CN117986388A - Recombinant protein, monkey pox vaccine and preparation method and application thereof - Google Patents
Recombinant protein, monkey pox vaccine and preparation method and application thereof Download PDFInfo
- Publication number
- CN117986388A CN117986388A CN202410340321.XA CN202410340321A CN117986388A CN 117986388 A CN117986388 A CN 117986388A CN 202410340321 A CN202410340321 A CN 202410340321A CN 117986388 A CN117986388 A CN 117986388A
- Authority
- CN
- China
- Prior art keywords
- monkey
- recombinant protein
- monkey pox
- preventing
- recombinant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 title claims abstract description 54
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 title claims abstract description 54
- 208000005871 monkeypox Diseases 0.000 title claims abstract description 33
- 229940124939 Pox vaccine Drugs 0.000 title claims description 9
- 238000002360 preparation method Methods 0.000 title description 7
- 241000700627 Monkeypox virus Species 0.000 claims abstract description 47
- 108091007433 antigens Proteins 0.000 claims abstract description 23
- 208000015181 infectious disease Diseases 0.000 claims abstract description 23
- 102000036639 antigens Human genes 0.000 claims abstract description 22
- 239000000427 antigen Substances 0.000 claims abstract description 20
- 239000012620 biological material Substances 0.000 claims abstract description 11
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 7
- 230000000694 effects Effects 0.000 claims abstract description 7
- 230000002265 prevention Effects 0.000 claims abstract description 6
- 125000000539 amino acid group Chemical group 0.000 claims abstract description 3
- 150000007523 nucleic acids Chemical class 0.000 claims description 14
- 230000014509 gene expression Effects 0.000 claims description 13
- 102000039446 nucleic acids Human genes 0.000 claims description 12
- 108020004707 nucleic acids Proteins 0.000 claims description 12
- 108020004414 DNA Proteins 0.000 claims description 10
- 244000005700 microbiome Species 0.000 claims description 10
- 239000013598 vector Substances 0.000 claims description 10
- 102000053602 DNA Human genes 0.000 claims description 9
- 201000010099 disease Diseases 0.000 claims description 8
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 8
- 239000013604 expression vector Substances 0.000 claims description 7
- 239000002299 complementary DNA Substances 0.000 claims description 6
- 238000000034 method Methods 0.000 claims description 6
- 230000001225 therapeutic effect Effects 0.000 claims description 6
- 239000002773 nucleotide Substances 0.000 claims description 5
- 125000003729 nucleotide group Chemical group 0.000 claims description 5
- 241000588724 Escherichia coli Species 0.000 claims description 4
- 241000894006 Bacteria Species 0.000 claims description 3
- 108091026890 Coding region Proteins 0.000 claims description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 claims description 2
- 238000004519 manufacturing process Methods 0.000 claims description 2
- 238000011282 treatment Methods 0.000 claims description 2
- 229940031626 subunit vaccine Drugs 0.000 abstract description 17
- 230000004927 fusion Effects 0.000 abstract description 15
- 231100000419 toxicity Toxicity 0.000 abstract description 8
- 230000001988 toxicity Effects 0.000 abstract description 8
- 241000700605 Viruses Species 0.000 abstract description 7
- 208000003322 Coinfection Diseases 0.000 abstract description 3
- 229940031567 attenuated vaccine Drugs 0.000 abstract description 3
- 230000036039 immunity Effects 0.000 abstract description 3
- 229940031551 inactivated vaccine Drugs 0.000 abstract description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 21
- 108090000623 proteins and genes Proteins 0.000 description 18
- 102000004169 proteins and genes Human genes 0.000 description 13
- 241000699670 Mus sp. Species 0.000 description 11
- 230000003053 immunization Effects 0.000 description 11
- 238000002649 immunization Methods 0.000 description 10
- 239000000047 product Substances 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 5
- 230000006698 induction Effects 0.000 description 5
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 5
- 229960005486 vaccine Drugs 0.000 description 5
- 241000700629 Orthopoxvirus Species 0.000 description 4
- 241000700618 Vaccinia virus Species 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 238000000502 dialysis Methods 0.000 description 4
- 238000010828 elution Methods 0.000 description 4
- 230000003612 virological effect Effects 0.000 description 4
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 3
- 102000018697 Membrane Proteins Human genes 0.000 description 3
- 108010052285 Membrane Proteins Proteins 0.000 description 3
- 241000700647 Variola virus Species 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 239000012149 elution buffer Substances 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- PXHVJJICTQNCMI-UHFFFAOYSA-N nickel Substances [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 230000001681 protective effect Effects 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 2
- 230000006978 adaptation Effects 0.000 description 2
- 229940024546 aluminum hydroxide gel Drugs 0.000 description 2
- SMYKVLBUSSNXMV-UHFFFAOYSA-K aluminum;trihydroxide;hydrate Chemical compound O.[OH-].[OH-].[OH-].[Al+3] SMYKVLBUSSNXMV-UHFFFAOYSA-K 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 239000012535 impurity Substances 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 238000002604 ultrasonography Methods 0.000 description 2
- 101150084923 C19L gene Proteins 0.000 description 1
- 102100022443 CXADR-like membrane protein Human genes 0.000 description 1
- 241000450599 DNA viruses Species 0.000 description 1
- 201000004624 Dermatitis Diseases 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 101000901723 Homo sapiens CXADR-like membrane protein Proteins 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 208000009525 Myocarditis Diseases 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- 241000700625 Poxviridae Species 0.000 description 1
- 108010026552 Proteome Proteins 0.000 description 1
- 101150090155 R gene Proteins 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 230000003255 anti-acne Effects 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 238000002224 dissection Methods 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 239000003480 eluent Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 231100000636 lethal dose Toxicity 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 108700021021 mRNA Vaccine Proteins 0.000 description 1
- 229940126582 mRNA vaccine Drugs 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 208000008494 pericarditis Diseases 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229940024231 poxvirus vaccine Drugs 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 230000001018 virulence Effects 0.000 description 1
- 108700026215 vpr Genes Proteins 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
Landscapes
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The invention discloses a recombinant protein, which is the recombinant protein of the following a) or b): a) The amino acid sequence is a recombinant protein of SEQ ID No. 2; b) The recombinant protein which can code for the activity of the monkey pox antigen is obtained by substituting and/or deleting and/or adding one or more amino acid residues in the amino acid sequence shown in SEQ ID No. 2. The invention screens proper recombinant virus subunit vaccine from EEV and IMV surface antigen, and the toxicity attack protection rate of immune group shows that the bigeminal fusion recombinant protein can generate 100% immunity protection rate. Is a high-efficiency and safe technical means, and solves the problems of unstable protection effect, easy secondary infection, strong toxicity and the like of the existing inactivated vaccine and the existing attenuated vaccine. The recombinant protein and the biological material can be used for preparing a monkey pox virus subunit vaccine and can be applied to the prevention of monkey pox.
Description
Technical Field
The invention relates to an in vitro diagnosis technology, in particular to a recombinant protein, a monkey pox vaccine, a preparation method and application thereof.
Background
Since month 5 of 2022, the number of Monkey Pox Virus (MPV) infection cases outside of the african primary region has dramatically increased. The World Health Organization (WHO) has announced that the global monkey poxvirus outbreak constitutes an international public health emergency. The monkey poxvirus and smallpox virus (smallpox) and vaccinia virus (VACV) belong to the genus orthopoxvirus of the family poxviridae and are double-stranded DNA viruses. Vaccination with an orthopoxvirus vaccine provides cross-immune protection against infection with other orthopoxviruses. Thus, two VACV-based vaccines with reduced activity (ACAM 2000 and JYNNEOS) have been urgently approved by the U.S. food and drug administration for the prevention of monkey pox. However, these vaccines have been shown to be associated with a number of serious adverse events, including myocarditis and pericarditis, particularly in certain individual populations, such as eczema patients and pregnant women. To date, they have only been approved for pre-exposure prophylaxis in monkey pox high exposure individuals, and not for general public use. Thus, in the context of reduced immunity of the world's smallpox, there is an urgent need for a safer, more effective new vaccine against the potentially increased monkey pox epidemic.
The monkey poxvirus has a large and complex proteome containing more than 200 proteins. There are two main modes of infection for monkey poxviruses, extracellular membrane viruses (EEVs) and Intracellular Mature Viruses (IMVs), and screening for appropriate recombinant viral subunit vaccines from surface antigens of EEVs and IMVs may be a highly efficient and safe technique.
CN116102663a discloses a monkey poxvirus B6R antigen, its preparation method and application.
CN116024265A discloses a method for preparing monkey poxvirus M1R antigen secretion protein and nucleic acid molecules used therefor.
CN116603060a discloses a monkey pox virus subunit vaccine, a preparation method and application thereof, and relates to the field of biotechnology. The anti-acne virus antigen comprises an antigen and an adjuvant, wherein the antigen components are monkey pox virus antigen proteins M1R, A, L, A, 35R and B6R, and His labels are added to the tail parts of the monkey pox virus antigen proteins M1R, A, 29, L, A and 35R or B6R.
CN116082521a discloses a multi-immunogen chimeric or mixed antigen against poxviruses (particularly monkey poxviruses), the chimeric or mixed antigen comprising three immunogens: (1) a monkey poxvirus a35R protein, (2) a monkey poxvirus M1R protein, and (3) a monkey poxvirus B6R protein, capable of eliciting an immune response against both infectious viral particles, intracellular mature viral particles (IMV) and extracellular enveloped viral particles (EEV).
CN116218879a discloses an mRNA vaccine against orthopoxvirus, which encodes and secretively expresses surface protein M1R, B6R, C19L, E8L, H3L derived from a monkey poxvirus 2022 epidemic strain.
CN116712536a discloses an anti-poxvirus vaccine comprising mRNA of the following antigens and/or fusion antigens: a fusion antigen fused to two or more monkey poxvirus antigens or parts of antigens selected from the group consisting of: a35R, M1R, B R and a29L.
The invention provides a bigeminal recombinant protein for preventing monkey pox, a construction method and application thereof, and aims to solve the problems that the protection effect of the existing inactivated vaccine and attenuated vaccine is unstable, secondary infection is easy to cause, virulence returns and the like. The technology can be used for preparing the subunit vaccine of the monkey pox virus and is applied to the prevention of the monkey pox.
Disclosure of Invention
In certain embodiments, the invention first provides a recombinant protein that is a recombinant protein of a) or b) as follows:
a) The amino acid sequence is a recombinant protein of SEQ ID No. 2;
b) The recombinant protein which can code for the activity of the monkey pox antigen is obtained by substituting and/or deleting and/or adding one or more amino acid residues in the amino acid sequence shown in SEQ ID No. 2.
In certain embodiments, the present invention also provides a biological material associated with the recombinant protein described above, which is any one of the following B1) to B8):
B1 A nucleic acid molecule encoding the recombinant protein of claim 1;
b2 An expression cassette comprising the nucleic acid molecule of B1);
b3 A recombinant vector comprising the nucleic acid molecule of B1),
B4 A recombinant vector comprising the expression cassette of B2);
b5 A recombinant microorganism comprising the nucleic acid molecule of B1);
B6 A recombinant microorganism comprising the expression cassette of B2);
b7 A recombinant microorganism containing the recombinant vector of B3);
B8 A recombinant microorganism comprising the recombinant vector of B4);
In certain embodiments, the vectors include E.coli, yeast expression vectors, and other expression vectors;
in certain embodiments, the recombinant microorganism comprises an engineered bacterium.
In certain embodiments, the nucleic acid molecule is a nucleic acid molecule as set forth in 1) or 2) or 3) or 4) below:
1) The coding sequence is a DNA molecule or a cDNA molecule of SEQ ID No.1 in a sequence table;
2) The nucleic acid sequence is a DNA molecule of SEQ ID No.1 in a sequence table;
3) A cDNA molecule or a genomic DNA molecule having 75% or more identity to the nucleotide sequence defined in 1) or 2) and encoding the recombinant protein;
4) Hybridizing under stringent conditions with the nucleotide sequence defined in 1) or 2) and encoding a cDNA molecule or genomic DNA molecule of the recombinant protein described above.
In certain embodiments, the invention also provides any one of the following uses of the recombinant proteins described above:
c1 Preparing a product for preventing infection of monkey pox virus;
C2 Preventing infection by monkey poxvirus;
c3 Preparing a product for preventing or treating diseases caused by the monkey poxvirus;
c4 Preventing or treating diseases caused by the monkey poxvirus;
c5 Preparing a product for preventing or treating monkey pox caused by infection by a monkey pox virus;
C6 Preventing or treating monkey pox caused by infection with a monkey pox virus;
Optionally, the use is for non-therapeutic purposes.
In certain embodiments, the invention also provides any one of the following applications of the above-described biological material:
c1 Preparing a product for preventing infection of monkey pox virus;
C2 Preventing infection by monkey poxvirus;
c3 Preparing a product for preventing or treating diseases caused by the monkey poxvirus;
c4 Preventing or treating diseases caused by the monkey poxvirus;
c5 Preparing a product for preventing or treating monkey pox caused by infection by a monkey pox virus;
C6 Preventing or treating monkey pox caused by infection with a monkey pox virus;
Optionally, the use is for non-therapeutic purposes.
In certain embodiments, the invention also provides a method for producing a monkey pox vaccine comprising the step of expressing a recombinant protein using the biological material described above.
In certain embodiments, the invention also provides a monkey pox vaccine prepared by the above method.
In certain embodiments, the invention also provides the use of a monkey pox vaccine for the prevention of a monkey pox virus or for the treatment of monkey pox, the use being for non-therapeutic purposes.
Compared with the prior art, the invention has at least the following beneficial effects:
The invention screens proper recombinant virus subunit vaccine from EEV and IMV surface antigen, and the toxicity attack protection rate of immune group shows that the bigeminal fusion recombinant protein can generate 100% immunity protection rate. Is a high-efficiency and safe technical means, and solves the problems of unstable protection effect, easy secondary infection, strong toxicity and the like of the existing inactivated vaccine and the existing attenuated vaccine. The recombinant protein and the biological material can be used for preparing a monkey pox virus subunit vaccine and can be applied to the prevention of monkey pox.
Drawings
FIG. 1 purified polyacrylamide gel electrophoresis analysis of recombinant protein L1R-Plinker-EEV1-HIS 6. 1. Before IPTG induction; 2. ultrasonic disruption of bacterial precipitate after IPTG induction; 3. ultrasonically crushing a bacterial supernatant after IPTG induction; 4. elution with 50mM imidazole; 5. elution with 100mM imidazole; 6. elution with 200mM imidazole; 7. elution with 300mM imidazole; m: protein molecular weight indicates standard.
FIG. 2 antibody titres of the bivalent fusion recombinant protein L1R-Plinker-EEV1-HIS 6 after immunization of mice.
Detailed Description
In order to make the technical problems, technical solutions and advantages to be solved more apparent, the following detailed description will be given with reference to the accompanying drawings and specific embodiments.
Example 1
1. Obtaining monkey pox antigen gene sequences from NCBI database and codon optimizing same
One candidate antigen (IMV membrane protein L R and EEV type-I membrane glycoprotein, respectively) was selected from each of the monkey pox virus Intracellular Mature Virus (IMV) and extracellular membrane virus (EEV) surface antigens. Extracting IMV membrane protein L R and EEV type-I membrane glycoprotein gene data, removing a transmembrane region sequence, performing gene synthesis, connecting the two sequences by using a linker sequence, constructing a bivalent recombinant protein subunit vaccine gene expression sequence, and performing artificial synthesis. The nucleotide sequence of the coding gene of the duplex fusion recombinant protein is shown as SEQ ID NO. 1.
SEQ ID NO.1：
ATGGGTGCAGCCGCCTCCTTCCAGACAACCGTGAACACCCTGTACG
AGAGAATCTCTTCCAAGCTGGAGCAAGAGGCAAATGCGTCTGCAAAGA
CCAAATGCCACATCGAAATTGGTAACTTCTACATCAGACAGAACCATGGC
TGCAATATCACCGTGAAGAACATGTGTAGCGCGGATGCAGACGCCCAGC
TCGATGCTGTTCTGTCTGCTGCGACAGAGACATATAGCGGACTGACACCA
GAGCAGAAGGCATATGTGCCCGCCATGTTCACCGCAGCACTGAACATTC
AGACCTCTGTGAATACCGTGGTTCGTGATTTTGAGAACTACGTGAAGCA
GACCTGTAATTCCAGTGCCGTGGTTGATAACAAGCTGAAGATTCAGAATG
TTATCATCGATGAATGTTATGGCGCTCCTGGTAGTCCGACCAATCTGGAAT
TTATTAACACGGGCAGCAGTAAAGGCAATTGTGCCATCAAGGCTCTGATG
CAGCTGACTACCAAGGCAACCACCCAGATCGCGCCGCGTCAGGTGGCTG
GCACCGGCGTCCAGGCCGAAGCCGCAGCCAAAGAAGCAGCGGCCAAG
GAGGCCGCTGCTAAGGAGGCCGCCGCAAAAGCGCTGGAAGCAGAGGCC
GCGGCAAAAGAAGCTGCGGCAAAAGAAGCAGCAGCAAAAGAAGCAGC
CGCTAAGGCCATGAAGACCATTTCCGTGGTTACCCTGCTGTGTGTTCTGC
CTGCCGTTGTTTATAGTACCTGTACCGTACCGACCATGAACAACGCGAAA
CTGACCAGCACCGAGACCAGCTTCAACGACAAACAGAAAGTGACCTTT
ACCTGTGACTCCGGTTACCATTCTCTGGACCCGCCTGCTGTTTGCGAGAC
AGACAAGTGGAAATACGAAAACCCGTGTAAACGGATGTGCACTGTTTCG
GATTATGTTAGCGAACTGTATGACAAGCCTCTGTATGAAGTTAATTCCACC
ATGACCCTGAGCTGCAATGGTGAAACCAAATATTTTAGATGCGAAGAAA
AAAATGGCAATACTTCCTGGAACGACACCGTGACCTGTCCTCGCGCCGA
ATGCCAGCCTCTCCAGCTGGAACATGGTAGCTGTCAGCCGGTTAAAGAA
AAATATAGCTTTGGTGAGTACATGACCATCAACTGTGATGTCGGCTACGA
AGTGATTGGTGTGAGCTACATCTCATGTACAGCCAATAGCTGGAACGTCA
TCCCAAGTTGCCAGCAGAAGTGCGATATTCCGTCCCTAAGTAATGGTCTG
ATCAGCGGTAGCACCTTTTCCATTGGCGGAGTGATCCACCTGTCTTGTAA
AAGCGGCTTTACACTGACCGGTAGCCCTAGCAGCACCTGCATTGATGGC
AAGTGGAACCCCATTCTGCCGACCTGCGTTAGATCCAACGAGGAATTTG
ATCCTGTGGATGATGGTCCGGATGATGAGACCGACCTGTCTAAGCTGTCT
AAGGATGTCGTGCAGTATGAACAAGAGATCGAATCCCTGGAAGCAACCTACCAC；
The recombinant protein for preventing monkey pox is a bivalent fusion recombinant protein L1R-Plinker-EEV1, and the amino acid sequence of the recombinant protein is shown as SEQ ID NO. 2.
SEQ ID NO.2：
MGAAASFQTTVNTLYERISSKLEQEANASAKTKCHIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTGVQAEAAAKEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKEAAAKAMKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPPAVCETDKWKYENPCKRMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPRAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH;
2. Constructing a codon-optimized bigeminal recombinant protein coding gene into a recombinant protein expression vector:
(1) Using a rigid protein linker: a (EAAAK) 4ALEA(EAAAK)4 A, the IMV membrane protein L R gene and the EEV type-I membrane glycoprotein gene after codon optimization are connected to obtain the expression gene sequence of the bigeminal fusion recombinant protein L1R-Plinker-EEV 1.
(2) The DNA was chemically synthesized and cloned into the prokaryotic expression vector pET28 a.
3. The invention relates to a bigeminal recombinant protein induction expression method for preventing monkey pox, which comprises the following steps:
Transferring the recombinant expression vector pET28a-L1R-Plinker-EEV1 into competent cells of E.coli Rosetta (DE 3) to obtain E.coli genetic engineering expression strain Ec-L1R-Plinker-EEV1 capable of expressing the multi-fusion recombinant protein L1R-Plinker-EEV1, and purifying by IPTG induced expression and Ni column affinity chromatography to obtain the recombinant protein L1R-Plinker-EEV1-HIS 6. The purified L1R-Plinker-EEV1-HIS 6 recombinant protein was analyzed by SDS-PAGE electrophoresis, as shown in FIG. 1.
The induction expression method of the recombinant protein specifically comprises the following steps:
(1) After the gene engineering expression bacteria Ec-L1R-Plinker-EEV1 are induced to express by IPTG, lysozyme is added, bacterial cells are crushed by ultrasound, and bacterial liquid after ultrasound is centrifuged for 30min at the temperature of 12000g and 4 ℃, and the supernatant is collected.
(2) Combining the supernatant after centrifugation with a nickel column; washing the column with eluting buffer to remove impurity protein; eluting the impurity protein with an elution buffer containing 50mM imidazole and an elution buffer containing 100mM imidazole respectively; the target protein was eluted with elution buffer containing 200mM and 300mM imidazole, and the protein eluate was collected.
(3) And (3) loading the collected protein eluent into a dialysis bag, immersing the dialysis bag into PBS for 3-4 times, changing the PBS for dialysis every 3 hours, and concentrating by using an ultrafiltration tube after the dialysis is finished to obtain the purified target protein L1R-Plinker-EEV1-HIS 6.
(4) The purified target protein concentration was measured using BCA protein concentration measurement kit.
3. Preparation and immunoprotection analysis experiment of monkey pox genetic engineering recombinant bivalent subunit vaccine
(1) Preparation of subunit vaccine
Diluting the purified bigeminal fusion recombinant protein L1R-Plinker-EEV1-HIS 6 to 100 mu-F/ml, and uniformly mixing with aluminum hydroxide gel according to a volume ratio of 1:1 to prepare the subunit vaccine.
(2) Subunit vaccine immunogenicity analysis experiment
SPF grade C57/BL6 mice of 4 weeks old are divided into 6 groups, 6 mice in each group, subunit vaccines prepared by immunizing the bivalent fusion recombinant protein respectively in the first 5 groups are immune groups, the 6 th group is PBS control group, and PBS with the same volume is injected. Immunization was emulsified with an equal volume of aluminum hydroxide gel, the immunization period was 7 days, the immunization schedule was 4 immunizations, and the immunization regimen was leg intramuscular inoculation. Serum samples of immunized mice were collected weekly for antibody titer change level detection starting one week after the first immunization of the mice by tail-end blood collection, and the serum was tested for antibody titer by indirect ELISA and analyzed for statistics and data by GRAPHPAD PRISM software. The results are shown in figure 2, and the result shows that the subunit vaccine prepared by the bigeminal fusion recombinant protein can stimulate the organism to produce antibodies, and the antibodies have long maintenance time, which indicates that the prepared bigeminal fusion recombinant protein has good immunogenicity and can stimulate the organism to produce the antibodies with strong binding capacity and long maintenance time.
FIG. 2 shows the determination of antibody titers of anti-L1R and anti-EEV1 in the serum of mice on days 0,7, 14, 21, 28, respectively, after immunization of mice with the bivalent fusion recombinant protein L1R-Plinker-EEV1-HIS 6. And statistical and data analysis was performed using GraphPadPrism 9 software. As a result, the subunit vaccine prepared by the bigeminal fusion recombinant protein can effectively stimulate the organism to produce protective antibodies. p <0.05 represents the statistical difference. In the upper graph, p <0.01; * Represents p <0.001; * P <0.0001.
(3) Subunit vaccine immunoprotection experiments
① Experimental mice grouping and immunization
Negative control (PBS group): and injecting PBS into the virus-fighting group.
Experimental group (vaccine group): and (3) injecting a bivalent subunit vaccine into the virus-attacking group.
② Toxicity attack protective experiment
After 4 immunizations, negative control (PBS group) and experimental group were given intramuscular injections of lethal doses of VACV virus (5 x 10 6 PFU/mouse). One week after the challenge, mice were observed daily for survival symptoms, mice weight and death recorded, the dead mice were examined by dissection, and lesions were observed. The results of the toxicity attack protection experiment are shown in table 1. The toxicity attack protection rate of the immune group indicates that the bigeminal fusion recombinant protein can generate 100% of the immune protection rate.
TABLE 1 toxicity counteracting protective test results
While the foregoing is directed to the preferred embodiments of the present invention, it will be appreciated by those skilled in the art that various modifications and adaptations can be made without departing from the principles of the present invention, and such modifications and adaptations are intended to be comprehended within the scope of the present invention.
Claims (10)
1. A recombinant protein which is a recombinant protein of the following a) or b):
a) The amino acid sequence is a recombinant protein of SEQ ID No. 2;
b) The recombinant protein which can code for the activity of the monkey pox antigen is obtained by substituting and/or deleting and/or adding one or more amino acid residues in the amino acid sequence shown in SEQ ID No. 2.
2. The biomaterial associated with the recombinant protein of claim 1, which is any one of the following B1) to B8):
B1 A nucleic acid molecule encoding the recombinant protein of claim 1;
b2 An expression cassette comprising the nucleic acid molecule of B1);
b3 A recombinant vector comprising the nucleic acid molecule of B1),
B4 A recombinant vector comprising the expression cassette of B2);
b5 A recombinant microorganism comprising the nucleic acid molecule of B1);
B6 A recombinant microorganism comprising the expression cassette of B2);
b7 A recombinant microorganism containing the recombinant vector of B3);
B8 A recombinant microorganism containing the recombinant vector of B4).
3. The biomaterial according to claim 2, characterized in that: the vectors include E.coli, yeast expression vectors, and other expression vectors.
4. The biomaterial according to claim 2, characterized in that: the recombinant microorganism comprises engineering bacteria.
5. The biomaterial according to claim 2, characterized in that: the nucleic acid molecule is as shown in the following 1) or 2) or 3) or 4):
1) The coding sequence is a DNA molecule or a cDNA molecule of SEQ ID No.1 in a sequence table;
2) The nucleic acid sequence is a DNA molecule of SEQ ID No.1 in a sequence table;
3) A cDNA molecule or a genomic DNA molecule having 75% or more identity to the nucleotide sequence defined in 1) or 2) and encoding the recombinant protein of claim 1;
4) Hybridizing under stringent conditions to the nucleotide sequence defined in 1) or 2) and encoding a cDNA molecule or a genomic DNA molecule of the recombinant protein according to claim 1.
6. Use of the recombinant protein of claim 1 for any of the following:
c1 Preparing a product for preventing infection of monkey pox virus;
C2 Preventing infection by monkey poxvirus;
c3 Preparing a product for preventing or treating diseases caused by the monkey poxvirus;
c4 Preventing or treating diseases caused by the monkey poxvirus;
c5 Preparing a product for preventing or treating monkey pox caused by infection by a monkey pox virus;
C6 Preventing or treating monkey pox caused by infection with a monkey pox virus;
Optionally, the use is for non-therapeutic purposes.
7. Use of the biomaterial of claim 2 for any one of the following:
c1 Preparing a product for preventing infection of monkey pox virus;
C2 Preventing infection by monkey poxvirus;
c3 Preparing a product for preventing or treating diseases caused by the monkey poxvirus;
c4 Preventing or treating diseases caused by the monkey poxvirus;
c5 Preparing a product for preventing or treating monkey pox caused by infection by a monkey pox virus;
C6 Preventing or treating monkey pox caused by infection with a monkey pox virus;
Optionally, the use is for non-therapeutic purposes.
8. A method for producing a monkey pox vaccine comprising the step of expressing a recombinant protein using the biomaterial according to claim 2.
9. A monkey pox vaccine prepared by the method of claim 8.
10. Use of a monkey pox vaccine, wherein the use is for the prevention of a monkey pox virus or the treatment of a monkey pox, the use being for non-therapeutic purposes.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202410340321.XA CN117986388A (en) | 2024-03-25 | 2024-03-25 | Recombinant protein, monkey pox vaccine and preparation method and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202410340321.XA CN117986388A (en) | 2024-03-25 | 2024-03-25 | Recombinant protein, monkey pox vaccine and preparation method and application thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN117986388A true CN117986388A (en) | 2024-05-07 |
Family
ID=90899385
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202410340321.XA Pending CN117986388A (en) | 2024-03-25 | 2024-03-25 | Recombinant protein, monkey pox vaccine and preparation method and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN117986388A (en) |
-
2024
- 2024-03-25 CN CN202410340321.XA patent/CN117986388A/en active Pending
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN113164586B (en) | Immune composition and preparation method and application thereof | |
| CN111018996A (en) | Neutralizing epitope subunit vaccine for African swine fever | |
| CN102154325B (en) | Vaccine against human papillomavirus (HPV) as well as preparation method and application thereof | |
| CN110684116B (en) | Mycobacterium tuberculosis EEC fusion protein, preparation method and application thereof | |
| CN108273054B (en) | Porcine foot-and-mouth disease virus O-type and A-type Fc polypeptide bivalent vaccine as well as preparation method and application thereof | |
| CN113845576B (en) | Recombinant feline herpesvirus type 1 gB-gD protein and application thereof | |
| CN110327461A (en) | A kind of preparation method and applications of porcine pseudorabies virus subunit vaccine | |
| CN115043948A (en) | Hemopox virus specific fusion protein antigen and preparation method and application thereof | |
| JPH05505616A (en) | Purified gp120 composition retaining native conformation | |
| CN108503696B (en) | Zika virus subunit vaccine expressed by yeast cells | |
| CN112812193A (en) | Recombinant protein vaccine of norovirus GII.4 type and enterovirus 71 type | |
| CN113350495A (en) | Streptococcus suis-haemophilus parasuis disease-porcine infectious pleuropneumonia triple subunit vaccine and preparation method thereof | |
| CN102586287A (en) | HPV16L1 polynucleotide sequence and expression vector, host cell and application thereof | |
| CN116003540B (en) | Preparation and application of mycobacterium tuberculosis antigen composition PFHP010 | |
| CN115073565B (en) | Recombinant novel coronavirus S protein trimer and preparation method and application thereof | |
| CN114437236B (en) | Recombinant African swine fever virus multi-epitope fusion protein, preparation and application thereof | |
| CN117986388A (en) | Recombinant protein, monkey pox vaccine and preparation method and application thereof | |
| CN113832168B (en) | mRNA vaccine and preparation method and application thereof | |
| CN108330134B (en) | O-type Fc polypeptide vaccine of swine foot-and-mouth disease virus and preparation method and application thereof | |
| CN114805600B (en) | VLPs of porcine circovirus type 2d frame chimeric antigen epitope of porcine foot-and-mouth disease virus, and preparation method and application thereof | |
| CN103740736B (en) | The HSV2 virus gE glucoprotein extracellular region gene fragment of chemosynthesis and expression, application | |
| CN110407944B (en) | Cryptosporidium multi-epitope gene fragment cpmcef, fusion protein and application thereof | |
| CN114306589B (en) | Recombinant African swine fever virus antigen cocktail vaccine and application | |
| CN114377121B (en) | Recombinant African swine fever antigen cocktail vaccine containing intramolecular adjuvant and application thereof | |
| CN113461828B (en) | Recombinant protein vaccine for 2019-nCoV and preparation method thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination |