CN117820471A - GFAP specific antibody and application thereof in GFAP detection kit - Google Patents
GFAP specific antibody and application thereof in GFAP detection kit Download PDFInfo
- Publication number
- CN117820471A CN117820471A CN202410247761.0A CN202410247761A CN117820471A CN 117820471 A CN117820471 A CN 117820471A CN 202410247761 A CN202410247761 A CN 202410247761A CN 117820471 A CN117820471 A CN 117820471A
- Authority
- CN
- China
- Prior art keywords
- antibody
- seq
- gfap
- amino acid
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 101710193519 Glial fibrillary acidic protein Proteins 0.000 title claims abstract description 70
- 102100039289 Glial fibrillary acidic protein Human genes 0.000 title claims abstract description 67
- 210000005046 glial fibrillary acidic protein Anatomy 0.000 title claims abstract description 66
- 238000001514 detection method Methods 0.000 title abstract description 33
- 239000000427 antigen Substances 0.000 claims abstract description 44
- 102000036639 antigens Human genes 0.000 claims abstract description 44
- 108091007433 antigens Proteins 0.000 claims abstract description 44
- 239000012634 fragment Substances 0.000 claims abstract description 31
- 108091033319 polynucleotide Proteins 0.000 claims abstract description 6
- 102000040430 polynucleotide Human genes 0.000 claims abstract description 6
- 239000002157 polynucleotide Substances 0.000 claims abstract description 6
- 238000003745 diagnosis Methods 0.000 claims abstract description 4
- 201000010099 disease Diseases 0.000 claims abstract description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 4
- 238000002360 preparation method Methods 0.000 claims description 11
- 239000011324 bead Substances 0.000 claims description 5
- 108010001336 Horseradish Peroxidase Proteins 0.000 claims description 4
- 239000005081 chemiluminescent agent Substances 0.000 claims description 4
- 102000002260 Alkaline Phosphatase Human genes 0.000 claims description 3
- 108020004774 Alkaline Phosphatase Proteins 0.000 claims description 3
- DZBUGLKDJFMEHC-UHFFFAOYSA-N acridine Chemical class C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 claims description 3
- 125000003275 alpha amino acid group Chemical group 0.000 claims 13
- 210000004027 cell Anatomy 0.000 abstract description 39
- 238000000034 method Methods 0.000 abstract description 10
- 239000013598 vector Substances 0.000 abstract description 10
- 239000003814 drug Substances 0.000 abstract description 2
- 229940079593 drug Drugs 0.000 abstract description 2
- 150000001413 amino acids Chemical group 0.000 description 49
- 108090000623 proteins and genes Proteins 0.000 description 39
- 210000003719 b-lymphocyte Anatomy 0.000 description 19
- 238000012216 screening Methods 0.000 description 17
- 241000283973 Oryctolagus cuniculus Species 0.000 description 16
- 238000003752 polymerase chain reaction Methods 0.000 description 15
- 102000004169 proteins and genes Human genes 0.000 description 15
- 229920001184 polypeptide Polymers 0.000 description 13
- 108090000765 processed proteins & peptides Proteins 0.000 description 13
- 102000004196 processed proteins & peptides Human genes 0.000 description 13
- 239000006228 supernatant Substances 0.000 description 12
- 238000002965 ELISA Methods 0.000 description 11
- 238000002474 experimental method Methods 0.000 description 11
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 description 8
- 108091026890 Coding region Proteins 0.000 description 8
- 238000003259 recombinant expression Methods 0.000 description 8
- 230000001580 bacterial effect Effects 0.000 description 7
- 239000002299 complementary DNA Substances 0.000 description 7
- 230000003053 immunization Effects 0.000 description 7
- 108020004707 nucleic acids Proteins 0.000 description 7
- 102000039446 nucleic acids Human genes 0.000 description 7
- 150000007523 nucleic acids Chemical class 0.000 description 7
- 238000002649 immunization Methods 0.000 description 6
- 230000002163 immunogen Effects 0.000 description 6
- 239000013612 plasmid Substances 0.000 description 6
- 239000011148 porous material Substances 0.000 description 6
- 230000003321 amplification Effects 0.000 description 5
- 239000006285 cell suspension Substances 0.000 description 5
- 238000002156 mixing Methods 0.000 description 5
- 238000003199 nucleic acid amplification method Methods 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 238000003786 synthesis reaction Methods 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 238000010276 construction Methods 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 239000013613 expression plasmid Substances 0.000 description 4
- 239000013604 expression vector Substances 0.000 description 4
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 4
- 238000002372 labelling Methods 0.000 description 4
- 210000004698 lymphocyte Anatomy 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 238000003118 sandwich ELISA Methods 0.000 description 4
- 210000000952 spleen Anatomy 0.000 description 4
- 102000053171 Glial Fibrillary Acidic Human genes 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 239000007853 buffer solution Substances 0.000 description 3
- 238000002038 chemiluminescence detection Methods 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 230000008878 coupling Effects 0.000 description 3
- 238000010168 coupling process Methods 0.000 description 3
- 238000005859 coupling reaction Methods 0.000 description 3
- 239000003995 emulsifying agent Substances 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 2
- 101800000263 Acidic protein Proteins 0.000 description 2
- 230000004544 DNA amplification Effects 0.000 description 2
- -1 acridine ester Chemical class 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 230000003619 fibrillary effect Effects 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 238000000227 grinding Methods 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 230000003902 lesion Effects 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 230000023105 myelination Effects 0.000 description 2
- 210000005036 nerve Anatomy 0.000 description 2
- RXNXLAHQOVLMIE-UHFFFAOYSA-N phenyl 10-methylacridin-10-ium-9-carboxylate Chemical compound C12=CC=CC=C2[N+](C)=C2C=CC=CC2=C1C(=O)OC1=CC=CC=C1 RXNXLAHQOVLMIE-UHFFFAOYSA-N 0.000 description 2
- 230000009257 reactivity Effects 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 238000010839 reverse transcription Methods 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 241000283707 Capra Species 0.000 description 1
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000620209 Escherichia coli DH5[alpha] Species 0.000 description 1
- 206010018341 Gliosis Diseases 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 206010061216 Infarction Diseases 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 101710180012 Protease 7 Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 239000006180 TBST buffer Substances 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 235000011089 carbon dioxide Nutrition 0.000 description 1
- 230000021164 cell adhesion Effects 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000009087 cell motility Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 206010008118 cerebral infarction Diseases 0.000 description 1
- 208000026106 cerebrovascular disease Diseases 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 210000001612 chondrocyte Anatomy 0.000 description 1
- 238000013377 clone selection method Methods 0.000 description 1
- 238000012411 cloning technique Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 230000003436 cytoskeletal effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 208000016361 genetic disease Diseases 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 230000007387 gliosis Effects 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 210000004024 hepatic stellate cell Anatomy 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000007574 infarction Effects 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 238000011587 new zealand white rabbit Methods 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 239000003761 preservation solution Substances 0.000 description 1
- 208000020016 psychiatric disease Diseases 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000008521 reorganization Effects 0.000 description 1
- 239000012898 sample dilution Substances 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 230000003977 synaptic function Effects 0.000 description 1
- 230000001360 synchronised effect Effects 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
Landscapes
- Peptides Or Proteins (AREA)
Abstract
The application discloses a GFAP specific antibody and application thereof in a GFAP detection kit, and belongs to the technical field of biological medicines. The present application provides an antibody or antigen-binding fragment thereof that specifically binds to GFAP, and also provides polynucleotides encoding the antibodies or antigen-binding fragments, vectors comprising the polynucleotides, host cells comprising the vectors, methods of making the antibodies or antigen-binding fragments, and kits for detecting GFAP proteins. The detection kit provided by the application can be used for auxiliary diagnosis of diseases related to GFAP.
Description
Technical Field
The application belongs to the technical field of biological medicines, and relates to an antibody targeting GFAP, a preparation method and a kit for detecting GFAP.
Background
GFAP is rich in glutamate and aspartate, has little distribution in chondrocytes, fibroblasts, myoepithelial cells, lymphocytes, hepatic stellate cells, but is mainly present in AST of the central nervous system, being the main framework protein in AST. GFAP is specifically expressed in AST and is a marker protein thereof, and is considered as a specific marker for AST maturation activation. It forms a link between the nucleus and the cell membrane, and is involved in cytoskeletal reorganization, cell adhesion, maintenance of structures of myelination and neurons in the brain, and also involved in cell movement migration and cell proliferation as a cell signal involved in transduction pathways, etc. Has the functions of maintaining stable AST morphology, participating in blood brain barrier and myelination, regulating synaptic function and the like.
Several studies have shown that abnormal levels of GFAP expression are associated with various genetic and psychiatric disorders, levels of GFAP are associated with stroke, and gliosis is accompanied by increased GFAP expression. GFAP levels can reflect the size of cerebral infarction lesions, with higher GFAP levels in plasma leading to greater infarct lesions and positive correlation of both. Furthermore, GFAP levels are also related to the extent of nerve function damage, the higher the GFAP level in plasma, the more severe the nerve function damage.
The most commonly used detection methods for GFAP in clinic are enzyme-linked immunosorbent assay (ELISA) and Chemiluminescence (CLIA), electrochemiluminescence and liquid chromatography. The performance of the GFAP specific antibodies used in the detection method directly determines the sensitivity and specificity of the detection.
Therefore, it is found that a monoclonal antibody against GFAP protein having high binding specificity is of great importance for detecting the expression level of GFAP.
Disclosure of Invention
The application provides a monoclonal antibody for recognizing glial fibrillary acidic protein and application thereof in a chemiluminescent immunoassay kit, and provides a tool for auxiliary diagnosis of diseases related to the glial fibrillary acidic protein (namely GFAP).
In one aspect, the present application provides an antibody or antigen-binding fragment thereof that specifically binds GFAP.
In some embodiments, the antibody or antigen binding fragment comprises at least one, two, three, four, five, or six CDRs selected from the group consisting of: (a) comprises a sequence identical to SEQ ID NO:1, CDR-H1 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of seq id no; (b) comprises a sequence identical to SEQ ID NO:2, CDR-H2 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of seq id no; (c) comprises a sequence identical to SEQ ID NO:3, CDR-H3 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of seq id no; (d) comprises a sequence identical to SEQ ID NO:4, CDR-L1 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of seq id no; (e) Comprising CDR-L2 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of RAS; and (f) comprises a sequence identical to SEQ ID NO:5, has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the CDR-L3.
In some embodiments, the antibody or antigen-binding fragment comprises at least one, at least two, or all three VH CDR sequences selected from the group consisting of: (a) comprises a sequence identical to SEQ ID NO:1, CDR-H1 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of seq id no; (b) comprises a sequence identical to SEQ ID NO:2, CDR-H2 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of seq id no; and (c) comprises a sequence identical to SEQ ID NO:3, has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the CDR-H3. In some embodiments, the antibody or antigen binding fragment comprises (a) a polypeptide comprising SEQ ID NO:1, CDR-H1 of the amino acid sequence of seq id no; (b) a polypeptide comprising SEQ ID NO:2, CDR-H2 of the amino acid sequence of seq id no; and (c) a polypeptide comprising SEQ ID NO:3, and CDR-H3 of the amino acid sequence of seq id no.
In some embodiments, the antibody or antigen binding fragment comprises at least one, at least two, or all three VL CDR sequences selected from the group consisting of: (a) comprises a sequence identical to SEQ ID NO:4, CDR-L1 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of seq id no; (b) Comprising CDR-L2 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of RAS; and (c) comprises a sequence identical to SEQ ID NO:5, has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the CDR-L3. In some embodiments, the antibody or antigen binding fragment comprises (a) a polypeptide comprising a sequence identical to SEQ ID NO:4, CDR-L1 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of seq id no; (b) Comprising CDR-L2 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of RAS; and (c) comprises a sequence identical to SEQ ID NO:5, has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the CDR-L3.
In some embodiments, the antibody or antigen-binding fragment comprises (a) a VH domain comprising at least one, at least two, or all three VH CDR sequences selected from the group consisting of: (i) comprises a sequence identical to SEQ ID NO:1, CDR-H1 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of seq id no; (ii) comprises a sequence identical to SEQ ID NO:2, CDR-H2 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of seq id no; (iii) comprises a sequence identical to SEQ ID NO:3, CDR-H3 having an amino acid sequence with at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity; and (b) a VL domain comprising at least one, at least two, or all three VL CDR sequences selected from the group consisting of: (i) comprises a sequence identical to SEQ ID NO:4, CDR-L1 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of seq id no; (ii) Comprising CDR-L2 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of RAS; and (iii) comprises a sequence identical to SEQ ID NO:5, has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the CDR-L3.
In some embodiments, the antibody or antigen binding fragment comprises (a) a polypeptide comprising SEQ ID NO:1, CDR-H1 of the amino acid sequence of seq id no; (b) a polypeptide comprising SEQ ID NO:2, CDR-H2 of the amino acid sequence of seq id no; (c) a polypeptide comprising SEQ ID NO:3, CDR-H3 of the amino acid sequence of seq id no; (d) a polypeptide comprising SEQ ID NO:4, CDR-L1 of the amino acid sequence of seq id no; (e) CDR-L2 comprising the amino acid sequence of RAS; and (f) comprises a sequence selected from the group consisting of SEQ ID NOs: 5, and CDR-L3 of the amino acid sequence of seq id no.
In some embodiments, the antibody or antigen binding fragment comprises a sequence that hybridizes to SEQ ID NO:6, a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity. In some embodiments, VH sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identity contain substitutions (e.g., conservative substitutions), insertions, or deletions relative to a reference sequence, but anti-GFAP antibodies comprising the sequences retain the ability to bind GFAP. In one embodiment, the VH comprises one, two or three CDRs selected from the group consisting of: (a) a polypeptide comprising SEQ ID NO:1, CDR-H1 of the amino acid sequence of seq id no; (b) a polypeptide comprising SEQ ID NO:2, CDR-H2 of the amino acid sequence of seq id no; and (c) a polypeptide comprising SEQ ID NO:3, and CDR-H3 of the amino acid sequence of seq id no.
In some embodiments, the antibody or antigen binding fragment comprises a sequence that hybridizes to SEQ ID NO:7, a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity. In some embodiments, VL sequences that have at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contain substitutions (e.g., conservative substitutions), insertions, or deletions relative to a reference sequence, but anti-GFAP antibodies comprising the sequences retain the ability to bind GFAP. In some embodiments, the VL comprises one, two, or three CDRs selected from the group consisting of: (a) a polypeptide comprising SEQ ID NO:4, CDR-L1 of the amino acid sequence of seq id no; (b) CDR-L2 comprising the amino acid sequence of RAS; and (c) a polypeptide comprising SEQ ID NO:5, and CDR-L3 of the amino acid sequence of seq id no.
In some embodiments, the antibody or antigen-binding fragment comprises a VH in any of the embodiments provided above, and a VL in any of the embodiments provided above. In some embodiments, the antibody comprises the sequences as set forth in SEQ ID NO:6 and SEQ ID NO:7, including post-translational modifications of those sequences.
In one aspect, the present application provides a polynucleotide encoding an antibody or antigen-binding fragment of the present application.
In one aspect, the present application provides a vector comprising a polynucleotide of the present application.
In some embodiments, an isolated nucleic acid encoding an anti-GFAP antibody described herein is provided. Such nucleic acids may encode amino acid sequences comprising the VL of an antibody and/or amino acid sequences comprising the VH of an antibody (e.g., the light chain and/or heavy chain of an antibody). In some embodiments, one or more vectors (e.g., expression vectors) comprising such nucleic acids are provided.
In one aspect, the present application provides a host cell comprising a polynucleotide or vector of the present application.
In some embodiments, the host cell comprises: (1) A vector comprising a nucleic acid encoding an amino acid sequence comprising an antibody VL and an amino acid sequence comprising an antibody VH; or (2) a first vector comprising a nucleic acid encoding an amino acid sequence comprising an antibody VL and a second vector comprising a nucleic acid encoding an amino acid sequence comprising an antibody VH. In some embodiments, the host cell is a eukaryotic cell and the host cell is a 293 cell. In some embodiments, a method of making an anti-GFAP antibody is provided, wherein the method comprises culturing a host cell comprising a nucleic acid encoding the antibody as provided above under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
In one aspect, the present application provides a kit for detecting GFAP.
In some embodiments, the kit comprises an antibody or antigen binding fragment of the present application. In some embodiments, the kit detects GFAP in a non-diagnostic purpose of immunodetection. In some embodiments, the kit is a chemiluminescent method, an electrochemiluminescent method, an ELISA. In some embodiments, the kit is a chemiluminescent immunoassay kit of the double antibody sandwich principle comprising: magnetic beads coated with a primary antibody targeting GFAP; a secondary antibody labeled with a chemiluminescent agent that targets GFAP. In some embodiments, the chemiluminescent agent is selected from at least one of acridinium ester, alkaline phosphatase (ALP), horseradish peroxidase (HRP).
In some embodiments, one antibody of the pair of first and second antibodies that targets GFAP is selected from the antibodies or antigen binding fragments as described above. In some embodiments, the heavy chain CDRH1-CDRH3 amino acid sequence of the other antibody in the pair of antibodies comprising the first antibody and the second antibody that targets GFAP is as set forth in SEQ ID NO:18-SEQ ID NO:20, the amino acid sequence of the light chain CDRL1 is shown in SEQ ID NO:21, the amino acid sequence of the light chain CDRL2 is DAS, and the amino acid sequence of the light chain CDRL3 is shown in SEQ ID NO: shown at 22. In some embodiments, the other antibody of the pair of first and second antibodies that targets GFAP comprises an amino acid sequence as set forth in SEQ ID NO:16 and a heavy chain variable region VH as set forth in SEQ ID NO:17, and a light chain variable region VL.
In some embodiments, the second antibody is an antibody or antigen-binding fragment described herein, and the heavy chain CDRH1-CDRH3 amino acid sequence of the first antibody is as set forth in SEQ ID NO:18-SEQ ID NO:20, the amino acid sequence of the light chain CDRL1 is shown in SEQ ID NO:21, the amino acid sequence of the light chain CDRL2 is DAS, and the amino acid sequence of the light chain CDRL3 is shown in SEQ ID NO: shown at 22. In some embodiments, the second antibody is an antibody or antigen-binding fragment described herein, and the first antibody comprises an amino acid sequence as set forth in SEQ ID NO:16 and a heavy chain variable region VH as set forth in SEQ ID NO:17, and a light chain variable region VL.
In one aspect, the application provides the use of an antibody or antigen binding fragment as described above in the preparation of a reagent or kit for detecting GFAP. In one aspect, the application provides the use of an antibody or antigen binding fragment as described above in the preparation of a kit for aiding in the diagnosis of a GFAP related disease.
In one aspect, the present application provides a method for preparing an antibody or antigen binding fragment as described above, specifically prepared using a single B cell antibody cloning technique, comprising the steps of:
(1) Immunizing rabbits with GFAP as immunogen, collecting spleen after the immunization is finished, and separating spleen cells;
(2) Screening specific B lymphocytes, extracting total RNA of the B lymphocytes, synthesizing cDNA (complementary deoxyribonucleic acid), and obtaining antibody variable region and constant region sequences by PCR (polymerase chain reaction);
(3) Inserting the amplified antibody genes into a recombinant expression vector, and transfecting 293 cells;
(4) Collecting and purifying culture supernatant to obtain monoclonal antibody.
Further, the amino acid sequence of the GFAP in the step 1) is shown as SEQ ID NO: shown at 8.
Further, the primer sequence used in the PCR in the step 2) is shown in SEQ ID NO: 9-11.
The heavy chain coding region gene of the antibody is amplified, and the forward primer sequence is as follows:
caagctggctagcgtttaaacttgccaccagtcgtatgaagctaagagatc(SEQ ID NO:9)。
the heavy chain coding region gene of the antibody is amplified, and the reverse primer sequence is as follows:
tagtggatccgagctcggtacctcatttacccggagagcg(SEQ ID NO:10)。
the antibody light chain coding region gene is amplified, and the forward primer sequence is as follows:
caagctggctagcgtttaaacttgccaccagtcgtatgaagctaagagatc(SEQ ID NO:9)。
the antibody light chain coding region gene is amplified, and the reverse primer sequence is as follows:
tagtggatccgagctcggtacctcaacagtcacccctattg(SEQ ID NO:11)。
further, the purification of step 4) is specifically: the supernatant was purified by a protease A affinity column.
In one aspect, the present application provides a paired screening method for antibodies or antigen-binding fragments that specifically bind GFAP, specifically using a fixed heavy chain variable region as set forth in SEQ ID NO:16 and the light chain variable region is set forth in SEQ ID NO:17, and screening antibodies or antigen binding fragments by sandwich ELISA assay pairing.
Advantageous effects of the present application
The application provides a novel GFAP-targeted recombinant antibody and a kit containing the recombinant antibody, and the recombinant antibody has high affinity, high sensitivity and obviously shortened production period, and is more suitable for being used as a core raw material in the field of in-vitro diagnostic reagents.
Drawings
FIG. 1 is a graph showing the results of antigen-specific single B cell flow sorting during the preparation of the anti-GFAP monoclonal antibodies of the present application.
FIG. 2 is a graph showing the correlation between the detection result and clinical value of the anti-GFAP monoclonal antibody used for chemiluminescence detection of a quantitative gradient clinical sample.
Detailed Description
The following detailed description of the present disclosure is provided in connection with examples, but the implementation of the present disclosure is not limited thereto, and it is apparent that the examples described below are only some examples of the present disclosure, and that other similar examples are within the scope of protection of the present disclosure without inventive faculty for those skilled in the art.
Unless defined otherwise, all terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains. All patents, patent applications, and publications cited throughout the disclosure are incorporated herein by reference in their entirety. If there are multiple definitions for terms herein, those in this section control.
The technical solutions provided by the present disclosure are described in detail below with reference to examples, but they should not be construed as limiting the scope of the present disclosure.
Example 1: preparation of anti-glial fibrillary acidic protein (Glial fibrillary acidic protein, GFAP) monoclonal antibody
1. Antigen preparation
GFAP, mammalian cell 293F cell expression system was selected in this example, with His tag at C-terminal. The immunogen and the sorting source are the same and are GFAP-His recombinant proteins.
GFAP, sequence:
MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVMGGGGSHHHHHH(SEQ ID NO:8)。
to obtain a GFAP rabbit monoclonal antibody, a New Zealand white rabbit was immunized with 500ug of each of the GFAP-His protein developed independently as an immunogen. For the first immunization, the immunogen is mixed with equivalent Freund's adjuvant to prepare an emulsifier, the emulsifier is prepared by taking 250ug of the immunogen and equivalent Freund's adjuvant at intervals of 3 weeks, and the emulsifier is prepared by subcutaneous multipoint injection and boosting twice. PBMC samples are collected after three immunizations, GFAP-His protein is used as a sorting original package plate, serum titer is measured by ELISA method, and the rabbit with high serum titer is taken, and after 250ug immunogen is subjected to subcutaneous multipoint injection for enhancing immunization once, the spleen of the rabbit is taken.
2. Single B cell suspension preparation
The separation and preparation of rabbit spleen sample lymphocytes is to prepare single cell suspension by physically grinding rabbit spleen and filtering through a porous filter screen. Single cell suspensions were used for cell staining and flow sorting work.
3. Antigen-specific single B cell sorting
Antigen specific single B cell sorting is based on specific recognition of lymphocyte B cell surface characteristic markers by using a flow cell sorting technology, and the acquisition of specific single B cells in lymphocyte suspension is completed.
In this example, the raw coupled FITC dye was selected.
Anti-rabbit IgG secondary antibodies are self-grinding type antibodies. And coupling PE dye.
At the time of cell labeling, DAPI dye was added to differentiate Dead/living cells (Dead/Live cells).
Cell labeling protocol, lymphocyte B cell sorting protocol: read/Live-/IgG+/anti+.
Cell labeling operation: the rabbit lymphocyte suspension is centrifuged for 5min at 300g, 5mL buffer solution is added, the mixture is stirred upside down, and centrifuged for 5min at 300 g. The supernatant was discarded and repeated 1 time, and 30uL of the cell suspension was taken for cell counting, and 40uL of the cell suspension was taken for blank control and single-stained tubes to be labeled. The remaining cell fluid was used as a sample tube, centrifuged at 300g for 5min, and resuspended in a small amount of PBS. The blank tube was left untreated. Single-stained tubes, supplemented with PBS to 100uL, and 2uL PE, 2uL FITC, 2uL DAPI dye were added, respectively. Sample tubes according to PE dye 1.5uL/10 6 Cells, FITC dye 2ug/10 6 The cells were counted, the corresponding antibodies were added in the dark, and left at 4℃for 30min. After the antibody incubation, 2mL buffer solution was added, mixed gently, centrifuged at 300g for 5min, and washed repeatedly 3 times. 1mL buffer solution was resuspended, and after cell filtration, the cells were waited for sorting on the machine.
After fluorescence compensation adjustment, based on the living cell population, PE and FITC double-positive signal cell populations are defined (figure 1), antigen-specific B cells are sorted into 96-well plates, only 1 cell is in each well, the sorted well plates need to be stored at low temperature immediately, and a dry ice box is arranged in the experiment of the embodiment, and the wells can be placed for a short time. The wells contained cell lysates and the sorted 96-well PCR plates were directly subjected to single cell antibody gene amplification.
4. Preparation of rabbit single B cell cDNA
Single B cell cDNA library was prepared based on SMART 5' RACE technology using reagents of Nanjinozan Biotechnology Co., ltd (VAZYME) N711 kit, commercially available. The amplification systems involved in the experiments in the examples are referred to the N711 kit instructions.
Single B cell RNA reverse transcription: after the sorting of the 96-well plates is completed, the plates are thawed and placed in a PCR instrument to run a program, and the plates are placed on ice for 2min after the program is finished.
Single B cell cDNA single-stranded synthesis: after the completion of the reverse transcription reaction procedure, a single-stranded synthesis system may be added. After the system is added, the pore plate is mixed evenly, the mixture is placed in a PCR instrument to run a program, and after the program is finished, the pore plate sample is placed on ice for 2min.
Single B cell DNA double strand synthesis: after the synthesis reaction of the cDNA single-stranded product is completed, a double-stranded synthesis system may be added. After the system is added, the pore plate is mixed evenly, centrifuged and then placed in a PCR instrument to run a program, and after the program is finished, the pore plate sample is placed on ice for standing.
5. Rabbit single B cell PCR technology amplified antibody coding gene
A single B cell cDNA library can be used for preparing the natural paired heavy chain and light chain coding genes of antibody.
The reagents used for the amplification of the coding gene are all kits for the Nanjinozan biotechnology Co., ltd (VAZYME) P515# and are available in the market. The amplification system involved in the experiments in the examples can be referred to the P515 kit instructions.
The upstream primer contains homologous arms overlapping with the 3' -end of the CMV gene sequence of the promoter, so that the antibody coding gene can be directly used for constructing a linear expression frame after being called.
The downstream primer for the heavy chain coding gene of the antibody is positioned at the position of the constant region and comprises a homologous arm overlapped with the BGH-polyA gene sequence.
The downstream primer of the light chain coding gene is positioned at the position of the constant region and contains a homologous arm complementary with the BGH-polyA gene sequence, so that the antibody coding gene can be directly used for constructing a linear expression frame after being called.
The heavy chain coding region gene of the antibody is amplified, and the forward primer sequence is as follows:
caagctggctagcgtttaaacttgccaccagtcgtatgaagctaagagatc(SEQ ID NO:9)。
the heavy chain coding region gene of the antibody is amplified, and the reverse primer sequence is as follows:
tagtggatccgagctcggtacctcatttacccggagagcg(SEQ ID NO:10)。
the antibody light chain coding region gene is amplified, and the forward primer sequence is as follows:
caagctggctagcgtttaaacttgccaccagtcgtatgaagctaagagatc(SEQ ID NO:9)。
the antibody light chain coding region gene is amplified, and the reverse primer sequence is as follows:
tagtggatccgagctcggtacctcaacagtcacccctattg(SEQ ID NO:11)。
modulation of antibody light chain and heavy chain coding genes: adding a PCR amplification system according to the specification, mixing the pore plates lightly, placing the mixture into a PCR instrument to run a program, and standing the pore plate sample on ice after the program is finished.
In the embodiment, the amplification product pairing positive rate of the antibody light chain and heavy chain coding genes in the same 96-well plate is more than 80%, and the detection strips are clear by agarose gel electrophoresis, so that the single B cell flow sorting and coding gene amplification experiments are effective. Amplification products, used for construction of recombinant expression plasmids.
6. Construction and expression of recombinant expression plasmids for heavy and light chains of antibody
Recombinant expression vector pcDNA3.1 (Invitrogen) was selected and purchased at ThermoFisher SCIENTIFIC. Prior to recombinant construction, hindIII restriction enzyme single enzyme was selected to linearize the expression vector and restriction enzymes were purchased on a New England Biolabs functional network.
The vector and the coding gene are recombined efficiently, a seamless cloning kit is selected, and a C115# kit is purchased in a VAZYME functional network.
Construction of recombinant expression plasmids: the amplified products of the heavy chain and the light chain of the antibody are cyclized and connected with pcDNA3.1 linearization vector by using a seamless cloning technology, then Escherichia coli DH5 alpha competent cells are transformed, LB fixed culture medium plates are coated, and the plates are inverted and cultured at 37 ℃ overnight.
Recombinant positive clone selection: the heavy chain and the light chain of the primary screening antibody are respectively picked into 8 single colonies, and the colony positive rate is determined after PCR bacterial detection.
Bacterial detection PCR of the recombinant plasmid, and the upstream primer sequence of the recombinant plasmid is as follows: caagctggctagcgtttaaactt (SEQ ID NO: 12).
The primer sequence of the antibody heavy chain bacterial PCR downstream is as follows: ctcatttacccggagagcg (SEQ ID NO: 13).
The sequence of the primer downstream of the PCR for the light chain bacterial detection of the antibody is as follows: acctcaacagtcacccctattg (SEQ ID NO: 14).
Recombinant positive clones were sent: and 5 bacterial PCR positive clones are selected from the heavy chain and the light chain of the antibody and sent to Shanghai biological company for sequencing.
Analysis of rabbit antibody gene sequences: and (3) finishing gene determination of the antibody sequence V region by using an IMGT database, finishing analysis of antibody sequences by using antibody heavy chain and light chain CDR1/CDR2/CDR3 regions and the like, and deriving and determining correct sequence numbers of bacterial detection PCR positive clones.
Small expression of recombinant expression plasmids: cloning the correct sequence, and extracting the light chain and heavy chain plasmids of the antibody from the bacterial liquid in a small amount. The plasmids were co-transfected into HEK293 mammalian cells after mixing. Cell supernatants were collected by centrifugation 10 days after cell transfection. The supernatant was subjected to antigen-specific evaluation, and cell supernatant purification was arranged after waiting for ELISA primary screening results.
In this example, 100 plasmids were transfected per round, i.e., 100 monoclonal antibodies were obtained per round of transfection. A 5-cycle rotation experiment was performed in total.
7. Recombinant expression supernatant antigen specificity evaluation
The antigen coated plate is prepared, the screening sources are GFAP-His protein and GST-His tag protein, which are recombinant expression of 293F cells, and the C terminal carries His tag.
Screening protocol for monoclonal antibodies to GFAP protein: antibodies that react with the GFAP-His protein and do not react with the GST-His protein, i.e., initially designated as GFAP-specific monoclonal antibodies.
Screening of the original GST-His with the sequence of
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGGGGSHHHHHH(SEQ ID NO:15)。
The cell supernatant was detected by indirect ELISA, and the goat Anti-Rabbit polyclonal antibody (HRP) detection was performed using self-produced Rabbit secondary antibody-Rabbit IgG mAb, and the reactive OD >1, indicating that the recombinant plasmid was normally expressed on 293 cells.
Indirect ELISA was used to detect cell supernatants, and reactivity was evaluated on each of the 2 antigen-coated plates to obtain primary screening results for well plate supernatants (Table 1 shows exemplary detection data for 50 cell supernatants).
Table 1: antigen-antibody affinity data sheet for partial antibodies
Indirect ELISA detection results: the GFAP-His antibody is subjected to primary screening, cotransfection and recombination to obtain 500 monoclonal antibodies, the antibodies react with GFAP-His protein and do not react with GST-His protein, and 100 monoclonal antibodies are primarily screened.
The cell supernatant determined by preliminary screening is purified by protein A to obtain a small amount of monoclonal antibody, and the average amount of each strain is 1-3mg.
8. ELISA paired screening of recombinant antibodies
The paired antibodies of GFAP proteins are screened, and the development of GFAP high-affinity specific antibodies is finished early, so that the embodiment selects and fixes the Rabbit anti-GFAP mAb, the sandwich ELISA experiment paired detection is carried out on the preliminarily screened 100 monoclonal antibodies, and the better monoclonal antibody which can be paired with the Rabbit anti-GFAP mAb is screened.
The sequence of the variable region of the heavy chain of the Rabbit anti-GFAP mAb is as follows:
QSLEESGGRLVTPGGSLTLTCTVSGIDLTTYTMTWVRQAPGKGLEWIGIISGSGTTYYASWAKGRFTISKTSTTVDLKITSPTTEDTATYFCARDLYGSSDIYNIWGPGTLVTVST(SEQ ID NO:16);
(CDRH1:GIDLTTYT(SEQ ID NO:18);CDRH2:ISGSGTT(SEQ ID NO:19);CDRH3:ARDLYGSSDIYNI(SEQ ID NO:20))
the light chain variable region sequences are:
DIVMTQTPASVSAAVGGTVTINCQASESIRNYLSWYQQKPGQPPKLLIFDASTLASGVSSRFKGSGSGTEFTLTISDLECADAATYYCQTYYGVSGFGNAFGGGTEVVVK(SEQ ID NO:17);
(CDRL1:ESIRNY(SEQ ID NO:21);CDRL2:DAS;CDRL3:QTYYGVSGFGNA(SEQ ID NO:22))
the ELISA platform synchronous detection data of the clinical positive sample show that the ELISA pairing experiment can select GFAP-His as a detection source.
The 100 monoclonal antibodies screened initially are subjected to detection of GFAP-His by a sandwich ELISA experiment, the first 10 strains with high and low paired detection signal values are finally screened out, and the clinical sample detection condition of the antibodies is verified by a chemiluminescent platform (Table 2 shows the detection results of 20 paired antibodies in an illustrative manner).
Table 2: detection data (part) of GFAP-His paired antibody
9. Recombinant antibody chemiluminescent platform screening
And (3) detecting the reactivity and the specificity of the antibody screened in the step (8) on a chemiluminescent platform, wherein the specific operation is as follows:
and (3) coating magnetic beads: the Rabbit anti-GFAP mAb is fixed as a coating antibody (the sequence information of the variable region of the antibody is shown in the step 8), 2mg of magnetic beads are taken, an activated buffer is washed for 2 times, a certain amount of EDC is added for shaking and mixing, and the supernatant is removed by magnetic attraction. Adding 1000uL of coupling buffer into the precipitate, adding 40ug of antibody, shaking and mixing for 2h, adding 100uL of blocking solution, shaking and mixing and blocking for 3h. Finally, 1000uL TBST is added to clean the magnetic beads, and 1000uL preservation solution is added.
Acridinium ester labeling: taking the antibody screened in the step 8 as a labeled antibody, and taking 100- (100/C) Ab ) uL coupling Buffer to 0.5 mL brown EP tube, add (100/C Ab ) The uL Ab was placed in a 0.5 mL brown EP tube to give a final concentration of 1mg/mL antibody label, 5mM acridine ester was added to the 0.5 mL brown EP tube, the mixture was homogenized by vortex mixer, and then reacted with a vertical kneader at room temperature (20-25 ℃) for 2 hours, followed by purification to remove the free acridine ester.
The screening antigen is selected from GFAP-His protein and GST-His protein, the specific sequence information of the screening antigen is displayed before, and the sample diluent is detected as a control.
The preparation of the coated antibody, the labeled antibody and the screening antigen is respectively completed according to the method, and each screening antigen is detected according to a set program by using a full-automatic chemiluminescence apparatus. The detection result is reacted with GFAP-His protein, and the antibody which does not react with GST-His protein is the preferable antibody.
10 monoclonal antibodies screened by sandwich ELISA experiments are detected by a chemiluminescent platform, and 1 GFAP specific antibody is preferably selected. Table 3 shows the detection results of 4 pairs of paired antibodies by way of example.
Table 3: GFAP specific antibody chemiluminescence platform pairing detection data (part)
The screened specific antibody was designated as Anti-GFAP-rImab-1, and the heavy chain variable region sequence was:
QSLEESGGRLVTPGTPLTLTCTSSGFSLSSYYIQWVRQAPGKGLEWIGIIYASGSTYYASWAKGRFTISKTSATVDLKITSPTQEDTATYFCARNDYDSNLIMSIWGPGTLVTVSS(SEQ ID NO:6);
the light chain variable region sequences are:
AYDMTQTPASMEVAVGGTVTINCQASQNIGSSLAWYQQKPGQRPKLLIYRASTLASGVPSRFSGSGSGTEFTLTISGLQCDDAATYYCQQHFSIGAVQNVFGGGTEVVVR(SEQ ID NO:7)。
table 4: amino acid sequence of anti-GFAP antibody
Example 2: application of anti-Glial Fibrillary Acidic Protein (GFAP) monoclonal antibody in chemiluminescence detection of clinical samples
The optimized GFAP specific antibody Anti-GFAP-rRNA-1 is applied to a chemiluminescence detection experiment, matched with an antibody capable of being matched with the antibody, a constant value gradient clinical sample is detected, and the correlation between a detection result and a clinical constant value is compared.
Gradient clinical samples GFAP concentrations in samples were quantified using simoa single-molecule immunization, specific concentrations are shown in table 5:
table 5: clinical sample GFAP concentration meter
The concentration of GFAP in samples P1 to P9 and sample dilutions was measured using a full-automatic chemiluminescence apparatus (step same as in example 1 (9)) using the antibody pair consisting of the preferred GFAP-specific antibody Anti-GFAP-rRNA-1 and the antibody Rabbit Anti-GFAP mAb paired with the above, and the results are shown in Table 6:
table 6: chemiluminescent detection result table for clinical samples
And drawing a scatter diagram of the GFAP concentration of each sample by taking the GFAP concentration detected by a simoa single-molecule immunoassay as a horizontal axis and the GFAP concentration detected by a chemiluminescence method as a vertical axis, and calculating a correlation coefficient of the GFAP concentration value between the two detection methods.
As shown in fig. 2, the correlation coefficient r=0.9954, R of the two detection methods 2 When applied to chemiluminescent detection experiments, the detection result has strong correlation with simoa single molecule immunization, namely, a preferred GFAP specific antibody Anti-GFAP-rRNA-1 is matched with an antibody capable of being paired with the antibody, and the preferred antibody can be used for preparing a downstream kit.
While embodiments of the present application have been shown and described, it will be understood by those of ordinary skill in the art that: many changes, modifications, substitutions and variations may be made to the embodiments without departing from the principles and spirit of the application, the scope of which is defined by the claims and their equivalents.
Claims (10)
1. An antibody or antigen binding fragment thereof specifically binding to GFAP, having the amino acid sequences of heavy chain CDRH1-CDRH3 as set forth in SEQ ID NO:1-SEQ ID NO:3, the amino acid sequence of the light chain CDRL1 is shown in SEQ ID NO:4, wherein the amino acid sequence of the light chain CDRL2 is RAS, and the amino acid sequence of the light chain CDRL3 is shown in SEQ ID NO: shown at 5.
2. The antibody or antigen-binding fragment thereof of claim 1, comprising: as set forth in SEQ ID NO:6 and a heavy chain variable region VH as set forth in SEQ ID NO:7, and a light chain variable region VL.
3. A polynucleotide encoding the antibody or antigen-binding fragment thereof of any one of claims 1-2.
4. A kit for detecting GFAP, comprising a magnetic bead coated with a first antibody that targets GFAP and a second antibody that targets GFAP labeled with a chemiluminescent agent, wherein one of the antibodies in the pair of first and second antibodies that targets GFAP is the antibody or antigen binding fragment thereof of any one of claims 1-2.
5. The kit of claim 4, wherein the heavy chain CDRH1-CDRH3 amino acid sequences of the other antibody in the pair of antibodies comprising the first antibody and the second antibody are set forth in SEQ ID NOs: 18-SEQ ID NO:20, the amino acid sequence of the light chain CDRL1 is shown in SEQ ID NO:21, the amino acid sequence of the light chain CDRL2 is DAS, and the amino acid sequence of the light chain CDRL3 is shown in SEQ ID NO: shown at 22.
6. The kit of claim 5, the other antibody of the pair of first and second antibodies comprising: as set forth in SEQ ID NO:16 and a heavy chain variable region VH as set forth in SEQ ID NO:17, and a light chain variable region VL.
7. The kit of claim 4, wherein the second antibody is the antibody or antigen-binding fragment thereof of any one of claims 1-2, and the heavy chain CDRH1-CDRH3 amino acid sequences of the first antibody are set forth in SEQ ID NOs: 18-SEQ ID NO:20, the amino acid sequence of the light chain CDRL1 is shown in SEQ ID NO:21, the amino acid sequence of the light chain CDRL2 is DAS, and the amino acid sequence of the light chain CDRL3 is shown in SEQ ID NO: shown at 22.
8. The kit of claim 4, wherein the second antibody is the antibody or antigen-binding fragment thereof of any one of claims 1-2, and the first antibody comprises the amino acid sequence set forth in SEQ ID NO:16 and a heavy chain variable region VH as set forth in SEQ ID NO:17, and a light chain variable region VL.
9. The kit according to claim 4, wherein the chemiluminescent agent is at least one selected from the group consisting of acridinium esters, alkaline phosphatase, and horseradish peroxidase.
10. Use of an antibody or antigen-binding fragment thereof according to any one of claims 1-2 in the preparation of a kit for aiding in the diagnosis of a GFAP-related disease.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202410247761.0A CN117820471B (en) | 2024-03-05 | 2024-03-05 | GFAP specific antibody and application thereof in GFAP detection kit |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202410247761.0A CN117820471B (en) | 2024-03-05 | 2024-03-05 | GFAP specific antibody and application thereof in GFAP detection kit |
Publications (2)
Publication Number | Publication Date |
---|---|
CN117820471A true CN117820471A (en) | 2024-04-05 |
CN117820471B CN117820471B (en) | 2024-05-10 |
Family
ID=90509942
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202410247761.0A Active CN117820471B (en) | 2024-03-05 | 2024-03-05 | GFAP specific antibody and application thereof in GFAP detection kit |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN117820471B (en) |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN102532315A (en) * | 2010-12-16 | 2012-07-04 | 复旦大学 | Human brain glioma marker glial fibrillary acidic protein (GFAP) autoantibody and applications thereof |
CN103173458A (en) * | 2013-03-04 | 2013-06-26 | 百奇生物科技(苏州)有限公司 | Sequences of variable regions of anti-GFAP (glial fibrillary acidic protein) monoclonal antibody and method for preparing same |
CN105646705A (en) * | 2015-12-30 | 2016-06-08 | 天津三箭生物技术股份有限公司 | Mouse anti-human GFAP monoclonal antibody and hybridoma cell strain for secretion of monoclonal antibody |
US20170165383A1 (en) * | 2008-07-10 | 2017-06-15 | Institut Pasteur | Variable domains of camelid heavy-chain antibodies directed against glial fibrillary acidic proteins |
CN108997496A (en) * | 2018-10-16 | 2018-12-14 | 无锡傲锐东源生物科技有限公司 | Anti- GFAP protein monoclonal antibody and application thereof |
-
2024
- 2024-03-05 CN CN202410247761.0A patent/CN117820471B/en active Active
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20170165383A1 (en) * | 2008-07-10 | 2017-06-15 | Institut Pasteur | Variable domains of camelid heavy-chain antibodies directed against glial fibrillary acidic proteins |
CN102532315A (en) * | 2010-12-16 | 2012-07-04 | 复旦大学 | Human brain glioma marker glial fibrillary acidic protein (GFAP) autoantibody and applications thereof |
CN103173458A (en) * | 2013-03-04 | 2013-06-26 | 百奇生物科技(苏州)有限公司 | Sequences of variable regions of anti-GFAP (glial fibrillary acidic protein) monoclonal antibody and method for preparing same |
CN105646705A (en) * | 2015-12-30 | 2016-06-08 | 天津三箭生物技术股份有限公司 | Mouse anti-human GFAP monoclonal antibody and hybridoma cell strain for secretion of monoclonal antibody |
CN108997496A (en) * | 2018-10-16 | 2018-12-14 | 无锡傲锐东源生物科技有限公司 | Anti- GFAP protein monoclonal antibody and application thereof |
Non-Patent Citations (1)
Title |
---|
卞修武: "胶质纤维酸性蛋白基因调控及其在胶质瘤诱导分化中的作用", 中华病理学杂志, vol. 28, no. 3, 30 June 1999 (1999-06-30), pages 222 - 223 * |
Also Published As
Publication number | Publication date |
---|---|
CN117820471B (en) | 2024-05-10 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2020125653A1 (en) | Monoclonal antibody which fights cd19 and application thereof | |
WO2016104439A1 (en) | Anti-active gip antibody | |
CN117624358B (en) | Abeta 1-40 specific antibody and application thereof in Alzheimer disease auxiliary diagnosis kit | |
CN106854244B (en) | Nano antibody aiming at HER3 and clinical application thereof | |
CN117088976B (en) | anti-NFL monoclonal antibody | |
CN113480659A (en) | Human source anti-mycobacterium tuberculosis complex LAM monoclonal antibody and preparation and application thereof | |
CN117820471B (en) | GFAP specific antibody and application thereof in GFAP detection kit | |
WO2022247804A1 (en) | Anti-gprc5d antibody, preparation method therefor, and use thereof | |
CN115947854A (en) | Anti-human CD40 protein monoclonal antibody, preparation method and application thereof | |
CN117624356B (en) | NfL specific antibody and application thereof in Alzheimer disease auxiliary diagnosis kit | |
CN117820472B (en) | P-Tau 181 specific antibody and application thereof in Alzheimer disease auxiliary diagnosis kit | |
CN117820473B (en) | Abeta 1-42 specific antibody and application thereof in Alzheimer disease auxiliary diagnosis kit | |
CN117624357B (en) | P-Tau 217 specific antibody and application thereof in Alzheimer disease auxiliary diagnosis kit | |
CN111434686B (en) | Anti-human PBX1 monoclonal antibody, preparation method thereof and application thereof in clinical diagnosis of recurrent abortion | |
CN113667011A (en) | Method for preparing antigen binding units | |
WO2024008094A1 (en) | Anti-cd20-antibody monoclonal antibody and use thereof | |
TW202041862A (en) | Antibody and antibody fragments, kit and method for detecting miltenberger blood group antigen | |
WO2024008090A1 (en) | Monoclonal antibody for detecting anti-bcma car expression level and use thereof | |
WO2022121899A1 (en) | Antibody specifically binding to strep-tag ii tag and use thereof | |
CN117209605B (en) | Antibodies that specifically bind IL-15 and uses thereof | |
CN116496395B (en) | Monoclonal antibody combined with Dsg3 and application thereof | |
CN117186221A (en) | Large endothelin-1 specific antibody and preparation method and application thereof | |
CN113461822B (en) | Scl-70 antibody or binding fragment thereof, screening method thereof, and detection kit comprising same | |
CN116023495B (en) | anti-CD40 nano antibody and preparation method and application thereof | |
CN115960237A (en) | Monoclonal antibody of OXA-48 enzyme and application |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |