATTCTGCCACCTACCTGTGTGCCGTGAACATCGGAAATCACGACATGAGATTTGGAGCCGGCACAAGACTGACCGTGAAGCCCAATATCCAGAACCCTGATCCTGCTGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGTCCCAGAGCAAGGACAGCGACGTGTACATCACCGATAAGTGCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAACAGCGCCGTGGCCTGGTCCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATTATCCCCGAGGACACATTCTTCCCAAGCCCCGAGAGCAGCTGCGACGTGAAGCTGGTGGAAAAGAGCTTCGAGACAGACACCAACCTGAACTTCCAGAACCTCAGCGTGATCGGCTTCCGGATCCTGCTGCTGAAGGTGGCCGGCTTCAACCTGCTGATGACCCTGCGGCTGTGGTCCAGCTGA(SEQ ID NO:245)
ATGGAGAAGATGCTGGAGTGTGCGTTCATCGTTCTGTGGCTGCAACTTGGATGGCTGTCTGGAGAGGATCAGGTTACACAGTCTCCTGAAGCCCTGAGACTGCAAGAAGGAGAAAGCTCTAGCCTGAACTGCAGCTACACAGTGTCTGGACTGAGAGGCCTGTTCTGGTACAGACAGGATCCTGGAAAAGGCCCAGAGTTCCTGTTTACCCTGTATTCTGCCGGCGAGGAGAAGGAGAAAGAGAGACTGAAAGCTACCCTGACCAAGAAGGAGAGCTTCCTGCACATTACCGCCCCCAAACCTGAGGATTCTGCCACATATCTGTGTGCTGTGCAGACCATGGATGGCAACCAGTTCTACTTCGGCACAGGCACATCTCTGACCGTTATCCCCAATATCCAGAACCCTGATCCTGCCGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGTCCCAGAGCAAGGACAGCGACGTGTACATCACCGATAAGTGCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAACAGCGCCGTGGCCTGGTCCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATTATCCCCGAGGACACATTCTTCCCAAGCCCCGAGAGCAGCTGCGACGTGAAGCTGGTGGAAAAGAGCTTCGAGACAGACACCAACCTGAACTTCCAGAACCTCAGCGTGATCGGCTTCCGGATCCTGCTGCTGAAGGTGGCCGGCTTCAACCTGCTGATGACCCTGCGGCTGTGGTCCAGCTGA(SEQ ID NO:246)
ATGGCTTGTCCTGGATTCTTATGGGCTCTGGTGATCAGCACCTGTCTGGAGTTCTCTATGGCCCAGACAGTGACACAGTCTCAGCCTGAAATGTCTGTGCAGGAAGCCGAAACCGTGACACTGTCTTGCACCTACGATACAAGCGAGAGCGACTACTACCTGTTCTGGTACAAGCAGCCTCCCTCTAGGCAGATGATCCTGGTGATTAGACAGGAGGCCTACAAACAGCAGAATGCCACCGAGAACCGGTTTAGCGTGAACTTCCAGAAAGCCGCCAAGAGCTTCAGCCTGAAAATCTCTGACAGCCAGCTGGGAGATGCTGCCATGTACTTTTGTGCCAGCTCTCCAGGCACCTACAAGTACATTTTTGGCACCGGCACCAGACTGAAGGTGCTGGCCAATATCCAGAATCCCGATCCTGCCGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGTCCCAGAGCAAGGACAGCGACGTGTACATCACCGATAAGTGCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAACAGCGCCGTGGCCTGGTCCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATTATCCCCGAGGACACATTCTTCCCAAGCCCCGAGAGCAGCTGCGACGTGAAGCTGGTGGAAAAGAGCTTCGAGACAGACACCAACCTGAACTTCCAGAACCTCAGCGTGATCGGCTTCCGGATCCTGCTGCTGAAGGTGGCCGGCTTCAACCTGCTGATGACCCTGCGGCTGTGGTCCAGCTGA(SEQ ID NO:247)
ATGACCAGAGTTAGCCTGTTATGGGCTGTGGTGGTGAGCACATGTCTGGAATCTGGAATGGCCCAGACAGTGACACAGTCTCAGCCTGAAATGTCTGTGCAGGAAGCCGAAACCGTTACACTGAGCTGCACCTACGATACAAGCGAGAGCAACTACTACCTGTTCTGGTACAAGCAGCCCCCTTCTAGGCAGATGATCCTGGTGATCAGACAGGAGGCCTATAAACAGCAGAATGCCACCGAGAACCGGTTTAGCGTGAACTTCCAGAAAGCCGCCAAGAGCTTCAGCCTGAAAATCTCTGACAGCCAGCTGGGCGATACAGCCATGTACTTTTGTGCCTTCAACCCCTGGGAGAACTATGGCCAGAATTTCGTGTTCGGCCCTGGCACCAGACTGTCTGTTCTGCCTTATATCCAGAACCCCGATCCTGCTGTGTACCAGCTGCGGGACAGCAAGAGCAGCGACAAGAGCGTGTGCCTGTTCACCGACTTCGACAGCCAGACCAACGTGTCCCAGAGCAAGGACAGCGACGTGTACATCACCGATAAGTGCGTGCTGGACATGCGGAGCATGGACTTCAAGAGCAACAGCGCCGTGGCCTGGTCCAACAAGAGCGACTTCGCCTGCGCCAACGCCTTCAACAACAGCATTATCCCCGAGGACACATTCTTCCCAAGCCCCGAGAGCAGCTGCGACGTGAAGCTGGTGGAAAAGAGCTTCGAGACAGACACCAACCTGAACTTCCAGAACCTCAGCGTGATCGGCTTCCGGATCCTGCTGCTGAAGGTGGCCGGCTTCAACCTGCTGATGACCCTGCGGCTGTGGTCCAGCTGA(SEQ ID NO:248)
ATGGGCTGCAGGCTGCTCTGCTGTGCGGTTCTCTGTCTCCTGGGAGCAGTTCCCATAGACACTGAAGTTACCCAGACACCAAAACACCTGGTCATGGGAATGACAAATAAGAAGTCTTTGAAATGTGAACAACATATGGGGCACAGGGCTATGTATTGGTACAAGCAGAAAGCTAAGAAGCCACCGGAGCTCATGTTTGTCTACAGCTATGAGAAACTCTCTATAAATGAAAGTGTGCCAAGTCGCTTCTCACCTGAATGCCCCAACAGCTCTCTCTTAAACCTTCACCTACACGCCCTGCAGCCAGAAGACTCAGCCCTGTATCTCTGCGCCAGCAGCCAAGGGACTAGCGGGGCAGATACGCAGTATTTTGGCCCAGGCACCCGGCTGACAGTGCTCGAGGACCTGAAAAACGTGTTCCCACCCGAGGTCGCTGTGTTTGAGCCATCAGAAGCAGAGATCTCCCACACCCAAAAGGCCACACTGGTGTGCCTGGCCACAGGCTTCTACCCCGACCACGTGGAGCTGAGCTGGTGGGTGAATGGGAAGGAGGTGCACAGTGGGGTCAGCACAGACCCGCAGCCCCTCAAGGAGCAGCCCGCCCTCAATGACTCCAGATACTGCCTGAGCAGCCGCCTGAGGGTCTCGGCCACCTTCTGGCAGAACCCCCGCAACCACTTCCGCTGTCAAGTCCAGTTCTACGGGCTCTCGGAGAATGACGAGTGGACCCAGGATAGGGCCAAACCTGTCACCCAGATCGTCAGCGCCGAGGCCTGGGGTAGAGCAGACTGTGGCTTCACCTCCGAGTCTTACCAGCAAGGGGTCCTGTCTGCCACCATCCTCTATGAGATCTTGCTAGGGAAGGCCACCTTGTATGCCGTGCTGGTCAGTGCCCTCGTGCTGATGGCCATGGTCAAGAGAAAGGATTCCAGAGGCTAG(SEQ ID NO:249)
ATGAGCATCGGCCTCCTGTGCTGTGCAGCCTTGTCTCTCCTGTGGGCAGGTCCAGTGAATGCTGGTGTCACTCAGACCCCAAAATTCCAGGTCCTGAAGACAGGACAGAGCATGACACTGCAGTGTGCCCAGGATATGAACCATGAATACATGTCCTGGTATCGACAAGACCCAGGCATGGGGCTGAGGCTGATTCATTACTCAGTTGGTGCTGGTATCACTGACCAAGGAGAAGTCCCCAATGGCTACAATGTCTCCAGATCAACCACAGAGGATTTCCCGCTCAGGCTGCTGTCGGCTGCTCCCTCCCAGACATCTGTGTACTTCTGTGCCAGCAGTTACTCTCTTTGGGACCTTCAAGAGACCCAGTACTTCGGGCCAGGCACGCGGCTCCTGGTGCTCGAGGACCTGAAAAACGTGTTCCCACCCGAGGTCGCTGTGTTTGAGCCATCAGAAGCAGAGATCTCCCACACCCAAAAGGCCACACTGGTGTGCCTGGCCACAGGCTTCTACCCCGACCACGTGGAGCTGAGCTGGTGGGTGAATGGGAAGGAGGTGCACAGTGGGGTCAGCACAGACCCGCAGCCCCTCAAGGAGCAGCCCGCCCTCAATGACTCCAGATACTGCCTGAGCAGCCGCCTGAGGGTCTCGGCCACCTTCTGGCAGAACCCCCGCAACCACTTCCGCTGTCAAGTCCAGTTCTACGGGCTCTCGGAGAATGACGAGTGGACCCAGGATAGGGCCAAACCTGTCACCCAGATCGTCAGCGCCGAGGCCTGGGGTAGAGCAGACTGTGGCTTCACCTCCGAGTCTTACCAGCAAGGGGTCCTGTCTGCCACCATCCTCTATGAGATCTTGCTAGGGAAGGCCACCTTGTATGCCGTGCTGGTCAGTGCCCTCGTGCTGATGGCCATGGTCAAGAGAAAGGATTCCAGAGGCTAG(SEQ ID NO:250)
ATGGGCACCAGCCTCCTCTGCTGGATGGCCCTGTGTCTCCTGGGGGCAGATCACGCAGATACTGGAGTCTCCCAGGACCCCAGACACAAGATCACAAAGAGGGGACAGAATGTAACTTTCAGGTGTGATCCAATTTCTGAACACAACCGCCTTTATTGGTACCGACAGACCCTGGGGCAGGGCCCAGAGTTTCTGACTTACTTCCAGAATGAAGCTCAACTAGAAAAATCAAGGCTGCTCAGTGATCGGTTCTCTGCAGAGAGGCCTAAGGGATCTTTCTCCACCTTGGAGATCCAGCGCACAGAGCAGGGGGACTCGGCCATGTATCTCTGTGCCAGCAGCTTTTCAGACGGGGGGGCTACAGATACGCAGTATTTTGGCCCAGGCACCCGGCTGACAGTGCTCGAGGACCTGAAAAACGTGTTCCCACCCGAGGTCGCTGTGTTTGAGCCATCAGAAGCAGAGATCTCCCACACCCAAAAGGCCACACTGGTGTGCCTGGCCACAGGCTTCTACCCCGACCACGTGGAGCTGAGCTGGTGGGTGAATGGGAAGGAGGTGCACAGTGGGGTCAGCACAGACCCGCAGCCCCTCAAGGAGCAGCCCGCCCTCAATGACTCCAGATACTGCCTGAGCAGCCGCCTGAGGGTCTCGGCCACCTTCTGGCAGAACCCCCGCAACCACTTCCGCTGTCAAGTCCAGTTCTACGGGCTCTCGGAGAATGACGAGTGGACCCAGGATAGGGCCAAACCTGTCACCCAGATCGTCAGCGCCGAGGCCTGGGGTAGAGCAGACTGTGGCTTCACCTCCGAGTCTTACCAGCAAGGGGTCCTGTCTGCCACCATCCTCTATGAGATCTTGCTAGGGAAGGCCACCTTGTATGCCGTGCTGGTCAGTGCCCTCGTGCTGATGGCCATGGTCAAGAGAAAGGATTCCAGAGGCTAG(SEQ ID NO:251)
ATGCTGCTGCTTCTGCTGCTTCTGGGGCCAGCAGGCTCCGGGCTTGGTGCTGTCGTCTCTCAACATCCGAGCTGGGTTATCTGTAAGAGTGGAACCTCTGTGAAGATCGAGTGCCGTTCCCTGGACTTTCAGGCCACAACTATGTTTTGGTATCGTCAGTTCCCGAAACAGAGTCTCATGCTGATGGCAACTTCCAATGAGGGCTCCAAGGCCACATACGAGCAAGGCGTCGAGAAGGACAAGTTTCTCATCAACCATGCAAGCCTGACCTTGTCCACTCTGACAGTGACCAGTGCCCATCCTGAAGACAGCAGCTTCTACATCTGCAGTGCTAGACCCCATTCTCTCACAGATACGCAGTATTTTGGCCCAGGCACCCGGCTGACAGTGCTCGAGGACCTGAAAAACGTGTTCCCACCCGAGGTCGCTGTGTTTGAGCCATCAGAAGCAGAGATCTCCCACACCCAAAAGGCCACACTGGTGTGCCTGGCCACAGGCTTCTACCCCGACCACGTGGAGCTGAGCTGGTGGGTGAATGGGAAGGAGGTGCACAGTGGGGTCAGCACAGACCCGCAGCCCCTCAAGGAGCAGCCCGCCCTCAATGACTCCAGATACTGCCTGAGCAGCCGCCTGAGGGTCTCGGCCACCTTCTGGCAGAACCCCCGCAACCACTTCCGCTGTCAAGTCCAGTTCTACGGGCTCTCGGAGAATGACGAGTGGACCCAGGATAGGGCCAAACCTGTCACCCAGATCGTCAGCGCCGAGGCCTGGGGTAGAGCAGACTGTGGCTTCACCTCCGAGTCTTACCAGCAAGGGGTCCTGTCTGCCACCATCCTCTATGAGATCTTGCTAGGGAAGGCCACCTTGTATGCCGTGCTGGTCAGTGCCCTCGTGCTGATGGCCATGGTCAAGAGAAAGGATTCCAGAGGCTAG(SEQ ID NO:252)
ATGGGCTGTAGACTGTTGTGTTGTGCTGTGCTGTGTCTGTTGGGAGCTGTGCCTATCGATACAGAGGTGACCCAGACCCCTAAACATCTGGTTATGGGCATGACCAACAAGAAGAGCCTGAAGTGCGAGCAGCACATGGGCCATAGGGCCATGTATTGGTATAAGCAGAAGGCCAAGAAACCTCCTGAGCTGATGTTCGTGTACAGCTACGAGAAGCTGAGCATCAACGAGAGCGTGCCCAGCAGATTTTCTCCTGAGTGCCCTAATTCTAGCCTGCTGAATCTGCACCTGCATGCTCTGCAGCCTGAGGATTCTGCTCTGTACCTGTGTGCTTCTTCTCAGGGCACATCTGGAGCTGATACACAGTACTTCGGACCTGGCACAAGACTGACAGTGCTGGAAGACCTGAAGAACGTGTTCCCCCCAGAGGTGGCCGTGTTCGAGCCTAGCGAGGCCGAGATCAGCCACACCCAGAAAGCCACCCTCGTGTGCCTGGCCACCGGCTTTTACCCCGACCACGTGGAACTGTCTTGGTGGGTCAACGGCAAAGAGGTGCACAGCGGCGTCTGCACCGACCCCCAGCCCCTGAAAGAGCAGCCCGCCCTGAACGACAGCCGGTACTGTCTGAGCAGCAGACTGAGAGTGTCCGCCACCTTCTGGCAGAACCCCCGGAACCACTTCAGATGCCAGGTGCAGTTCTACGGCCTGAGCGAGAACGACGAGTGGACCCAGGACCGGGCCAAGCCCGTGACCCAGATCGTGTCTGCTGAGGCCTGGGGCAGAGCCGATTGCGGCTTCACCAGCGAGAGCTACCAGCAGGGCGTGCTGAGCGCCACCATCCTGTACGAGATCCTGCTGGGCAAGGCCACCCTGTACGCCGTGCTGGTGTCCGCCCTGGTGCTGATGGCCATGGTCAAGCGGAAGGACAGCCGGGGC(SEQ ID NO:253)
ATGTCTATCGGTCTGCTGTGCTGTGCTGCTCTTTCTCTGCTTTGGGCTGGACCTGTGAATGCTGGAGTTACACAAACCCCCAAGTTCCAAGTGCTGAAGACAGGACAGAGCATGACCCTGCAGTGTGCTCAGGACATGAATCACGAGTACATGAGCTGGTACAGACAGGATCCTGGAATGGGCCTGAGGCTGATCCACTACTCTGTTGGAGCCGGAATTACAGATCAGGGAGAAGTGCCAAATGGCTACAACGTGAGCAGGAGCACAACCGAGGACTTCCCCTTAAGACTGTTGTCTGCTGCTCCATCTCAGACAAGCGTGTACTTTTGCGCCAGCTCCTACTCTCTGTGGGATCTGCAGGAAACCCAGTACTTTGGACCAGGCACAAGACTGTTAGTGCTGGAGGACCTGAAGAACGTGTTCCCCCCAGAGGTGGCCGTGTTCGAGCCTAGCGAGGCCGAGATCAGCCACACCCAGAAAGCCACCCTCGTGTGCCTGGCCACCGGCTTTTACCCCGACCACGTGGAACTGTCTTGGTGGGTCAACGGCAAAGAGGTGCACAGCGGCGTCTGCACCGACCCCCAGCCCCTGAAAGAGCAGCCCGCCCTGAACGACAGCCGGTACTGTCTGAGCAGCAGACTGAGAGTGTCCGCCACCTTCTGGCAGAACCCCCGGAACCACTTCAGATGCCAGGTGCAGTTCTACGGCCTGAGCGAGAACGACGAGTGGACCCAGGACCGGGCCAAGCCCGTGACCCAGATCGTGTCTGCTGAGGCCTGGGGCAGAGCCGATTGCGGCTTCACCAGCGAGAGCTACCAGCAGGGCGTGCTGAGCGCCACCATCCTGTACGAGATCCTGCTGGGCAAGGCCACCCTGTACGCCGTGCTGGTGTCCGCCCTGGTGCTGATGGCCATGGTCAAGCGGAAGGACAGCCGGGGC(SEQ ID NO:254)ATGGGCACATCTCTTCTCTGCTGGATGGCTCTTTGTCTGCTTGGAGCCGATCATGCCGATACAGGAGTTAGCCAGGATCCTAGACACAAGATCACCAAGAGAGGCCAGAATGTGACCTTCCGGTGCGATCCTATCTCTGAGCACAACAGGCTGTACTGGTACAGACAAACACTGGGACAAGGACCTGAGTTCCTGACCTACTTCCAGAACGAAGCCCAGCTGGAGAAGTCTAGACTTCTGAGCGACAGATTTAGCGCCGAGAGACCTAAAGGCAGCTTTAGCACCCTGGAGATCCAGAGAACAGAACAGGGCGATTCTGCCATGTACCTGTGTGCTAGCAGCTTTTCTGATGGAGGCGCCACCGATACACAGTATTTCGGACCTGGCACAAGACTGACAGTGCTGGAGGACCTGAAGAACGTGTTCCCCCCAGAGGTGGCCGTGTTCGAGCCTAGCGAGGCCGAGATCAGCCACACCCAGAAAGCCACCCTCGTGTGCCTGGCCACCGGCTTTTACCCCGACCACGTGGAACTGTCTTGGTGGGTCAACGGCAAAGAGGTGCACAGCGGCGTCTGCACCGACCCCCAGCCCCTGAAAGAGCAGCCCGCCCTGAACGACAGCCGGTACTGTCTGAGCAGCAGACTGAGAGTGTCCGCCACCTTCTGGCAGAACCCCCGGAACCACTTCAGATGCCAGGTGCAGTTCTACGGCCTGAGCGAGAACGACGAGTGGACCCAGGACCGGGCCAAGCCCGTGACCCAGATCGTGTCTGCTGAGGCCTGGGGCAGAGCCGATTGCGGCTTCACCAGCGAGAGCTACCAGCAGGGCGTGCTGAGCGCCACCATCCTGTACGAGATCCTGCTGGGCAAGGCCACCCTGTACGCCGTGCTGGTGTCCGCCCTGGTGCTGATGGCCATGGTCAAGCGGAAGGACAGCCGGGGC(SEQ ID NO:255)
ATGCTGCTTCTTCTCCTCCTTCTCGGACCTGCTGGATCTGGATTAGGAGCTGTTGTGTCTCAGCACCCTTCTTGGGTGATCTGTAAAAGCGGCACAAGCGTGAAGATCGAGTGCAGAAGCCTGGACTTTCAGGCCACAACCATGTTCTGGTATAGGCAGTTCCCCAAGCAGTCTCTGATGCTGATGGCCACCTCTAATGAGGGCTCTAAGGCCACATATGAACAGGGAGTGGAGAAGGACAAGTTCCTGATCAACCACGCCTCTCTGACCCTGTCTACCCTGACAGTTACATCTGCCCACCCTGAGGATAGCAGCTTTTACATCTGTAGCGCCAGACCTCACAGCCTGACCGATACACAGTACTTTGGCCCTGGCACAAGACTGACAGTGTTAGAAGACCTGAAGAACGTGTTCCCCCCAGAGGTGGCCGTGTTCGAGCCTAGCGAGGCCGAGATCAGCCACACCCAGAAAGCCACCCTCGTGTGCCTGGCCACCGGCTTTTACCCCGACCACGTGGAACTGTCTTGGTGGGTCAACGGCAAAGAGGTGCACAGCGGCGTCTGCACCGACCCCCAGCCCCTGAAAGAGCAGCCCGCCCTGAACGACAGCCGGTACTGTCTGAGCAGCAGACTGAGAGTGTCCGCCACCTTCTGGCAGAACCCCCGGAACCACTTCAGATGCCAGGTGCAGTTCTACGGCCTGAGCGAGAACGACGAGTGGACCCAGGACCGGGCCAAGCCCGTGACCCAGATCGTGTCTGCTGAGGCCTGGGGCAGAGCCGATTGCGGCTTCACCAGCGAGAGCTACCAGCAGGGCGTGCTGAGCGCCACCATCCTGTACGAGATCCTGCTGGGCAAGGCCACCCTGTACGCCGTGCTGGTGTCCGCCCTGGTGCTGATGGCCATGGTCAAGCGGAAGGACAGCCGGGGC(SEQ ID NO:256)
METLLGLLILWLQLQWVSSKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVKETSGSRLTFGEGTQLTVNP(SEQ ID NO:257)
MTRVSLLWAVVVSTCLESGMAQTVTQSQPEMSVQEAETVTLSCTYDTSENNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFIYPSYTSGTYKYIFGTGTRLKVLAN(SEQ ID NO:258)
MAMLLGASVLILWLQPDWVNSQQKNDDQQVKQNSPSLSVQEGRISILNCDYTNSMFDYFLWYKKYPAEGPTFLISISSIKDKNEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAASGTGGSYIPTFGRGTSLIVHPY(SEQ ID NO:259)
MAMLLGASVLILWLQPDWVNSQQKNDDQQVKQNSPSLSVQEGRISILNCDYTNSMFDYFLWYKKYPAEGPTFLISISSIKDKNEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAASGIGDYKLSFGAGTTVTVRAN(SEQ ID NO:260)
MVKIRQFLLAILWLQLSCVSAAKNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRTSYDKVIFGPGTSLSVIPN(SEQ ID NO:261)
MKSLRVLLVILWLQLSWVWSQQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNLLGATGYSTLTFGKGTMLLVSP(SEQ ID NO:262)
MWGVFLLYVSMKMGGTTGQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVRGINDYKLSFGAGTTVTVRAN(SEQ ID NO:263)
MEKMLECAFIVLWLQLGWLSGEDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVITGFQKLVFGTGTRLLVSPN(SEQ ID NO:264)
MRLVARVTVFLTFGTIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIAGVGRGQNFVFGPGTRLSVLPY(SEQ ID NO:265)
MEKNPLAAPLLILWFHLDCVSSILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAFHPNFGNEKLTFGTGTRLTIIPN(SEQ ID NO:266)
MEKMLECAFIVLWLQLGWLSGEDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQPRGDGSSNTGKLIFGQGTTLQVKP(SEQ ID NO:267)
IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:268)
MGTSLLCWVVLGFLGTDHTGAGVSQSPRYKVTKRGQDVALRCDPISGHVSLYWYRQALGQGPEFLTYFNYEAQQDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSLTGSYEQYFGPGTRLTVTE(SEQ ID NO:269)
MLLLLLLLGPAGSGLGAVVSQHPSWVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSATPEASSPYEQYFGPGTRLTVTE(SEQ ID NO:270)
MGPGLLHWMALCLLGTGHGDAMVIQNPRYQVTQFGKPVTLSCSQTLNHNVMYWYQQKSSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLGDAAMYLCATSNLQGRQPQHFGDGTRLSILE(SEQ ID NO:271)
MLSPDLPDSAWNTRLLCHVMLCLLGAVSVAAGVIQSPRHLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSLRLGRETQYFGPGTRLLVLE(SEQ ID NO:272)
MGTRLLCWVVLGFLGTDHTGAGVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSLGQAYEQYFGPGTRLTVTE(SEQ ID NO:273)
MGTRLLCWVAFCLLVEELIEAGVVQSPRYKIIEKKQPVAFWCNPISGHNTLYWYLQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSLTRGAEAFFGQGTRLTVVE(SEQ ID NO:274)
MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSRDREQESPLHFGNGTRLTVTE(SEQ ID NO:275)
MGPQLLGYVVLCLLGAGPLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSMNVEVTDKGDVPEGYKVSRKEKRNFPLILESPSPNQTSLYFCASSFSGGTYEQYFGPGTRLTVTE(SEQ ID NO:276)
MLSPDLPDSAWNTRLLCHVMLCLLGAVSVAAGVIQSPRHLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSYRGGSTYEQYFGPGTRLTVTE(SEQ ID NO:277)
MSTRLLCWMALCLLGAELSEAEVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVQFQDESVVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAMYLCASSQRDSPNEKLFFGSGTQLSVLE(SEQ ID NO:278)
MGCRLLCCAVLCLLGAVPMETGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQDPYKLSGNTIYFGEGSWLTVVE(SEQ ID NO:279)
DLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF(SEQ ID NO:280)
DLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG(SEQ ID NO:281)
MKSLRVLLVILWLQLSWVWSQQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNIGNHDMRFGAGTRLTVKPN(SEQ ID NO:282)
MEKMLECAFIVLWLQLGWLSGEDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQTMDGNQFYFGTGTSLTVIPN(SEQ ID NO:283)
MACPGFLWALVISTCLEFSMAQTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCASSPGTYKYIFGTGTRLKVLAN(SEQ ID NO:284)
MTRVSLLWAVVVSTCLESGMAQTVTQSQPEMSVQEAETVTLSCTYDTSESNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFNPWENYGQNFVFGPGTRLSVLPY(SEQ ID NO:285)
IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS(SEQ ID NO:286)
MGCRLLCCAVLCLLGAVPIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLCASSQGTSGADTQYFGPGTRLTVLE(SEQ ID NO:287)
MSIGLLCCAALSLLWAGPVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSYSLWDLQETQYFGPGTRLLVLE(SEQ ID NO:288)
MGTSLLCWMALCLLGADHADTGVSQDPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSFSDGGATDTQYFGPGTRLTVLE(SEQ ID NO:289)
MLLLLLLLGPAGSGLGAVVSQHPSWVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSARPHSLTDTQYFGPGTRLTVLE(SEQ ID NO:290)
DLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG(SEQ ID NO:291)
In some embodiments, the TCR construct comprises a Human Papillomavirus (HPV) -specific TCR chain. In some embodiments, the TCR construct comprising an HPV-specific TCR chain comprises TCR a and TCR β chains that target HPV 18E6 protein and/or HPV 18E7 protein. In some embodiments, the HPV 18E6 epitope is amino acids 121-135 and/or amino acids 77-91 of the HPV 18E6 protein. In some embodiments, the TCR construct comprising an HPV-specific TCR chain comprises TCR a and TCR β chains that target HPV 18E7 protein. In some embodiments, the HPV 18E7 epitope is amino acids 11-19. In some embodiments, HPV-specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in international patent application publication WO 2015/009604A1, which is incorporated herein by reference for the purposes described herein.
NK cells
NK cells modified to express the TCR/CD3 receptor complex may be obtained from any suitable source, including fresh or frozen. In certain embodiments, the NK cells are derived from human Peripheral Blood Mononuclear Cells (PBMCs), unstimulated leukocyte isolation Products (PBSCs), NK cell lines (e.g., NK-92), human embryonic stem cells (hescs), induced pluripotent stem cells (ipscs), bone marrow, or umbilical cord blood by methods well known in the art. Specifically, NK cells may be isolated from umbilical Cord Blood (CB), peripheral Blood (PB), bone marrow, stem cells, NK cell lines, or mixtures thereof. In certain embodiments, NK cells are isolated from the pooled CBs. CBs may be consolidated from 2, 3,4, 5, 6, 7, 8, 9, 10 or more units. NK cells may be autologous or allogeneic to the recipient individual. The isolated NK cells may or may not match the subject haplotype to which the cell therapy is to be administered. For example, NK cells can be detected by specific surface markers, such as CD16 and CD56 in humans. In some cases, the source of NK cells is cord blood, where NK cells may be present in the cord blood in the form of a heterogeneous mixture of cells, and may deplete certain CD3 expressing cells. In other methods, umbilical cord CB is used to derive NK cells by isolating cd34+ cells.
NK cells may be pre-activated with one or more inflammatory cytokines, which may or may not be amplified. In certain cases, NK cells are pre-activated prior to modification to express the cd3±tcr or after modification to express the cd3±tcr complex. In particular embodiments, pre-activation of NK cells may include culturing the isolated NK cells in the presence of one or more cytokines. NK cells can be stimulated with IL-2 or other cytokines that bind to the common gamma chain (e.g. IL-7, IL-12, IL-15, IL-18, IL-21, etc.). In particular embodiments, the preactivated cytokine may be selected from the group consisting of IL-12, IL-15, IL-18, and combinations thereof. One or more additional cytokines may be used in the pre-activation step. The pre-activation may be for a short period of time, for example 5-72 hours, for example 10-50 hours, in particular 10-20 hours, for example 12, 13, 14, 15, 16, 17, 18, 19 or 20 hours, in particular about 16 hours. The pre-activation culture may comprise IL-12 at a concentration of 0.1-150ng/mL, for example at a concentration of 0.5-50ng/mL, especially 1-20ng/mL, for example 2, 3, 4,5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15ng/mL, especially about 10ng/mL. The pre-activation culture may comprise IL-18 and/or IL-15 in a concentration of 10-100ng/mL, for example in a concentration of 40-60ng/mL, in particular 45, 46, 47, 48, 49, 50, 51, 52, 53, 54 or 55ng/mL, in particular about 50ng/mL.
In certain instances, NK cells are expanded prior to modification to express the cd3±tcr complex or after modification to express the cd3±tcr complex. The pre-activated NK cells can be expanded in the presence of artificial antigen presenting cells (aAPCs). The pre-activated NK cells may be washed, for example 2, 3,4 or 5 times, in particular 3 times, prior to expansion. aapcs may be engineered to express CD137 ligands and/or membrane-bound cytokines. The membrane-bound cytokine may be membrane-bound IL-21 (mIL-21) or membrane-bound IL-15 (mIL-15). In particular embodiments, aapcs are engineered to express CD137 ligands and mll-21. aapcs may be derived from cancer cells, such as leukemia cells. aapcs may not express endogenous HLA class I, class II or CD1d molecules. They may express ICAM-1 (CD 54) and LFA-3 (CD 58). In particular, aapcs may be K562 cells, e.g., K562 cells engineered to express CD137 ligand and mll-21. aapcs may be subjected to radiation. Engineering can be performed by any method known in the art, such as retroviral transduction. The amplification may last for about 2-30 days, such as 3-20 days, particularly 12-16 days, such as 12, 13, 14, 15, 16, 17, 18 or 19 days, particularly about 14 days. The pre-activated NK cells and aAPCs may be present in a ratio of about 3:1-1:3, e.g. 2:1, 1:1, 1:2, especially about 1:2. The amplification culture may further comprise a cytokine that promotes amplification, such as IL-2.IL-2 may be present at a concentration of about 10-500U/mL, for example 100-300U/mL, particularly about 200U/mL. IL-2 may be supplemented in the amplification culture, for example, once every 2-3 days. aapcs may be added to the culture at least a second time, for example about 7 days of expansion.
In particular embodiments, NK cells are transfected or transduced with one or more membrane bound cytokines, including IL-21, IL-12, IL-18, IL-23, IL-7, or IL-15, which are secreted by NK cells or tethered to NK cell membranes. In this case, the membrane bound cytokine may be tethered to the NK cell membrane with a specific transmembrane domain, such as the transmembrane domain of CD8, CD28, CD27, B7H3, igG1, igG4, CD4, DAP10, DAP 12.
After preparation, the modified NK cells (including an effective amount of one or more bispecific or multispecific antibodies) may be infused immediately, or the NK cells may be stored, e.g., by cryopreservation. In certain aspects, cells may be propagated ex vivo as a large population for days, weeks, or months within about 1, 2, 3,4, or 5 days.
III. heterologous proteins
In particular embodiments, the NK cells are modified not only to express one or more components of the TCR/CD3 complex, but also to express one or more other heterologous proteins. The heterologous proteins may promote the activity of NK cells in any way, including at least their activation, persistence, amplification, homing and/or cytotoxicity.
A. bispecific or multispecific antibodies
In some embodiments, NK cells are modified to express one or more bispecific or multispecific antibodies, although in other cases NK cells do not express antibodies, antibodies are used with NK cells.
In the case where NK cells are modified to express antibodies, the antibodies may be conjugation molecules that bridge specific immune effector cells with specific target cells to disrupt the target cells. The present invention allows modified NK cells to be used with standard T cell binding molecules (BiTEs) because they have been modified to express CD3, in many cases CD3 is a T cell antigen that binds to a BiTE binding molecule. In this case, the BiTE used in the present invention may also target cancer antigens or viral antigens, which may be tailored to the medical condition of the intended recipient individual. For example, biTE can be tailored to bind to cancer antigens specific to cancer cells of an individual's cancer. anti-CD 3 antibodies to BiTE may target the cd3γ chain, the cd3δ chain, the cd3ε chain, or the cd3ζ chain.
In some cases, in addition to expressing a CD3 complex (with or without TCR) that allows NK cells to be used as a treatment with BiTE, NK cells may be modified to express (or not express) one or more bispecific NK engagement molecules (bikes) but be used with one or more bispecific NK engagement molecules (bikes). The BiKE comprises antibodies that bind to NK cell surface proteins, including those naturally expressed on NK cells, and antibodies that bind to the desired target antigen. The BiKE may target NK cells by antibodies against NK surface proteins (e.g. CD16, CS1, CD56, NKG2D, NKG2C, DNAM, 2B4, CD2, NCR or KIR). In this case, the bipes used in the present invention may also target cancer antigens or viral antigens, which may be tailored to the medical condition of the intended recipient individual. For example, the BiKE may be tailored to bind to a cancer cell-specific cancer antigen of an individual's cancer.
In embodiments where NK cells express a CD3 complex (with or without TCR) and one or more bikes, one or more vectors may be used to transfect or transduce cells with the components of the CD3 complex (with or without TCR) and one or more bikes. In some cases, one or more of the CD3 complex component (with or without TCR) and the BiKE may or may not be on the same polycistronic vector.
B. Engineered receptors
In particular embodiments, NK cells are engineered to express one or more engineered receptors. In some cases, the engineered receptor is an engineered antigen receptor that targets any type of cancer antigen or viral antigen. Receptors can be tailored to target a desired antigen according to the medical condition of the intended recipient individual.
In some embodiments, the engineered antigen receptor is a Chimeric Antigen Receptor (CAR). NK cells may be modified to encode at least one CAR, and the CAR may be, for example, a first generation, a second generation, or a third or subsequent generation. The CAR may or may not have dual specificity for two or more different antigens. The CAR may comprise one or more co-stimulatory domains. Each co-stimulatory domain may comprise, for example, a co-stimulatory domain of any one or more of the members CD28、CD137(4-1BB)、CD134(OX40)、DAP10、DAP12、CD27、CD2、CD5、ICAM-1、LFA-1(CD11a/CD18)、Lck、TNFR-I、TNFR-II、Fas、CD30、CD27、NKG2D、2B4M、CD40 of the TNFR superfamily or a combination thereof. In a particular embodiment, the CAR comprises cd3ζ. In certain embodiments, the CAR lacks one or more specific co-stimulatory domains; for example, the CAR may lack 4-1BB and/or CD28.
In certain embodiments, the CAR polypeptide in the cell comprises an extracellular spacer domain that connects the antigen binding domain and the transmembrane domain, which may be referred to as a hinge. The extracellular spacer domain may include, but is not limited to, an Fc fragment of an antibody or fragment or derivative thereof, a hinge region of an antibody or fragment or derivative thereof, a CH2 region of an antibody, a CH3 region antibody, an artificial spacer sequence, or a combination thereof. Examples of extracellular spacer domains include, but are not limited to, CD 8-alpha hinge, CD28, artificial spacers made of polypeptides such as Gly3, or CH1, CH3 domains of IgG (e.g., human IgG1 or IgG 4). In particular cases, the extracellular spacer domain may comprise: (i) the hinge, CH2 and CH3 regions of IgG4, (ii) the hinge region of IgG4, (iii) the hinge and CH2 of IgG4, (iv) the hinge region of CD 8a or CD4, (v) the hinge, CH2 and CH3 regions of IgG1, (vi) the hinge region of IgG1 or (vii) the hinge and CH2 of IgG1, (viii) the hinge region of CD28, or a combination thereof. In particular embodiments, the hinge is from IgG1, and in certain aspects, the CAR polypeptide comprises or is encoded by a particular IgG1 hinge amino acid sequence.
The transmembrane domain in the CAR may be from a natural or synthetic source. If the source is natural, the domain is in some way derived from any membrane-bound or transmembrane protein. The transmembrane region includes a transmembrane region derived from (i.e., comprising at least) the following transmembrane regions: an alpha, beta, or zeta chain ,CD28,CD3ζ,CD3ε,CD3γ,CD3δ,CD45,CD4,CD5,CD8,CD9,CD16,CD22,CD33,CD37,CD64,CD80,CD86,CD134,CD137,CD154,ICOS/CD278,GITR/CD357,NKG2D of a T cell receptor and a DAP molecule (e.g., DAP10 or DAP 12). Alternatively, in some embodiments, the transmembrane domain is synthetic. In some aspects, the synthetic transmembrane domain comprises predominantly hydrophobic residues, such as leucine and valine. In some aspects, triplets of phenylalanine, tryptophan, and valine can be found at each end of the synthetic transmembrane domain.
In some embodiments, the engineered receptors utilize one or more homing receptors (which can home to the target, not necessarily because of signal release, e.g., where they utilize an adhesion molecule) and/or one or more chemokine receptors. Examples of chemokine receptors include CXC chemokine receptors, CC chemokine receptors, CX3C chemokine receptors, and XC chemokine receptors. In particular instances, the chemokine receptor is a receptor for CCR2, CCR3, CCR5, CCR8, CCR7, CXCR3, L-selectin (CD 62L) CXCR1, CXCR2, or CX3CR 1.
C. Cytokines and methods of use
In some embodiments, NK cell expressing cells are engineered to express one or more heterologous cytokines and/or are engineered to up-regulate normal expression of one or more heterologous cytokines. The cells may or may not transduce or transfect one or more cytokines on the same vector as the other genes.
One or more cytokines may be co-expressed from the vector, including the isolated polypeptide as any component from the TCR/CD3 complex. For example, interleukin-15 (IL-15) is tissue restricted and can only be observed at any level in serum or throughout the body under pathological conditions. IL-15 has several properties that are required for adoptive therapy. IL-15 is a homeostatic cytokine that induces natural killer cell development and cell proliferation, promotes eradication of established tumors by alleviating functional inhibition of tumor resident cells, and inhibits activation-induced cell death (AICD). In addition to IL-15, other cytokines are also contemplated. These include, but are not limited to, cytokines, chemokines, and other molecules that contribute to the activation and proliferation of cells for human use. NK cells expressing IL-15 are able to sustain cytokine signaling, which is useful for their survival after infusion.
In certain embodiments, the cells express one or more exogenously supplied cytokines. As one example, the cytokine is IL-15, IL-12, IL-2, IL-18, IL-21, IL-23, GMCSF, or a combination thereof. Cytokines can be supplied exogenously to NK cells because they are expressed from intracellular expression vectors. In another case, endogenous cytokines in the cell are up-regulated upon manipulation of the regulation of expression of the endogenous cytokines, such as gene recombination at the promoter site of the cytokine. Where the cytokine is provided to the cell on an expression construct, the cytokine may be encoded by the same vector as one or more components of the CD3 complex (with or without the TCR complex).
In some embodiments, specific sequences of IL-15 are used, such as the following sequences (underlined refers to signal peptide sequences):
D. Antigens
The modified NK cells of the invention are used with bispecific or multispecific antibodies that target one or more specific antigens. In addition, NK cells can be modified with engineered antigen receptors that target one or more specific antigens. Where NK cells are modified with one or more engineered antigen receptors, the antigen targeted by the bispecific or multispecific antibody and the antigen targeted by the one or more engineered antigen receptors may or may not be the same antigen. In some cases, the antigen targeted by the bispecific or multispecific antibody and the antigen targeted by the one or more engineered antigen receptors are different antigens, but are associated with the same type of cancer.
An antigen targeted by an antibody and/or engineered antigen receptor is an antigen expressed in the context of a disease, condition, or cell type targeted by adoptive cell therapy. These diseases and conditions are proliferative, neoplastic and malignant diseases and disorders, including cancers and tumors, including cancers of the blood, immune system, such as lymphomas, leukemias and/or myelomas, such as B, T and myelogenous leukemias, lymphomas and multiple myelomas. In some embodiments, the antigen is selectively expressed or over-expressed on cells of a disease or condition (e.g., tumor or pathogenic cells) as compared to normal or non-targeted cells or tissues. In other embodiments, the antigen is expressed on normal cells and/or on engineered cells.
Any suitable antigen may be targeted in the present method. In some cases, the antigen may be associated with certain cancer cells, but not non-cancer cells. Exemplary antigens include, but are not limited to, antigenic molecules from infectious agents, self/self antigens, tumor/cancer associated antigens, and tumor neoantigens (LINNEMANN et al 2015). In a particular aspect, the antigen comprises: NY-ESO, CD19, EBNA, CD123, HER2, CA-125, TRAIL/DR4, CD20, CD22, CD70, CD38, CD123, CLL1, carcinoembryonic antigen, alpha fetoprotein, CD56, AKT, her3, epithelial tumor antigen, CD319 (CS 1), ROR1, folate binding protein, HIV-1 envelope glycoprotein gp120, HIV-1 envelope glycoprotein gp41, CD5, CD23, CD30, HERV-K, IL-11Rα, kappa chain, lambda chain, CSPG4, CD33, CD47, CLL-1, U5snRNP200, CD200, BAFF-R, BCMA, CD99, P53, mutated P53, ras, C-Myc, cytoplasmic serine/threonine kinases (e.g., A-Raf, B-Raf and C-Raf, cyclin dependent kinase), MAGE-A1, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A6, MAGE-A10, MAGE-A12, MART-1, melanoma-associated antigen, BAGE, DAM-6, -10, GAGE-1, -2, -8, GAGE-3, -4, -5, -6, -7B, NA88-A, MC1R, mda-7, gp75, gp100, PSA, PSM, tyrosinase-related protein, TRP-1, TRP-2, ART-4, CAMEL, CEA, cyp-B, hTERT, hTRT, iCE, MUC, MUC2, phosphatidylinositol 3-kinase (PI 3K), TRK receptor, PRAME, P15, RU1, RU2, SART-1, SART-3, wilms tumor antigen (WT 1), AFP, -cycloprotein/M, caspase-8/M, CDK-4/M, ELF-2, gv-Gv, g250, HAGE, HSP70-2M, HST-2, KIAA0205, MUM-1, MUM-2, MUM-3, myoglobin/m, RAGE, SART-2, TRP-2/INT2, 707-AP, annexin II, CDC27/m, TPI/mbcr-ABL, BCR-ABL, interferon regulator 4 (IRF 4), ETV6/AML, LDLR/FUT, pml/RAR, tumor-associated calcium signal transducer 1 (TACSTD 1) TACSTD2, receptor tyrosine kinases (e.g., epidermal Growth Factor Receptor (EGFR) (particularly EGFRvIII), platelet-derived growth factor receptor (PDGFR), vascular Endothelial Growth Factor Receptor (VEGFR)), VEGFR2, cytoplasmic tyrosine kinases (e.g., src family, syk-ZAP70 family), integrin-linked kinase (ILK), signal transducer and transcriptional activators STAT3, STATS and STATE, hypoxia-inducible factors (e.g., HIF-1 and HIF-2), nuclear factor κB (NF-B), notch receptors (e.g., notch 1-4), NY ESO 1, c-Met, mammalian target of rapamycin (mTOR), WNT, extracellular signal-regulated kinase (ERK) and its regulatory subunits, PMSA, PR-3, MDM2, mesothelin, renal cell carcinoma-5T 4, SM22α, carbonic Anhydrase I (CAI) and IX (CAIX) (also known as G250), STEAD, TEL/AML1, GD2, protease 3, hTERT, sarcoma translocation breakpoint, ephA2, ML-IAP, epCAM, ERG (TMPRSS 2 ETS fusion gene), NA17, PAX3, ALK, androgen receptor, cyclin B1, polysialic acid, MYCN, rhoC, GD3, fucose GM1, mesothelium (mesothelian), PSCA, sLe, PLAC1, GM3, BORIS, tn, GLoboH, NY-BR-1, RGS, SAGE, SART3, STn, PAX5, OY-TES1, sperm protein 17, LCK, HMWMAA, AKAP-4, SSX2, XAGE 1, B7H3, legumain, TIE2, page4, MAD-CT-1, FAP, MAD-CT-2, fos-related antigen 1, CBX2, CLDN6, SPANX, TPTE, ACTL8, ANKRD30A, CDKRD2A, MAD2L1, CTA, G1B, SUNC1 and LRR 1. Examples of sequences of antigens are known in the art, e.g. inIn the database: CD19 (accession number NG_ 007275.1), EBNA (accession number NG_ 002392.2), WT1 (accession number NG_ 009272.1), CD123 (accession number NC_ 000023.11), NY-ESO (accession number NC_ 000023.11), EGFRvIII (accession number NG_ 007726.3), MUC1 (accession number NG_ 029383.1), HER2 (accession number NG_ 007503.1), CA-125 (accession number NG_ 055257.1), WT1 (accession number NG_ 009272.1), mage-A3 (accession number NG_ 013244.1), mage-A4 (accession number NG_ 013245.1), mage-A10 (accession number NC_ 000023.11), TRAIL/DR4 (accession number NC_ 000003.12) and/or CEA (accession number NC_ 000019.10).
Tumor-associated antigens may be derived from the following cancers: prostate cancer, breast cancer, colorectal cancer, lung cancer, pancreatic cancer, renal cancer, mesothelioma, ovarian cancer, liver cancer, brain cancer, bone cancer, stomach cancer, spleen cancer, testicular cancer, cervical cancer, anal cancer, gall bladder cancer, thyroid cancer or melanoma cancer. Exemplary tumor-associated antigens or antigens derived from tumor cells include MAGE 1,3 and MAGE 4 (or other MAGE antigens such as those disclosed in international patent publication No. WO 99/40188); PRAME; BAGE; RAGE, lange (also known as NY ESO 1); SAGE; and HAGE or GAGE. Non-limiting examples of these tumor antigens are expressed in a variety of tumor types, such as melanoma, lung cancer, sarcoma, and bladder cancer. See, for example, U.S. patent No. 6,544,518. Tumor-associated antigens for prostate cancer include, for example, prostate Specific Membrane Antigen (PSMA), prostate Specific Antigen (PSA), prostate phosphate, NKX3.1, and prostate hexatransmembrane epithelial antigen (STEAP).
Other tumor associated antigens include Plu-1, HASH-1, hasH-2, cripto, and Criptin. In addition, the tumor antigen may be a self-peptide hormone, such as full length gonadotropin releasing hormone (GnRH), wie a short 10 amino acid long peptide, useful in the treatment of many cancers.
Antigens may include epitope regions or peptides derived from genes mutated in tumor cells or from genes transcribed at different levels in tumor cells compared to normal cells, such as telomerase, survivin, mesothelin, mutated ras, bcr/abl rearrangements, her2/neu, mutated or wild-type P53, cytochrome P450 1B1 and abnormally expressed intron sequences, such as N-acetylglucosaminyl transferase-V; clonal rearrangement of immunoglobulin genes produces unique idiotypes in myeloma and B-cell lymphoma; tumor antigens including epitope regions or peptides derived from oncoviral processes, such as human papilloma virus proteins E6 and E7; epstein barr virus protein LMP2; non-mutated carcinoembryonic proteins, such as carcinoembryonic antigen and alpha fetoprotein, with tumor selective expression.
E. Suicide gene
In particular embodiments, suicide genes are used with NK cell therapies to control their use and allow termination of cell therapies at a desired event and/or time. Suicide genes are used in transduced cells in order to trigger death of the transduced cells when desired. The cells of the invention are modified to contain one or more vectors encompassed by the invention, which may contain one or more suicide genes. In some embodiments, the term "suicide gene" as used herein is defined as a gene that affects the conversion of a gene product to a compound that kills its host cell upon administration of a prodrug or other agent. In other embodiments, the suicide gene encodes a gene product that is targeted, when desired, by an agent (e.g., an antibody) that targets the suicide gene product.
In some cases, when an individual who is receiving and/or has received cell therapy exhibits one or more symptoms of one or more adverse events (e.g., cytokine release syndrome, neurotoxicity, allergic reaction/allergy, and/or toxicity to/off-target tumors (for example)), or is deemed at risk of one or more symptoms (including upcoming symptoms), the cell therapy may employ any variety of one or more suicide genes. The use of suicide genes may be part of the planned treatment regimen or may be used only under recognized use requirements. In some cases, cell therapy is terminated by using agents that target suicide genes or gene products thereof, as therapy is no longer needed.
Application of suicide genes may be initiated upon occurrence of at least one adverse event on an individual and the adverse event may be identified by any means, including routine monitoring that may or may not be continuous from the beginning of cellular therapy. Adverse events may be detected during inspection and/or testing. In the case of an individual suffering from a cytokine release syndrome (also known as a cytokine storm), the individual may have, for example, elevated inflammatory cytokines (by way of example only: interferon gamma, granulocyte macrophage colony stimulating factor, IL-10, IL-6 and TNF-alpha); fever; fatigue; hypotension; hypoxia, tachycardia; nausea; capillary leakage; heart/kidney/liver dysfunction; or a combination thereof. In cases where the individual has neurotoxicity, the individual may suffer from confusion, delirium, hypoplasia and/or epilepsy. In some cases, the individual is tested for markers associated with the onset and/or severity of cytokine release syndrome, such as C-reactive protein, IL-6, TNF- α, and/or ferritin.
Examples of suicide genes include engineered non-secreted (including membrane-bound) Tumor Necrosis Factor (TNF) -alpha mutant polypeptides (see PCT/US19/62009, incorporated herein by reference in its entirety), and they may be affected by the delivery of antibodies that bind TNF-alpha mutants. Examples of suicide gene/prodrug combinations that may be used are herpes simplex virus thymidine kinase (HSV-tk) and ganciclovir, acyclovir or FIAU; oxidoreductases and cycloheximides; cytosine deaminase and 5-fluorocytosine; thymidine kinase thymidylate kinase (Tdk:: tmk) and AZT; and deoxycytidine kinase and cytosine arabinoside. Coli (e.coli) purine nucleoside phosphorylase, a so-called suicide gene, can be used to convert the prodrug 6-methylpurine deoxyribose to the toxic purine 6-methylpurine. Other suicide genes include, for example, CD20, CD52, inducible caspase 9, purine Nucleoside Phosphorylase (PNP), cytochrome p450 enzyme (CYP), carboxypeptidase (CP), carboxylesterase (CE), nitroreductase (NTR), guanine ribosyltransferase (XGRTP), glycosidase, methionine- α, γ -lyase (MET), EGFRv3, and Thymidine Phosphorylase (TP).
Administering a therapeutic composition
Administering to an individual in need thereof a CD3 expressing NK cell and a bispecific or multispecific antibody, including in a manner that enables the anti-CD 3 antibody of the bispecific or multispecific antibody to bind to CD3 on the CD3 expressing NK cell. In some cases, the two components are administered separately to the individual, while in other cases, the two components are compounded together prior to administration, e.g., in an ex vivo manner. In another embodiment, the NK cells express the antibody. In some cases, the two components are not pre-compounded prior to administration, but are co-administered by any suitable route of administration, for example, by co-infusion to a patient.
Embodiments of the present invention relate to methods of treating or preventing a medical disease or disorder using compositions comprising NK cells and antibodies provided herein. The method comprises administering to the subject a therapeutically effective amount of CD3 (±tcr) modified NK cells and antibodies, thereby treating or preventing a disease in the subject, including reducing the risk of the disease, reducing the severity of the disease, and/or delaying the onset of the disease. In certain embodiments of the invention, the cancer or infection is treated by transferring a composition comprising a population of NK cells and the corresponding antibody. In at least some cases, NK cells can reverse the anti-inflammatory tumor microenvironment and increase the adaptive immune response by promoting differentiation, activation and/or recruitment of helper immune cells to the malignant tumor site as they release pro-inflammatory cytokines.
Cancers for which the present treatment methods can be used include any malignant cell type, such as those found in solid tumors or hematological tumors. Exemplary solid tumors may include, but are not limited to, tumors of an organ selected from the group consisting of pancreas, colon, cecum, stomach, brain, head, neck, ovary, kidney, larynx, sarcoma, lung, bladder, melanoma, prostate, and breast. Exemplary hematological tumors include bone marrow tumors, T-cell or B-cell malignancies, leukemia, lymphoma, blastoma, myeloma, and the like. Other examples of cancers that may be treated using the methods provided herein include, but are not limited to, lung cancer (including small cell lung cancer, non-small cell lung cancer, lung adenocarcinoma, and lung squamous carcinoma), peritoneal cancer, stomach cancer or gastric cancer (including gastrointestinal cancer and gastrointestinal stromal cancer), pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, breast cancer, colon cancer, colorectal cancer, endometrial cancer or uterine cancer, salivary gland cancer, renal cancer or renal cancer, prostate cancer, vulval cancer, thyroid cancer, various head and neck cancers, and melanoma.
The cancer may be of the following histological type in particular, although it is not limited to these: tumors, malignant; cancer; cancer, undifferentiated; giant cell carcinoma and spindle cell carcinoma; small cell carcinoma; papillary carcinoma; squamous cell carcinoma; lymphatic epithelial cancer; basal cell carcinoma; hair matrix cancer; transitional cell carcinoma; papillary transitional cell carcinoma; adenocarcinomas; gastrinomas, malignant; bile duct cancer; hepatocellular carcinoma; mixed hepatocellular carcinoma and cholangiocarcinoma; liang Xianai smaller; adenoid cystic carcinoma; adenocarcinomas among adenomatous polyps; adenocarcinomas, familial polyposis; solid cancer; carcinoid, malignant; bronchoalveolar adenocarcinoma; papillary adenocarcinoma; chromophobe cell cancer; eosinophilic cancer; eosinophilic adenocarcinoma; basophilic granulocyte cancer; clear cell adenocarcinoma; granulosa cell carcinoma; follicular adenocarcinoma; papillary and follicular adenocarcinomas; non-enveloped sclerotic cancers; adrenal cortex cancer; endometrial-like cancer; skin accessory cancer; apocrine adenocarcinoma; sebaceous gland cancer; cervical adenocarcinoma; epidermoid carcinoma of mucous; cystic adenocarcinoma; papillary cyst adenocarcinoma; papillary serous cystic adenocarcinoma; mucinous cystic adenocarcinoma; mucinous adenocarcinoma; printing ring cell carcinoma; invasive ductal carcinoma; medullary carcinoma; lobular carcinoma; inflammatory cancer; paget's disease, mammary gland; acinar cell carcinoma; adenosquamous carcinoma; adenocarcinomas are accompanied by squamous metaplasia; thymoma, malignant; ovarian stromal tumor, malignancy; follicular carcinoma, malignant; granulocytoma, malignant; androgenic blastoma, malignant; celetoly cell carcinoma; testicular stromal cell tumor, malignant; lipid cell neoplasms, malignant; paraganglioma, malignant; extramammary paraganglioma, malignant; pheochromocytoma; glomerular sarcoma; malignant melanoma; no melanin melanoma; superficial diffuse melanoma; malignant nevus malachite melanoma; lentigo acromioclavis melanoma; nodular melanoma; malignant melanoma in giant pigmented nevi; epithelioid cell melanoma; blue nevi, malignant; sarcoma; fibrosarcoma; malignant fibrous histiocytoma; myxosarcoma; liposarcoma; leiomyosarcoma; rhabdomyosarcoma; embryo rhabdomyosarcoma; alveolar rhabdomyosarcoma; interstitial sarcoma; mixed tumor, malignant; miaole tube mixed tumor; nephroblastoma; hepatoblastoma; carcinoma sarcoma; a mesenchymal neoplasm, malignancy; boehringer's tumor, malignant; phylliform tumor, malignant; synovial sarcoma; mesothelioma, malignant; a vegetative cell tumor; embryo cancer; teratoma, malignant; ovarian goiter, malignancy; choriocarcinoma; mesonephroma, malignancy; hemangiosarcoma; vascular endothelial tumor, malignant; kaposi's sarcoma; vascular epidermocytoma, malignant; lymphangiosarcoma; osteosarcoma; a cortical bone sarcoma; chondrosarcoma; chondroblastoma, malignant; mesenchymal chondrosarcoma; bone giant cell tumor; ewing's sarcoma; odontogenic tumors, malignancy; ameloblastic osteosarcoma; enameloblastoma, malignant; ameloblastic fibrosarcoma; pineal tumor, malignancy; chordoma; glioma, malignant; ventricular tube membranoma; astrocytoma; plasmacytoma; fibroastrocytoma; astrocytoma; glioblastoma; oligodendroglioma; oligodendroglioma; primitive neuroectoderm; cerebellar sarcoma; ganglion neuroblastoma; neuroblastoma; retinoblastoma; an olfactory neurogenic tumor; meningioma, malignancy; neurofibrosarcoma; schwannoma, malignancy; granulocytoma, malignant; malignant lymphoma; hodgkin's disease; hodgkin's; granuloma parades; malignant lymphoma, small lymphocytes; malignant lymphoma, large cell, diffuse; malignant lymphoma, follicular; mycosis fungoides; other specific non-hodgkin lymphomas; b cell lymphoma; low grade/follicular non-hodgkin lymphoma (NHL); small Lymphocytes (SL) NHL; intermediate grade/follicular NHL; medium grade diffuse NHL; advanced immunoblastic NHL; higher lymphoblastic NHL; advanced small non-nucleated cells NHL; large mass NHL; mantle cell lymphoma; AIDS-related lymphoma; primary macroglobulinemia; malignant histiocytosis; multiple myeloma; mast cell sarcoma; immunoproliferative small intestine disease; leukemia; lymphocytic leukemia; plasma cell leukemia; erythroleukemia; lymphosarcoma cell leukemia; myeloid leukemia; basophilic granulocytic leukemia; eosinophilic leukemia; monocytic leukemia; mast cell leukemia; megakaryocyte leukemia; myeloid sarcoma; hairy cell leukemia; chronic Lymphocytic Leukemia (CLL); acute Lymphoblastic Leukemia (ALL); acute Myelogenous Leukemia (AML); and chronic myeloid leukemia.
The therapies provided herein can include administration of a combination of therapeutic agents, e.g., a first cancer therapy and a second cancer therapy. These therapies may be administered in any suitable manner known in the art. For example, the first and second cancer treatments may be administered sequentially (at different times) or simultaneously (at the same time). In some embodiments, the first and second cancer treatments are administered as separate compositions. In some embodiments, the first and second cancer treatments are in the same composition. Embodiments of the present invention relate to compositions and methods comprising therapeutic compositions. The different therapies may be administered in one composition or more than one composition, for example in 2 compositions, 3 compositions or 4 compositions. Various combinations of agents may be used. Examples of therapies other than the present invention include surgery, chemotherapy, drug therapy, radiation therapy, hormonal therapy, immunotherapy (other than the present invention) or a combination thereof.
The therapeutic agents of the invention may be administered by the same route of administration or by different routes of administration. In some embodiments, the cancer therapy is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, implantable, inhaled, intrathecally, intraventricular, or intranasally. In some embodiments, the antibiotic is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, implantable, inhaled, intrathecally, intraventricular, or intranasally. The appropriate dosage may be determined according to the type of disease to be treated, the severity and course of the disease, the clinical condition of the individual, the clinical history of the individual and the response to the treatment, as well as the discretion of the attendant physician.
Treatment may include various "unit doses". A unit dose is defined as containing a predetermined amount of the therapeutic composition. The amount to be administered, as well as the particular route and formulation, is within the skill of the clinical technician's determination. The unit dose need not be administered as a single injection, but may include continuous infusion over a set period of time. In some embodiments, the unit dose comprises a single administrable dose.
Depending on the number of treatments and the unit dose, the amount administered will depend on the desired therapeutic effect. An effective dose is understood to mean the amount necessary to achieve a particular effect. In the practice of certain embodiments, it is contemplated that dosages in the range of 10mg/kg to 200mg/kg may affect the protective capabilities of these agents. Thus, the expected dosages include dosages of about 0.1、0.5、1、5、10、15、20、25、30、35、40、45、50、55、60、65、70、75、80、85、90、100、105、110、115、120、125、130、135、140、145、150、155、160、165、170、175、180、185、190、195 and 200, 300, 400, 500, 1000 μg/kg, mg/kg, μg/day or mg/day or any range derivable therein. Furthermore, such doses may be administered multiple times during the day, and/or over multiple days, weeks or months.
In certain embodiments, an effective dose of the pharmaceutical composition is a dose that can provide blood levels of about 1 μm to 150 μm. In another embodiment, an effective dose provides a blood level of about 4 μm to 100 μm; or about 1 μm to 100 μm; or about 1 μm to 50 μm; or about 1 μm to 40 μm; or about 1 μm to 30 μm; or about 1 μm to 20 μm; or about 1 μm to 10 μm; or about 10 μm to 150 μm; or about 10 μm to 100 μm; or about 10 μm to 50 μm; or about 25 μm to 150 μm; or about 25 μm to 100 μm; or about 25 μm to 50 μm; or about 50 μm to 150 μm; or about 50 μm to 100 μm (or any range derivable therein). In other embodiments, the dose may provide the following drug blood levels resulting from the therapeutic agent administered to the subject: about, at least about, or up to about 1、2、3、4、5、6、7、8、9、10、11、12、13、14、15、16、17、18、20、21、22、23、24、25、26、27、28、29、30、31、32、33、34、35、36、37、38、39、40、41、42、43、44、45、46、47、48、49、50、51、52、53、54,55、56、57、58、59、60、61、62、63、64、65、66、67、68、69、70、71、72、73、74、75、76、77、78、79、80、81、82、83、84、85、86、87、88、89、90、91、92、93、94、95、96、97、98、99 or 100 μm or any range derivable therein. In certain embodiments, the therapeutic agent administered to the subject is metabolized in vivo to a metabolized therapeutic agent, in which case blood levels may refer to the amount of metabolized therapeutic agent. Alternatively, to the extent that the therapeutic agent is not metabolized by the subject, the blood levels discussed herein may refer to the therapeutic agent not metabolized.
The precise amount of therapeutic composition will also depend on the discretion of the practitioner and is specific to each individual. Factors that affect the dosage include the physical and clinical state of the patient, the route of administration, the intended target of the treatment (relief of symptoms and cure), and the efficacy, stability, and toxicity of the particular therapeutic substance or other treatment that the subject may be receiving.
Those skilled in the art will understand and appreciate that dosage units of μg/kg or mg/kg body weight may be converted and expressed in units of comparable concentration of μg/ml or mM (blood level), for example 4 μM to 100 μM. It is also understood that uptake is species and organ/tissue dependent. Suitable conversion factors and physiological assumptions regarding uptake and concentration measurements are well known and allow one skilled in the art to convert one concentration measurement to another and to reasonably compare and draw conclusions about the dosages, efficacy and results described herein.
V. kit
Certain aspects of the invention also relate to kits comprising the compositions of the invention or compositions for practicing the methods of the invention. In particular embodiments, the kit comprises fresh or frozen NK cells and may or may not have been pre-activated or expanded. NK cells may or may not express one or more components of the TCR/CD3 complex. In the case where the NK cells have not expressed one or more components of the TCR/CD3 complex, the kit may comprise reagents for the corresponding transfection or transduction of the NK cells, including reagents such as vectors expressing the components, primers for amplifying the components, and the like. In some cases, NK cells may or may not express one or more heterologous proteins as defined herein, and when they do not express, the kit may comprise vectors expressing the heterologous proteins, primers for amplifying the heterologous proteins, and the like.
The kit may include components that may be packaged separately or placed in containers, such as tubes, bottles, vials, syringes, or other suitable container means. The individual components may also be provided in the kit in concentrated amounts; in some embodiments, the components are provided separately at the same concentration in solution as the other components. The concentration of the components may be 1x, 2x, 5x, 10x or 20x or more.
VI. Examples
The following examples are included to demonstrate preferred embodiments of the invention. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the invention, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention.
Example 1
Preparation and efficient use of NK cells expressing CD3
This example relates to cancer immunotherapy as a strategy to redirect NK cells' specificity for one or more target antigens by "arming" or pre-complexing them with bispecific or multispecific antibodies (e.g. prior to infusion or by co-infusing the two products separately). NK cells are transduced with one or more CD3 chains, including the cd3ζ, cd3γ, cd3δ, and cd3ε chains, and can be from any source. The cells may or may not be expanded, may be pre-activated with one or more inflammatory cytokines, such as IL12/15/18, and/or may be genetically modified to express one or more heterologous proteins, including, for example, engineered antigen receptors, such as chimeric antigen receptors or TCRs, and/or cytokine genes and/or homing/chemokine receptors.
FIGS. 1A and 1B show different embodiments of NK cells engineered for use with bispecific or multispecific antibodies. As shown in fig. 1A, in the first generation of NK cells, cells engineered to express CD3 can be activated by bispecific or multispecific antibodies including bispecific T cell engagement molecules (bites) comprising anti-CD 3 antibodies that bind to NK cell surface expressed heterologous CD3. In another embodiment, NK cells expressing CD3 are capable of binding by BiTE comprising anti-CD 3 antibodies and NK cells also express one or more specific cytokines (e.g. IL-15 and/or IL-21), resulting in increased efficacy and potency, which is particularly useful for treating solid tumors. In another embodiment, NK cells are engineered to express CD3, not only are capable of being activated by BiTE comprising an anti-CD 3 antibody, but can also be used with bispecific or multispecific antibodies (e.g., bispecific NK cell binding molecules or BiKE) comprising antibodies that bind to a surface antigen naturally occurring on NK cells, such as CD16, CS1, CD56, NKG2D, NKG2C, DNAM, 2B4, CD2, NCR, or KIR. In this way, NK cells are responsive to both NK and T cell engagement molecules. In another embodiment, the NK cells express an engineered antigen receptor, such as a CAR or engineered TCR, in addition to CD3 for binding to a T cell engagement molecule.
FIG. 1B shows a different embodiment in which NK cells are modified to express CD3 and TCR. On the right, T cell TCRs are shown as alpha and beta chains with antigen binding sites, where the TCRs complex with cd3ζ to affect signal transduction. The T cell TCR is co-complexed with two CD3 epsilon, CD3 delta and CD3 gamma chains. In some embodiments, the NK cells express a TCR in which one or more cytoplasmic domains of any CD3 molecule are heterologous intracellular domains, e.g., one or more cytoplasmic domains from one of CD16, NKG2D, DAP, DAP12, NCR, and DNAM-1. As shown on the left side of fig. 1B, NK cells are configured to express a CD3 co-receptor component, in one embodiment, the CD3 component is CD3 epsilon. In this case, standard BiTE (upper left corner contains antibody against tumor antigen and antibody against CD 3) commonly used with T cells naturally expressing CD3 can be used with NK cells expressing CD 3. In this particular example, the NK cell expresses a polypeptide comprising the extracellular domain of CD3 epsilon (although the extracellular domain of other CD3 components may be utilized) and the extracellular domain of CD3 epsilon is linked to the transmembrane and/or cytoplasmic domain of another molecule, such as CD3 zeta, CD16, NKG2D, DAP, DAP12, NCR, or DNAM-1.
As described above, fig. 1C schematically depicts the generation of a surface expressed single chimeric CD3 construct that can be used with anti-CD 3 BiTE. For example, the CD3 epsilon extracellular domain (ECD) is fused to a CD28, CD16, or NKG2D Transmembrane (TM) domain and a CD28, CD16, or NKG2D intracellular domain (ICD), with or without a CD3 zeta and/or DAP10 intracellular domain. In one embodiment, the construct is contained within the vector backbone of an SFG retrovirus derived from Moloney murine virus, which can be used with packaging plasmids to produce the virus. In the case of CD3 BiTE used with this construct in fig. 1C, the antibody will therefore bind to the extracellular domain of CD3 epsilon.
Embodiments of the invention utilize part or all of the CD3 receptor complex. As shown in fig. 2A and 2B, NK cells can be transfected or transduced with full length cd3ζ, cd3γ, cd3δ, and cd3ε. In this case, each of the full length cd3ζ, cd3γ, cd3δ, and cd3ε includes an extracellular domain, a transmembrane domain, and an intracellular domain. When the different components of the receptor are expressed from the same vector, they may be configured to be produced as separate polypeptides, e.g., separated by IRES or 2A elements. In any case, any expression construct may be configured to express one or more cytokines, including at least IL-15.
FIG. 4 shows CD3 expression on NK cells on day 4 after CMV TCR complex transduction. The figure provides a FACS plot showing CD3 expression on NK cells 4 days after CMV TCR complex transduction. Non-transduced (NT) NK cells (CD56+CD3-) served as negative control and T cells (CD3+CD56-) served as positive control.
FIG. 5 shows TCR expression on NK cells on day 4 after transduction of NK by CMV TCR complex. In particular, FACS diagrams showing expression of TCRa/b on NK cells 4 days after CMV TCR complex transduction are provided. Non-transduced (NT) NK cells (CD56+CD3 TCRa/b-) served as negative control and T cells (CD3+ TCRa/b+CD56-) served as positive control.
FIG. 6 shows TCR/CD3 expression on NK on day 6 post CMV TCR complex transduction. Specifically, FACS plots show double CD3 and TCRa/b expression on NK cells 6 days after CMV TCR complex transduction. Non-transduced (NT) NK cells (CD56+CD3 TCRa/b-) served as negative control and T cells (CD3+ TCRa/b+CD56-) served as positive control.
In FIG. 7, the binding of CD3-CD19 BiTE to NK cells by CD3/TCR at various concentrations is shown. Specifically, various cells (non-transduced (NT) NK cells, T cells or three different NK-TCR cells) were incubated with Bonauzumab (a CD3-CD19 bispecific binding molecule (BiTe)) at 37℃for 1 hour using two different concentrations (0.5. Mu.g/. Mu.l or 4. Mu.g/. Mu.l). The biotin-labeled CD19 antigen (CD 19 CAR detection reagent from Miltenyi) was then added for 20 minutes, followed by the addition of the anti-biotin antibody at room temperature for 15 minutes. This method was used to detect any BiTE that bound to cd3+ cells. The histogram in FIG. 7 shows the binding levels of CD19 to CD3-CD19 bispecific binding molecules (BiTe) associated with CD3 expression on NK-TCR and T cells.
FIG. 8 shows NK-TCR cytokine production following stimulation with plate-bound CD3 antibody. In particular, 20. Mu.g/ml of CD3-OKT3 clones were incubated overnight at 4℃in flat bottom 96-well plates to form plate-bound antigen. The next day, T cells or NK cells (NT or TCR transduced) were added to the wells for 4 hours, and brefeldin a (which prevented cytokine release, captured in the cytoplasm, so that it could be detected by intracellular cytokine staining) was added. They were then collected for surface and intracellular staining to assess cytokine production and degranulation (tnfα and CD107 a). The FACS plot in fig. 8 shows tnfα and CD107a biscationic populations in NK cells transduced with TCRs. Non-transduced (NT) NK cells (CD56+CD3-) served as negative control and T cells (CD3+CD56-) served as positive control.
FIG. 9 shows phosphorylation of CD3 zeta after CD3 cross-linking in NK TCR/CD3 cells. The various cells tested included non-transduced (NT) NK cells; non-transduced (NT) T cells or three different CD3-TCR transduced NK cells (where CD1, CD2 or CD3 represent different donors). Each NK cell group was transduced with CD3ZFLGDEFL (see fig. 2A and 2B). NK cells were incubated with CD3OKT3 clones (Miltenyi, 130-093-387) at a concentration of 20. Mu.g/ml for 20 min on ice. Cells were then cross-linked with Fab2 IgG1 antibodies at different time points and stained to check CD3z phosphorylation. This analysis of cd3ζ is useful because, as an internalization signal from the surface, NK cells can only cross-link with CD3 monoclonal antibodies if they express cd3ζ. NK cells not transduced with CD3 do not show any phosphorylation or activation after stimulation.
NK cells transduced with CD3-TCR also showed basal levels of sustained signaling that increased upon CD3 OKT3 stimulation and were similar to T cells, whereas non-transduced NK cells did not show any CD3 zeta phosphorylation, neither upon basal nor upon CD3 OKT3 stimulation.
FIG. 10 shows that pre-culturing CD3-CD19 BiTE with TCR/CD3 expressing NK cells increases their killing activity against Raji cells. NK cells were either loaded with CD3-TCR#1 (CD 3ZFLGDEFL (see FIGS. 2A and 2B)) or CD3-TCR#2 (Z2, also known as CD3ZGDEFL8SP21CD 8), which includes full length CD3 zeta, full length CD3 gamma, full length CD3 delta and full length CD3 epsilon linked to membrane bound IL21 (membrane bound IL21 has CD8 transmembrane domain) CD3/TCR construct transduced NK cells or non transduced NK cells were loaded with Blinatumumab and incubated with PBS for 1 hour and washed with PBS then co-cultured with CD19+B cell lymphoma cells at different effector cell: target cell ratios (FIG. 10A is a 1:1 ratio, FIG. 10B is a 1:5 ratio) as used herein, effector cells are CD-3-NK cells, target cells are Raji cells CD3 transduced cells loaded with TCR Blinatumumab showed both anti-emetic activity at the same rate as non transduced NK cells loaded with Blinatumumab or CD 3/transduced NK cells.
Example 2
NY-ESO TCR in NK cells
This example relates to the generation and use of NY-ESO TCRs in NK cells. In FIG. 11, there is an example of a producer cell. The schematic shows a situation where NK cells are first transduced with uTNK construct, uTNK construct comprising signaling domain from CD3 complex, NK co-stimulatory molecule and IL-15, followed by a second transduction step introducing TCR molecules, thereby generating NK cells co-expressing CD3 and NK signaling molecule, IL-15 and TCR complex. In one embodiment, NK cells are derived from cord blood and expanded with irradiated (100 Gy) universal antigen presenting cells (uAPC) feeder cells (feeder cells: NK ratio 2:1) and recombinant human IL-2 (200U/ml) in complete medium. To generate universal T cell-like NK cells (uTNK cells) that secrete IL-15, NK cells were purified and transduced 4 days after isolation with a retroviral construct containing the CD3 complex with NK costimulatory molecules and IL-15 gene. 48 hours after initial transduction, NK cells expressing uTNK were then transduced with a TCR targeting the selected antigen.
FIG. 12 shows expression of NY-ESO TCR on NK cells transduced with uTNK. NK cells were derived from cord blood and expanded in complete medium with irradiated (100 Gy) universal antigen presenting cells (uAPC) feeder cells (feeder cells: NK ratio 2:1) and recombinant human IL-2 (200U/ml). To generate universal T cell-like NK cells that secrete IL-15, NK cells were purified and transduced 4 days after isolation with a retroviral construct containing the CD3 complex with NK costimulatory molecules and IL-15 gene. 48 hours after initial transduction, uTNK cells were then transduced with TCR complexes targeting the selected antigen. After 48 hours, expression of CD3 and NY-ESO TCRs on the various uTNK constructs was assessed using flow cytometry. Non-transduced (NT) NK cells were used as negative control. CD3 and NY-ESO TCRs are highly expressed on all uTNK cells compared to NT NK cells. FIG. 13 provides the number of tumor-specific TCR molecules expressed on TCR engineered NK cells using various TCR constructs and NT NK cells as negative controls.
FIG. 14 shows the expression of NY-ESO TCR on non-transduced and transduced T cells. T cells were isolated from cord blood (same donor as NK cells as paired positive control) and activated with CD3/CD28 microbeads at a concentration of 25 μl/100 ten thousand for 48 hours in RPMI complete medium. T cells were then transduced with retroviral constructs containing NY-ESO TCR. 48 hours post transduction, flow cytometry showed that NY-ESO TCRs were highly expressed on transduced T cells compared to non-transduced T cells.
NK cells transduced with NY-ESO TCR killed target cells loaded (pulsed) with NY-ESO peptide in a dose dependent manner (FIG. 15). Chromium 51 CR killing assays were performed 7 days after TCR transduction to determine the killing capacity of TCR-engineered NK cells and T cells on LCL cells loaded with varying concentrations of NY-ESO peptide (for 2 hours). The NY-ESO TCR transduced uTNK cells showed enhanced killing of peptide-loaded LCL cells compared to non-transduced NK cells. NY-ESO TCR transduced T cells showed enhanced killing of peptide-loaded LCL cells compared to non-transduced T cells.
FIG. 16 shows that NY-ESO is expressed endogenously in myeloma, sarcoma and melanoma cell lines. Flow cytometry was used to determine the expression of NY-ESO on U266 (myeloma), saos-2 (sarcoma) and a375 (melanoma) cell lines. The U266, saos-2 and A375 cell lines showed higher levels of NY-ESO expression compared to the Raji cell line used as negative control.
NY-ESO TCR transduced T cells killed tumor targets expressing NY-ESO at higher E:T ratios (FIG. 17). Chromium 51 CR killing assays were performed 7 days after TCR transduction to determine the killing capacity of NY-ESO TCR engineered T cells against NY-ESO expressing myeloma, osteosarcoma and melanoma cell lines. NY-ESO TCR transduced T cells showed enhanced killing of NY-ESO positive cell lines compared to non-transduced T cells.
FIG. 18 shows that NY-ESO TCR transduced NK cells kill NY-ESO expressing tumor targets even at low E:T ratios. Chromium 51 CR killing assays were performed 7 days after TCR transduction to determine the killing capacity of NY-ESO TCR engineered NK cells against NY-ESO expressing myeloma, osteosarcoma and melanoma cell lines. NY-ESO TCR transduced NK cells showed enhanced killing of NY-ESO positive cell lines even at very low effector: target ratios compared to non-transduced NK cells.
FIG. 19 shows that NY-ESO transduced NK cells have a phenotype similar to NT NK cells. CytoF imaging showed that the untransduced NK cells and NY-ESO TCR transduced uTNK cells had similar phenotypes. FIG. 19A shows a u-plot with similar clusters and FIG. 19B shows a heat map of various markers with similar expression on NT and NY-ESO TCR transduced uTNK cells.
FIG. 20 provides a table showing the percentage of CD3+ and CD3+ TCR+ NK cells in each uTNK product. Flow cytometry was used to assess the composition of single positive CD3 NK cells (cd3+) and double positive CD3/TCR NK cells (cd3+tcr+). The untransduced NK cells consisted of less than 1% cd3+ and cd3+ tcr+ NK cells, while the TCR transduced uTNK cell products consisted of more than 60% cd3+ and more than 25% cd3+ tcr+ NK cells.
FIG. 21A provides FACS diagrams showing successful expression of CD3 on NK cells 4 days after transduction with TCR constant α - β (TCRCab; TCR6 construct). Non-transduced (NT) NK cells (CD56+CD3-) served as negative control. In FIG. 21B, NT NK and uTNK NK cells were incubated with Blinatumumab, a CD3-CD19 bispecific binding molecule (BiTe), at 37℃for 1 hr at 10. Mu.g/. Mu.l. The biotin-labeled CD19 antigen (CD 19 CAR detection reagent from Miltenyi) was then added for 20 minutes, followed by the addition of the anti-biotin antibody at room temperature for 15 minutes. This method was used to detect any BiTE that bound to cd3+ cells. The histogram in this figure shows the level of binding of CD19 to CD3-CD19 bispecific binding molecule (BiTe) associated with CD3 expression on uTINK NK cells. In FIG. 21C, CD3/TCR transduced or non-transduced NK cells were loaded Blinatumumab and incubated for 1 hour and washed with PBS. They were then co-cultured with LCL cells of different E:T ratios (A.1:1, B.1:5) to different time points. CD3-TCR transduced NK cells loaded with Blinatumumab showed enhanced anti-tumor activity compared to either untransduced NK cells or CD3/TCR transduced NK cells loaded with Blinatumumab, but not loaded with Blinatumumab at both E: T ratios.
Example 3
NY-ESO TCR in NK cells expressing CD3 in vivo
As shown in fig. 22A-22C, NK cells comprising the constructs described herein were tested in vivo and found to strongly inhibit tumor growth. Fig. 22A is a schematic diagram showing an experimental procedure performed. Briefly, NSG mice received 300cGy radiation on day-1 and then 0.5X10 6 U266-B1 cells transduced with firefly luciferase (FFluc) (myeloma cell line expressing HLA-A2 and NY-ESO antigens) on day 0, mice were infused with 5X 10 6 effector cells (NY-ESO TCR NK cells with WT, # A or #BUT-NK 15-NY ESO TCR constructs, respectively; WT refers to wild-type CD3 molecules with IL-15; #A refers to CD3-CD28 with IL-15 (e.g., UT-NK 15-28); #B refers to CD3-DAP10 with IL-15 (e.g., UT-NK15-DAP 10); or NY-ESO TCR T cells) on day 3), and animals were monitored over time and sacrificed as appropriate (N=5 mice per group). Fig. 22B shows the monitoring results of the experiment described in fig. 22A as a function of time-dependent bioluminescence imaging (representative images from day 1, day 7, day 14 and day 21, respectively, are shown). FIG. 22C is a graphical quantification of the bioluminescence mean radiation shown in FIG. 22B, with the Y axis representing the mean radiation in units of p/s/cm 2/sr and the X axis representing time.
As shown in fig. 23A-B, effector cells (e.g., NK cells or T cells) comprising NY-ESO targeted TCR and UT-NK15 constructs were tested for in vitro activity. FIG. 22A is an image of a cell sphere formed by osteosarcoma tumor cell line Saos-2, which was used to test the cytotoxic activity of NK cells and T cells expressing NY-ESO1 specific TCR. Stably transducing Saos-2 cells to express GFP; 10,000 of these cells per well were seeded overnight in 96-well plates, followed by the addition of 40,000 NK cells or T cells. Images of the co-cultures were scanned over time and analyzed by the IncuCyte cell analysis system. Fig. 22B is a graph showing percent cytotoxicity (Y-axis) of effector cells captured from representative images after 3 days of co-culture. NK cells co-transduce with NY-ESO-TCR and UT-NK15 signaling complex, the UT-NK15 signaling complex co-expressing a different co-stimulatory molecule fused to the CD3 zeta signaling chain (e.g., UTNK-15-28 or UTNK-15-DAP 10). T cells were transduced with NY-ESO TCR alone. Abbreviations in the figures are as follows: 28 Cd3ζ fused to CD28 costimulatory domain; 10 Cd3ζ fused to Dap10 costimulatory domain; 8 = CD8 a/β co-receptor as part of NY ESO TCR construct; wo IL-15 = the construct contained only cd3ζ, ε, γ and δ, without co-stimulation or IL-15. The TCR NK cells expressed UTNK the DAP10 costimulatory domain fused to CD28 or to CD3ζ (e.g., UTNK-15-28 or UTNK-15-DAP10; corresponding SEQ ID NO:121 and SEQ ID NO: 119) compared to NK cells transduced with CD3 complex alone or UT-NK15 without costimulatory domain. The addition of CD8 a/β co-receptors to TCRs did not significantly improve NK cell or T cell cytotoxicity.
As shown in fig. 24A-D, effector cells (e.g., NK cells or T cells) comprising NY-ESO targeted TCR and UT-NK15 constructs were tested for in vivo activity. FIG. 24A depicts a plan for in vivo studies to test the activity of different NY ESO TCR transduced NK and T cells. The program was performed in which 10 week old NSG mice were irradiated (300 cGy) and 500,000U 266 cells (HLA-A 2 positive, NY ESO expressing myeloma cell lines) were injected by tail vein the next day. Three days later, mice received 500 ten thousand TCR-transduced T cells or TCR-transduced NK cells. Mice were then monitored for tumor control by BLI imaging. Fig. 24B shows the BLI imaging results of the test described and performed according to fig. 24A. Mice were injected with U266 tumor cells alone, or also with T cells transduced with NY ESO-specific TCR, or also with NK cells co-transduced with NY ESO TCR and UT-NK15, with CD3 zeta fused with CD28 in UT-NK15 (labeled NY ESO NK UT-NK15 CD28 or NY-ESO TCR UTNK-15CD28 NK cells). Fig. 24C shows quantification of the average radiation intensity of a region of interest of an animal tested according to fig. 24A and imaged in fig. 24B. Fig. 24D shows a survival graph depicting a group of the above animals. The results indicate that NY ESO TCR T and NY-ESO TCR UTNK-15-CD28 NK cells mediate strong antitumor activity in vivo.
As shown in fig. 25, NY ESO TCRs and effector cells (e.g., NK cells) of the CD3 complex with or without IL-15 were tested for in vivo activity. NSG mice were irradiated (300 cGy) and the next day by tail vein injection of 500,000U 266 cells (HLA-A 2 positive, NY ESO expressing myeloma cell line). Three days later, mice received 500 ten thousand TCR-transduced T cells or NK cells. Tumor control in mice was monitored by BLI imaging. NK cells were transduced with NY ESO-specific TCR and co-transduced with either a CD3 complex without IL-15 or with UT-NK15 expressing CD3 ζ fused to CD28 co-stimulatory molecule (UT-NK 15-28) or UT-NK15 expressing CD3 ζ fused to DAP10 co-stimulatory molecule (UT-NK 15-DAP 10), with or without expression of CD8 α/β co-receptor. The results show that the lack of IL-15 results in a decrease in anti-tumor activity in vivo.
Together, these results demonstrate that effector cells (e.g., NK cells) comprising a construct described herein (e.g., NY-ESO TCR construct and/or CD3 construct, e.g., UT-NK15 or modified versions thereof, e.g., UT-NK-15-28 or UT-NK15-DAP 10) are sufficient to strongly inhibit tumor growth in vivo.
Example 4
PRAME TCR in NK cells expressing CD3 in vitro
As shown in fig. 26A-C, NK cells comprising constructs targeting the melanoma preferential expression antigen (PRAME) described herein were tested in vitro and found to strongly inhibit the growth of tumor cells. FIG. 26A shows the expression of UT-NK15 (x-axis, CD 3) and PRAME-specific TCR (y-axis, TCR) in NK cells (TCR clone 46, 54 or DSK3, respectively), or PRAME-specific TCR in T cells transduced with the same (TCR clone 46 or 54). PRAME-specific TCR expression on NK cells was confirmed using antibodies against TCR and CD 3. Expression of PRAME-specific TCRs in T cells was confirmed by tetramer staining using 46/54 peptide/MHC-specific tetramers. Figure 26B shows in vitro cytotoxicity of NK cells expressing PRAME-specific TCRs against the U266 myeloma cell line. Cytotoxicity of U266 myeloma cells on T cells transduced with PRAME-specific TCR and NK cells transduced with UT-NK15 and PRAME-specific TCR was measured using Incucyte live cell imaging. GFP expressing U266 cells were co-cultured with PRAME specific TCR expressing T cells or NK cells at an effector to target ratio of 1:1 (50,000 effectors and 50,000 target cells were seeded in each well of a 96 well plate). A decrease in GFP expression indicates cell death. After 26 hours, a second round of 50,000 tumor cells (referred to as "re-challenge") was added to each well for the tumor re-challenge assay. NK cells expressing UT-NK15 and PRAME specific TCR clone 46 or PRAME specific TCR clone 54 exert optimal antitumor activity upon re-challenge with U266 cells and showed excellent cytotoxicity compared to control T cells transduced with PRAME specific TCR clone 46 or 54, respectively. Figure 26C shows in vitro cytotoxicity of NK cells expressing PRAME-specific TCRs against UA375 melanoma cell lines. Cytotoxicity of UA375 melanoma cells by T cells transduced with PRAME-specific TCRs and NK cells transduced with UT-NK15 and PRAME-specific TCRs was measured using intucyte live cell imaging. GFP-expressing UA375 cells were co-cultured with PRAME-expressing T cells or NK cells at a 1:1 effector to target ratio (50,000 effectors and 50,000 target cells were seeded in each well of a 96-well plate). A decrease in GFP expression indicates cell death. After 26 hours, a second round of 50,000 tumor cells were added to each well for tumor re-challenge assays. The open symbols represent T cells, while the filled symbols represent NK cells. Nt=untransduced. NK cells expressing UT-NK15 and PRAME specific TCR clone 46 (TCR-46), PRAME specific TCR clone 54 (TCR-54) or PRAME specific TCR clone DSK3 (DSK) showed excellent anti-tumor activity when re-challenged with UA375 cells and showed excellent cytotoxicity compared to control T cells transduced with PRAME specific TCR clone 46, 54 or DSK3, respectively.
Together, these results demonstrate that effector cells (e.g., NK cells) comprising the constructs described herein (e.g., PRAME-specific TCR constructs) are sufficient to strongly inhibit tumor growth in vivo. Furthermore, NK cells comprising the CD3 construct and PRAME-specific TCR construct described herein show increased cytotoxicity compared to T cell control cells comprising the same TCR construct, especially in case of tumor cell progression and/or re-challenge.
Example 5
TCR in NK cells expressing CD3 in vivo
NK cells comprising the constructs described herein were tested in vivo and strongly inhibited tumor growth. Experiments were performed according to the schematic and experimental procedure described herein. Briefly, NSG mice are irradiated (e.g., about 300 cGy) on day-1, then on day 0, individual mice receive tail vein injected cancer cells (e.g., 0.5x10 6 cells, e.g., cells expressing (native and/or transduced) antigens described herein) and transduced with appropriate markers (e.g., firefly luciferase (FFluc)), and on day 3 mice are injected with effector cells transduced with a transgenic TCR (e.g., TCR constructs comprising γ/δ TCR chains and/or α/β TCR chains, e.g., TCR constructs targeted to antigens described herein, e.g., NY-ESO, tyrosinase, MAGEA3, MAGEA4, HPV E7, WT1, PRAME, gp100, MART-1, etc.) with or without other constructs described herein (e.g., about 5x 10 6 NK cells with UT-NK15 constructs with or without IL15, with or without co-stimulatory molecules and with or without additional constructs with or without co-stimulatory molecules). Animals were then monitored over time and sacrificed as appropriate. The monitoring results of the above experiments are recorded, for example, as a function of bioluminescence imaging over time (e.g., on day 1, day 7, day 14, day 21, etc.).
In vitro activity of effector cells (e.g., NK cells or T cells) comprising TCRs (e.g., TCR constructs comprising gamma/delta TCR chains and/or alpha/beta TCR chains, e.g., targeting antigens described herein, e.g., NY-ESO, tyrosinase, MAGEA3, MAGEA4, HPV E7, WT1, PRAME, gp100, MART-1, etc.) and UT-NK15 constructs is tested. The cytoballs formed from an appropriate tumor cell line (e.g., 0.5x10 6 cells, e.g., cells expressing (naturally and/or with) an antigen as described herein) comprising the antigen of interest are used to test the cytotoxic activity of NK and/or T cells expressing a specific TCR. Stably transducing cancer cells to express appropriate markers (e.g., GFP, FFluc, etc.); many of these cells (e.g., about 10,000) were seeded overnight in each well of a 96-well plate, and then many effector cells (e.g., about 40,000) were added. Images of the co-cultures are scanned over time and analyzed by a suitable system (e.g., the IncuCyte cell analysis system). After several days of co-culture (e.g., 1 day, 3 days, 7 days, etc.), the percent cytotoxicity of effector cells was captured from representative images. NK cells co-transduce with antigen-targeting TCR and UT-NK15 signaling complexes, the UT-NK15 signaling complex co-expressing a different co-stimulatory molecule fused to the CD3 zeta signaling chain (e.g., UTNK-15-28 or UTNK-15-DAP 10). Appropriate control cells are transduced with the appropriate constructs described herein. Superior in vitro cytotoxicity was observed with TCR NK cells expressing UTNK with CD28 or DAP10 costimulatory domains fused to CD3 ζ (e.g., UTNK-15-28 or UTNK-15-DAP10; e.g., corresponding SEQ ID NO:121 and SEQ ID NO: 119) compared to NK cells transduced with CD3 complex alone or UT-NK15 transduced with NO costimulatory domain.
In vivo activity of effector cells (e.g., NK cells or T cells) comprising antigen-specific TCRs (e.g., TCR constructs comprising gamma/delta TCR chains and/or alpha/beta TCR chains, e.g., targeting antigens described herein, e.g., NY-ESO, tyrosinase, MAGEA3, MAGEA4, HPV E7, WT1, PRAME, gp100, MART-1, etc.) and UT-NK15 constructs is tested. Assays for in vivo analysis of effector cells (e.g., NK cells or T cells) comprising the engineered constructs were performed in an experimental plan similar to that described in fig. 24. Briefly, NSG mice of the appropriate age (e.g., 10 week old NSG mice) are irradiated (e.g., with about 300 cGy) and tumor cells containing the target antigen of interest (e.g., about 500,000 cells; e.g., naturally expressed and/or transduced with the antigens described herein) are injected by tail vein the next day. Three days later, mice received effector cell bolus injections (e.g., about 500 ten thousand TCR-transduced T cells and/or TCR-transduced NK cells). Mice are then monitored for tumor control (e.g., by BLI imaging). The mean radiation of the region of interest is measured and quantified, and animals comprising the test construct containing the TCR targeting the antigen of interest and the UT-NK15 construct with or without CD3 fusion and/or IL-15 expression show improved survival and/or reduced mean radiation relative to control animals. The results indicate that TCR UTNK-15NK cells mediate strong antitumor activity in vivo.
TCR constructs comprising TCRs (e.g., TCR constructs comprising a gamma/delta TCR chain and/or an alpha/beta TCR chain, e.g., targeted to antigens described herein, e.g., NY-ESO, tyrosinase, MAGEA3, MAGEA4, HPV E7, WT1, PRAME, gp100, MART-1, etc.) and effector cells (e.g., NK cells) with or without the CD3 complex of IL-15 are tested. NSG mice are irradiated (e.g., with about 300 cGy), and tumor cells expressing the antigen (e.g., about 500,000 cells; e.g., naturally expressed and/or transduced with the antigens described herein) are injected by tail vein the next day. Three days later, mice received effector cell bolus injections (e.g., about 500 ten thousand TCR-transduced T cells and/or TCR-transduced NK cells). Mice are monitored for tumor control (e.g., by BLI imaging). NK cells were transduced with antigen specific TCR and co-transduced with either a CD3 complex without IL-15 or UT-NK15 (UT-NK 15-28) expressing CD3 zeta fused to a CD28 co-stimulatory molecule or UT-NK15 (UT-NK 15-DAP 10) expressing CD3 zeta fused to a DAP10 co-stimulatory molecule with or without expression of a CD8 alpha/beta co-receptor. The results indicate that the lack of IL-15 results in reduced antitumor activity in vivo.
Together, these results demonstrate that effector cells (e.g., NK cells) comprising a construct described herein (e.g., a TCR construct and/or a CD3 construct, e.g., UT-NK15 or modified versions thereof, e.g., UT-NK-15-28 or UT-NK15-DAP 10) are sufficient to strongly inhibit tumor growth in vivo.
All methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.
Claims (95)
1. A composition comprising NK cells modified to express part or all or any combination of the individual chains of cd3δ, cd3ε, cd3γ, or cd3ζ.
2. The composition of claim 1, wherein the NK cells are modified to express one or more of a TCR a chain, a TCR β chain, a TCR γ chain, and a TCR δ chain.
3. The composition of claim 1 or 2, wherein the NK cells are modified to express a T Cell Receptor (TCR) αβ chain or a tcrγδ chain.
4. The composition of claim 1, wherein the NK cells are modified to express part or all of only constant regions of one or more of a TCR a chain, a TCR β chain, a TCR γ chain, and a TCR δ chain.
5. The composition of claim 1, wherein the NK cells are modified to express part or all of a constant region only of a T Cell Receptor (TCR) αβ chain or a tcrγδ chain.
6. The composition of any one of claims 1-5, wherein the NK cells are modified to express some or all of cd3ζ, two cd3ε, cd3δ, and cd3γ.
7. The composition of any one of claims 1-6, wherein the NK cells are modified to express full length: cd3ζ, cd3ε, cd3δ and/or cd3γ.
8. The composition of any one of claims 1-7, wherein any one or more of cd3ζ, cd3ε, cd3δ, and cd3γ is heterologously linked to one or more intracellular signaling domains.
9. The composition of claim 8, wherein the intracellular signaling domain is selected from the group consisting of: CD16, NKG2D, DAP, DAP12, 2B4, 4-1BB, CD2, CD28, and combinations thereof.
10. The composition of claim 8 or 9, wherein the intracellular signaling domain comprises a DAP10 intracellular signaling domain.
11. The composition of any one of claims 8-10, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 85% identical to SEQ ID No. 115.
12. The composition of any one of claims 8-11, wherein the intracellular signaling domain comprises the amino acid sequence according to SEQ ID No. 115.
13. The composition of claim 8 or 9, wherein the intracellular signaling domain comprises a CD28 intracellular signaling domain.
14. The composition of any one of claims 8, 9 or 13, wherein the intracellular signaling domain comprises an amino acid sequence at least about 85% identical to SEQ ID No. 116.
15. The composition of any one of claims 8, 9, 13 or 14, wherein the intracellular signaling domain comprises the amino acid sequence of SEQ ID No. 116.
16. The composition of claim 8 or 9, wherein the intracellular signaling domain comprises DAP10 and CD28 intracellular signaling domains.
17. The composition of any one of claims 8, 9 or 16, wherein the intracellular signaling domain comprises an amino acid sequence at least about 85% identical to SEQ ID No. 117.
18. The composition of any one of claims 8, 9, 16 or 17, wherein the intracellular signaling domain comprises the amino acid sequence of SEQ ID No. 117.
19. The composition of any one of claims 1-18, wherein the composition further comprises one or more bispecific or multispecific antibodies, wherein the bispecific or multispecific antibodies comprise an anti-CD 3 antibody.
20. The composition of claim 19, wherein the NK cells express the antibody.
21. The composition of claim 19 or 20, wherein the NK cells are complexed with the antibody.
22. The composition of claim 20 or 21, wherein the antibody is bolafuximab.
23. The composition of any one of claims 1-22, wherein the TCR is directed against a cancer antigen or a viral antigen.
24. The composition of any one of the preceding claims, wherein the NK cells are derived from umbilical Cord Blood (CB), peripheral Blood (PB), bone marrow, stem cells, or mixtures thereof.
25. The composition of any one of the preceding claims, wherein the NK cells are pre-activated.
26. The composition of claim 25, wherein the NK cells are pre-activated by one or more cytokines.
27. The composition of claim 26, wherein the cytokine is IL-2, IL-7, IL-12, IL-15, IL-18, IL-21, or a combination thereof.
28. The composition of any one of the preceding claims, wherein the NK cells are expanded.
29. The composition of claim 28, wherein the NK cells are expanded in the presence of IL-2.
30. The composition of any one of the preceding claims, wherein the NK cells are modified to express one or more heterologous proteins.
31. The composition of claim 30, wherein the heterologous protein is an engineered antigen receptor, cytokine, homing receptor, or chemokine receptor.
32. The composition of claim 31, wherein the engineered antigen receptor is a chimeric antigen receptor and/or an engineered T cell receptor.
33. The composition of claim 32, wherein the engineered antigen receptor is an engineered T cell receptor, and wherein the engineered T cell receptor targets an NY-ESO antigen.
34. The composition of claim 33, wherein the T cell receptor comprises a sequence at least 85% identical to SEQ ID No. 25 and a sequence at least 85% identical to SEQ ID No. 26.
35. The composition of claim 33, wherein the engineered antigen receptor is an engineered T cell receptor, and wherein the engineered T cell receptor targets a PRAME antigen.
36. The composition of claim 35, wherein the target PRAME epitope is SLLQHLIGL (SEQ ID NO: 131) and/or QLLALLPSL (SEQ ID NO: 132).
37. The composition of claim 35 or 36, wherein the T cell receptor comprises a sequence at least 85% identical to SEQ ID No. 135 and a sequence at least 85% identical to SEQ ID No. 136.
38. The composition of claim 35 or 36, wherein the T cell receptor comprises a sequence at least 85% identical to SEQ ID No. 139 and a sequence at least 85% identical to SEQ ID No. 140.
39. The composition of claim 35 or 36, wherein the T cell receptor comprises a sequence at least 85% identical to SEQ ID No. 143 and a sequence at least 85% identical to SEQ ID No. 144.
40. The composition of any one of claims 30-39, wherein the heterologous protein is a cytokine.
41. The composition of any one of claims 26-40, wherein the cytokine is selected from the group consisting of: IL-15, IL-12, IL-2, IL-18, IL-21, IL-23, IL-7, GMCSF, or combinations thereof.
42. The composition of claim 41, wherein the cytokine is membrane-bound.
43. The composition of claim 41 or 42, wherein the cytokine is IL-15.
44. The composition of claim 42 or 43, wherein the membrane-bound cytokine comprises a transmembrane domain from CD8, CD28, CD27, B7H3, igG1, igG4, CD4, DAP10, or DAP 12.
45. The composition of any one of claims 26-44, wherein said NK cells express a chimeric antigen receptor and a cytokine.
46. The composition of any one of the preceding claims, wherein the bispecific antibody comprises an antibody that targets a cancer antigen.
47. The composition of claim 46, wherein the cancer antigen is a CD19 antigen.
48. The composition of claim 46 or 47, wherein the bispecific antibody is bolafuximab.
49. A composition comprising a complex, the composition comprising:
(1) NK cells modified to express part or all of the CD3 receptor complex and optionally modified to express a T Cell Receptor (TCR) αβ chain or a tcrγδ chain; and
(2) A bispecific or multispecific antibody, wherein the bispecific or multispecific antibody comprises an anti-CD 3 antibody which binds to CD3 on the NK cell.
50. The composition of claim 49, wherein said NK cells are modified to express a TCR αβ chain that is at least 85% identical to SEQ ID No. 25 and SEQ ID No. 26, said TCR αβ chain targets an NY-ESO antigen, and said bispecific antibody is bolaful mab.
51. The composition of claim 49 or 50, wherein the NK cells are modified to express full length: cd3ζ, cd3ε, cd3δ and/or cd3γ.
52. The composition of any one of claims 49-51, wherein any one or more of cd3ζ, cd3ε, cd3δ, and cd3γ are heterologously linked to one or more intracellular signaling domains.
53. The composition of claim 52, wherein the intracellular signaling domain is selected from the group consisting of: CD16, NKG2D, DAP, DAP12, 2B4, 4-1BB, CD2, CD28, DNAM, and combinations thereof.
54. The composition of claim 52 or 53, wherein said intracellular signaling domain comprises a DAP10 intracellular signaling domain.
55. The composition of any one of claims 52-54, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 85% identical to SEQ ID No. 115.
56. The composition of any one of claims 52-55, wherein the intracellular signaling domain comprises the amino acid sequence according to SEQ ID No. 115.
57. The composition of claim 52 or 53, wherein the intracellular signaling domain comprises a CD28 intracellular signaling domain.
58. The composition of any one of claims 52, 53 or 57, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 85% identical to SEQ ID No. 116.
59. The composition of any one of claims 52, 53, 57 or 58, wherein said intracellular signaling domain comprises the amino acid sequence of SEQ ID No. 116.
60. The composition of claim 52 or 53, wherein said intracellular signaling domain comprises DAP10 and CD28 intracellular signaling domains.
61. The composition of any one of claims 52, 53 or 60, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 85% identical to SEQ ID No. 117.
62. The composition of any one of claims 52, 53, 60, or 61, wherein the intracellular signaling domain comprises the amino acid sequence of SEQ ID No. 117.
63. The composition of any one of claims 49-62, wherein the complex is contained in a pharmaceutically acceptable excipient.
64. The composition of any one of claims 49-63, wherein the complex is contained in a delivery device.
65. A method of treating cancer in an individual, the method comprising the step of administering to the individual a therapeutically effective amount of the composition of any one of claims 1-64.
66. The method of claim 65, wherein the NK cells and the antibody are administered to the individual simultaneously.
67. The method of claim 65 or 66, wherein the NK cells and the antibody are administered in the same formulation.
68. The method of any one of claims 65-67, wherein NK cells and antibody are pre-complexed prior to administration to the individual.
69. The method of claim 65, wherein the NK cells and the antibody are administered to the individual at different times.
70. The method of any one of claims 65-69, wherein NK cells and antibody are administered by infusion.
71. The method of any one of claims 65-70, wherein the NK cells are autologous to the subject.
72. The method of any one of claims 65-71, wherein the NK cells are allogeneic with respect to the individual.
73. A method of redirecting the specificity of NK cells for a cancer antigen with a bispecific or multispecific anti-CD 3 antibody, the redirected NK cells being used to treat an individual, the method comprising the step of administering to the individual the antibody and optionally NK cells expressing part or all of the CD3 receptor complex and optionally expressing part or all of the tcrαβ chain or tcrγδ chain.
74. The method of claim 73, further comprising the step of modifying NK cells to express part or all of the CD3 receptor complex.
75. The method of claim 73 or 74, wherein the NK cells are modified to express full length: cd3ζ, cd3ε, cd3δ and/or cd3γ.
76. The method of any one of claims 73-75, wherein any one or more of cd3ζ, cd3ε, cd3δ, and cd3γ are heterologously linked to one or more intracellular signaling domains.
77. The method of claim 76, wherein the intracellular signaling domain is selected from the group consisting of: CD16, NKG2D, DAP, DAP12, 2B4, 4-1BB, CD2, CD28, DNAM, and combinations thereof.
78. The method of claim 76 or 77, wherein said intracellular signaling domain comprises a DAP10 intracellular signaling domain.
79. The method of any one of claims 76-78, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 85% identical to SEQ ID No. 115.
80. The method of any one of claims 76-79, wherein the intracellular signaling domain comprises the amino acid sequence according to SEQ ID No. 115.
81. The method of claim 76 or 77, wherein the intracellular signaling domain comprises a CD28 intracellular signaling domain.
82. The method of any one of claims 76, 77, or 81, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 85% identical to SEQ ID No. 116.
83. The method of any one of claims 76, 77, 81 or 82 wherein the intracellular signaling domain comprises the amino acid sequence of SEQ ID No. 116.
84. The method of claim 76 or 77, wherein said intracellular signaling domain comprises DAP10 and CD28 intracellular signaling domains.
85. The method of any one of claims 76, 77, or 84, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 85% identical to SEQ ID No. 117.
86. The method of any one of claims 76, 77, 84, or 85, wherein the intracellular signaling domain comprises the amino acid sequence of SEQ ID No. 117.
87. The method of any one of claims 73-86, further comprising the step of modifying NK cells to express part or all of a tcrαβ chain or a tcrγδ chain.
88. The method of any one of claims 73-87, wherein the tcrαβ chain or tcrγδ chain targets an NY-ESO antigen.
89. The method of any one of claims 73-88, wherein the TCR chain is a TCR αβ chain and is at least 85% identical to SEQ ID No. 25 and SEQ ID No. 26.
90. The method of any one of claims 73-86, wherein the tcra β chain or tcrγδ chain targets a PRAME antigen.
91. The method according to claim 90, wherein the target PRAME epitope is SLLQHLIGL (SEQ ID NO: 131) and/or QLLALLPSL (SEQ ID NO: 132).
92. The method of claim 90 or 91, wherein the TCR chain comprises a sequence at least 85% identical to SEQ ID No. 135 and a sequence at least 85% identical to SEQ ID No. 136.
93. The method of claim 90 or 91, wherein the TCR chain comprises a sequence at least 85% identical to SEQ ID No. 139 and a sequence at least 85% identical to SEQ ID No. 140.
94. The method of claim 90 or 91, wherein the TCR chain comprises a sequence at least 85% identical to SEQ ID No. 143 and a sequence at least 85% identical to SEQ ID No. 144.
95. The method of any one of claims 73-94, further comprising the step of modifying the NK cells to express one or more additional exogenous proteins.
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US63/225,281 | 2021-07-23 | ||
US63/310,526 | 2022-02-15 | ||
US202263344931P | 2022-05-23 | 2022-05-23 | |
US63/344,931 | 2022-05-23 | ||
PCT/US2022/074062 WO2023004425A2 (en) | 2021-07-23 | 2022-07-22 | Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy |
Publications (1)
Publication Number | Publication Date |
---|---|
CN118055770A true CN118055770A (en) | 2024-05-17 |
Family
ID=91047032
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202280061681.5A Pending CN118055770A (en) | 2021-07-23 | 2022-07-22 | CD3 expressing natural killer cells with enhanced function for adoptive immunotherapy |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN118055770A (en) |
-
2022
- 2022-07-22 CN CN202280061681.5A patent/CN118055770A/en active Pending
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20210290676A1 (en) | Improving the efficacy and safety of adoptive cellular therapies | |
JP7107579B2 (en) | A constitutively active cytokine receptor for cell therapy | |
US20210137977A1 (en) | Diverse antigen binding domains, novel platforms and other enhancements for cellular therapy | |
US8822647B2 (en) | Method and compositions using a chimeric antigen receptor for enhanced anti-tumor effector functioning of T cells | |
US20220135678A1 (en) | Methods and compositions to improve the safety and efficacy of cellular therapies | |
ES2692206T3 (en) | Combined immunotherapy of antigen and hematopoietic recognition receptors for the treatment of diseases | |
BR112020005938A2 (en) | immune cell or immune cell population of the same, immune effector cell or stem cell, cell presenting antigen, recombinant polynucleotide, vector, composition comprising an immune effector cell or a stem cell, methods for producing an immune effector cell that expresses unnaturally occurring immune receptor, to generate a population of cells manipulated by rna, to provide anti-disease immunity in an individual, to treat or prevent a disease associated with the expression of an antigen, and, use | |
US20240024476A1 (en) | CAR Cells and Polyspecific Binding Molecules for Treating Solid Tumor | |
JP2018504104A (en) | Inhibitory chimeric antigen receptor expressing non-T cell transduction domain (iCAR or N-CAR) | |
WO2019136305A1 (en) | Cell-based and immune checkpoint inhibitor therapies combined with il-12 for treating cancer | |
CN110404061B (en) | Improved T cell therapy | |
JP7271037B2 (en) | Chimeric Antigen Receptor (CAR) T Cells Stabilize the Immune Synapse | |
US20230226113A1 (en) | Vaccine and Uses thereof in Cell Therapy | |
CN118055770A (en) | CD3 expressing natural killer cells with enhanced function for adoptive immunotherapy | |
JP2023511443A (en) | Quantitative control of activity of engineered cells expressing universal immune receptors | |
KR20240041964A (en) | CD3-expressing natural killer cells with enhanced function for adoptive immunotherapy | |
IL310308A (en) | Apparatuses, systems and methods for plunger-stopper depth measurement in pre-filled syringes | |
WO2024020537A2 (en) | Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy | |
CN109952309B (en) | Constitutive active cytokine receptors for cell therapy | |
KR20240055714A (en) | Mutant IL-15 compositions and methods thereof | |
JP2024073564A (en) | Diverse antigen-binding domains, novel platforms and other enhancements for cell therapy | |
CN116732068A (en) | Gene for encoding chimeric antigen receptor, vector, modified cell and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication |