CN117700558B - Monoclonal anti-GPRC 5D antibody and anti-GPRC 5D-CAR-NK cell - Google Patents
Monoclonal anti-GPRC 5D antibody and anti-GPRC 5D-CAR-NK cell Download PDFInfo
- Publication number
- CN117700558B CN117700558B CN202410166101.XA CN202410166101A CN117700558B CN 117700558 B CN117700558 B CN 117700558B CN 202410166101 A CN202410166101 A CN 202410166101A CN 117700558 B CN117700558 B CN 117700558B
- Authority
- CN
- China
- Prior art keywords
- seq
- amino acid
- antibody
- acid sequence
- scfv
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 114
- 102100021197 G-protein coupled receptor family C group 5 member D Human genes 0.000 claims abstract description 38
- 101001040713 Homo sapiens G-protein coupled receptor family C group 5 member D Proteins 0.000 claims abstract description 38
- 210000004027 cell Anatomy 0.000 claims description 64
- 239000003814 drug Substances 0.000 claims description 25
- 229940079593 drug Drugs 0.000 claims description 20
- 239000013598 vector Substances 0.000 claims description 20
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 17
- 239000012634 fragment Substances 0.000 claims description 13
- 108091033319 polynucleotide Proteins 0.000 claims description 13
- 102000040430 polynucleotide Human genes 0.000 claims description 13
- 239000002157 polynucleotide Substances 0.000 claims description 13
- 239000008194 pharmaceutical composition Substances 0.000 claims description 11
- 108010075254 C-Peptide Proteins 0.000 claims description 10
- 208000034578 Multiple myelomas Diseases 0.000 claims description 10
- 210000000822 natural killer cell Anatomy 0.000 claims description 10
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 10
- 239000013612 plasmid Substances 0.000 claims description 9
- 230000011664 signaling Effects 0.000 claims description 9
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims description 7
- 230000000139 costimulatory effect Effects 0.000 claims description 6
- 230000008878 coupling Effects 0.000 claims description 6
- 238000010168 coupling process Methods 0.000 claims description 6
- 238000005859 coupling reaction Methods 0.000 claims description 6
- 238000011282 treatment Methods 0.000 claims description 6
- 239000003085 diluting agent Substances 0.000 claims description 4
- 239000003937 drug carrier Substances 0.000 claims description 4
- 102000004127 Cytokines Human genes 0.000 claims description 3
- 108090000695 Cytokines Proteins 0.000 claims description 3
- 108090000790 Enzymes Proteins 0.000 claims description 3
- 102000004190 Enzymes Human genes 0.000 claims description 3
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 3
- 210000000349 chromosome Anatomy 0.000 claims description 3
- 230000001086 cytosolic effect Effects 0.000 claims description 3
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 3
- 230000001177 retroviral effect Effects 0.000 claims description 3
- 239000003053 toxin Substances 0.000 claims description 3
- 231100000765 toxin Toxicity 0.000 claims description 3
- 230000002265 prevention Effects 0.000 claims description 2
- 238000004519 manufacturing process Methods 0.000 claims 1
- 230000002147 killing effect Effects 0.000 abstract description 10
- 238000012216 screening Methods 0.000 abstract description 4
- 238000000338 in vitro Methods 0.000 abstract description 3
- 230000000694 effects Effects 0.000 description 26
- 238000009739 binding Methods 0.000 description 14
- 125000000539 amino acid group Chemical group 0.000 description 13
- 206010028980 Neoplasm Diseases 0.000 description 11
- 239000000427 antigen Substances 0.000 description 11
- 108091007433 antigens Proteins 0.000 description 11
- 102000036639 antigens Human genes 0.000 description 11
- 238000000034 method Methods 0.000 description 10
- 229920001184 polypeptide Polymers 0.000 description 9
- 102000004196 processed proteins & peptides Human genes 0.000 description 9
- 239000007853 buffer solution Substances 0.000 description 8
- 230000014509 gene expression Effects 0.000 description 8
- 108090000623 proteins and genes Proteins 0.000 description 8
- 239000006228 supernatant Substances 0.000 description 8
- 108060003951 Immunoglobulin Proteins 0.000 description 7
- 238000001514 detection method Methods 0.000 description 7
- 239000013604 expression vector Substances 0.000 description 7
- 102000018358 immunoglobulin Human genes 0.000 description 7
- 201000000050 myeloid neoplasm Diseases 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 6
- 102000039446 nucleic acids Human genes 0.000 description 6
- 108020004707 nucleic acids Proteins 0.000 description 6
- 150000007523 nucleic acids Chemical class 0.000 description 6
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 5
- 150000001413 amino acids Chemical class 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 229940072221 immunoglobulins Drugs 0.000 description 5
- 239000000203 mixture Substances 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- OZFAFGSSMRRTDW-UHFFFAOYSA-N (2,4-dichlorophenyl) benzenesulfonate Chemical compound ClC1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=CC=C1 OZFAFGSSMRRTDW-UHFFFAOYSA-N 0.000 description 4
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 4
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 102100029215 Signaling lymphocytic activation molecule Human genes 0.000 description 4
- 210000001744 T-lymphocyte Anatomy 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 102000004169 proteins and genes Human genes 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 description 3
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 description 3
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 description 3
- 102100024263 CD160 antigen Human genes 0.000 description 3
- 101000761938 Homo sapiens CD160 antigen Proteins 0.000 description 3
- 101000994375 Homo sapiens Integrin alpha-4 Proteins 0.000 description 3
- 101000633786 Homo sapiens SLAM family member 6 Proteins 0.000 description 3
- 102100032818 Integrin alpha-4 Human genes 0.000 description 3
- 102100032816 Integrin alpha-6 Human genes 0.000 description 3
- 108060001084 Luciferase Proteins 0.000 description 3
- 239000005089 Luciferase Substances 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 102100029197 SLAM family member 6 Human genes 0.000 description 3
- 229940121354 immunomodulator Drugs 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- -1 predominantly cd3ζ Proteins 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 2
- 102100038077 CD226 antigen Human genes 0.000 description 2
- 101000884298 Homo sapiens CD226 antigen Proteins 0.000 description 2
- 101001078158 Homo sapiens Integrin alpha-1 Proteins 0.000 description 2
- 101000994365 Homo sapiens Integrin alpha-6 Proteins 0.000 description 2
- 101001035237 Homo sapiens Integrin alpha-D Proteins 0.000 description 2
- 101001046687 Homo sapiens Integrin alpha-E Proteins 0.000 description 2
- 101000935043 Homo sapiens Integrin beta-1 Proteins 0.000 description 2
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 2
- 101000971538 Homo sapiens Killer cell lectin-like receptor subfamily F member 1 Proteins 0.000 description 2
- 101000950687 Homo sapiens Mitogen-activated protein kinase 7 Proteins 0.000 description 2
- 101000873418 Homo sapiens P-selectin glycoprotein ligand 1 Proteins 0.000 description 2
- 101000633782 Homo sapiens SLAM family member 8 Proteins 0.000 description 2
- 101000633780 Homo sapiens Signaling lymphocytic activation molecule Proteins 0.000 description 2
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 2
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 2
- 102100025323 Integrin alpha-1 Human genes 0.000 description 2
- 102100039904 Integrin alpha-D Human genes 0.000 description 2
- 102100022341 Integrin alpha-E Human genes 0.000 description 2
- 102100022338 Integrin alpha-M Human genes 0.000 description 2
- 102100022297 Integrin alpha-X Human genes 0.000 description 2
- 102100025304 Integrin beta-1 Human genes 0.000 description 2
- 102100025390 Integrin beta-2 Human genes 0.000 description 2
- 102100021458 Killer cell lectin-like receptor subfamily F member 1 Human genes 0.000 description 2
- 102100037805 Mitogen-activated protein kinase 7 Human genes 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 108010038807 Oligopeptides Proteins 0.000 description 2
- 102000015636 Oligopeptides Human genes 0.000 description 2
- 102100034925 P-selectin glycoprotein ligand 1 Human genes 0.000 description 2
- 229940079156 Proteasome inhibitor Drugs 0.000 description 2
- 102000014128 RANK Ligand Human genes 0.000 description 2
- 108010025832 RANK Ligand Proteins 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 102100029214 SLAM family member 8 Human genes 0.000 description 2
- 102100027744 Semaphorin-4D Human genes 0.000 description 2
- 108010074687 Signaling Lymphocytic Activation Molecule Family Member 1 Proteins 0.000 description 2
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 2
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 2
- IEDXPSOJFSVCKU-HOKPPMCLSA-N [4-[[(2S)-5-(carbamoylamino)-2-[[(2S)-2-[6-(2,5-dioxopyrrolidin-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl N-[(2S)-1-[[(2S)-1-[[(3R,4S,5S)-1-[(2S)-2-[(1R,2R)-3-[[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]-N-methylcarbamate Chemical compound CC[C@H](C)[C@@H]([C@@H](CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)c1ccccc1)OC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCc1ccc(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN2C(=O)CCC2=O)C(C)C)cc1)C(C)C IEDXPSOJFSVCKU-HOKPPMCLSA-N 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 238000004140 cleaning Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 239000002955 immunomodulating agent Substances 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 108010093470 monomethyl auristatin E Proteins 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 239000003207 proteasome inhibitor Substances 0.000 description 2
- 108020001580 protein domains Proteins 0.000 description 2
- 238000002864 sequence alignment Methods 0.000 description 2
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical class O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 1
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 238000011357 CAR T-cell therapy Methods 0.000 description 1
- 108010056102 CD100 antigen Proteins 0.000 description 1
- 108010017009 CD11b Antigen Proteins 0.000 description 1
- 102100027207 CD27 antigen Human genes 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 108010062802 CD66 antigens Proteins 0.000 description 1
- 102100035793 CD83 antigen Human genes 0.000 description 1
- 102100024533 Carcinoembryonic antigen-related cell adhesion molecule 1 Human genes 0.000 description 1
- 108010077544 Chromatin Proteins 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 102100027816 Cytotoxic and regulatory T-cell molecule Human genes 0.000 description 1
- 101710112752 Cytotoxin Proteins 0.000 description 1
- 238000012270 DNA recombination Methods 0.000 description 1
- 206010059866 Drug resistance Diseases 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 108010021468 Fc gamma receptor IIA Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 206010066476 Haematological malignancy Diseases 0.000 description 1
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 1
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 1
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 description 1
- 101001046683 Homo sapiens Integrin alpha-L Proteins 0.000 description 1
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 1
- 101001046668 Homo sapiens Integrin alpha-X Proteins 0.000 description 1
- 101001015037 Homo sapiens Integrin beta-7 Proteins 0.000 description 1
- 101001090688 Homo sapiens Lymphocyte cytosolic protein 2 Proteins 0.000 description 1
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 1
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 description 1
- 101000589305 Homo sapiens Natural cytotoxicity triggering receptor 2 Proteins 0.000 description 1
- 101000633778 Homo sapiens SLAM family member 5 Proteins 0.000 description 1
- 101000633784 Homo sapiens SLAM family member 7 Proteins 0.000 description 1
- 101000596234 Homo sapiens T-cell surface protein tactile Proteins 0.000 description 1
- 101000809875 Homo sapiens TYRO protein tyrosine kinase-binding protein Proteins 0.000 description 1
- 101000795169 Homo sapiens Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 description 1
- 101000648507 Homo sapiens Tumor necrosis factor receptor superfamily member 14 Proteins 0.000 description 1
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 1
- 101000679857 Homo sapiens Tumor necrosis factor receptor superfamily member 3 Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 102100022339 Integrin alpha-L Human genes 0.000 description 1
- 108010041100 Integrin alpha6 Proteins 0.000 description 1
- 108010030465 Integrin alpha6beta1 Proteins 0.000 description 1
- 102100033016 Integrin beta-7 Human genes 0.000 description 1
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 1
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- 102100034709 Lymphocyte cytosolic protein 2 Human genes 0.000 description 1
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101000997616 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 1 Proteins 0.000 description 1
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 1
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 description 1
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 1
- 108010004217 Natural Cytotoxicity Triggering Receptor 1 Proteins 0.000 description 1
- 108010004222 Natural Cytotoxicity Triggering Receptor 3 Proteins 0.000 description 1
- 102100032870 Natural cytotoxicity triggering receptor 1 Human genes 0.000 description 1
- 102100032851 Natural cytotoxicity triggering receptor 2 Human genes 0.000 description 1
- 102100032852 Natural cytotoxicity triggering receptor 3 Human genes 0.000 description 1
- 102100038082 Natural killer cell receptor 2B4 Human genes 0.000 description 1
- 101710141230 Natural killer cell receptor 2B4 Proteins 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 101710160107 Outer membrane protein A Proteins 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 102100029216 SLAM family member 5 Human genes 0.000 description 1
- 102100029198 SLAM family member 7 Human genes 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 102100035268 T-cell surface protein tactile Human genes 0.000 description 1
- 102100038717 TYRO protein tyrosine kinase-binding protein Human genes 0.000 description 1
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 1
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 description 1
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 1
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 1
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 102100022156 Tumor necrosis factor receptor superfamily member 3 Human genes 0.000 description 1
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 1
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- WQZGKKKJIJFFOK-FPRJBGLDSA-N beta-D-galactose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-FPRJBGLDSA-N 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 235000011132 calcium sulphate Nutrition 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 101150058049 car gene Proteins 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 108700010039 chimeric receptor Proteins 0.000 description 1
- 210000003483 chromatin Anatomy 0.000 description 1
- 108010072917 class-I restricted T cell-associated molecule Proteins 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 238000007398 colorimetric assay Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 239000002619 cytotoxin Substances 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 210000002744 extracellular matrix Anatomy 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 239000012642 immune effector Substances 0.000 description 1
- 102000027596 immune receptors Human genes 0.000 description 1
- 108091008915 immune receptors Proteins 0.000 description 1
- 230000002584 immunomodulator Effects 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000004068 intracellular signaling Effects 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000002796 luminescence method Methods 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 238000010837 poor prognosis Methods 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 230000001502 supplementing effect Effects 0.000 description 1
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 229960001967 tacrolimus Drugs 0.000 description 1
- QJJXYPPXXYFBGM-SHYZHZOCSA-N tacrolimus Natural products CO[C@H]1C[C@H](CC[C@@H]1O)C=C(C)[C@H]2OC(=O)[C@H]3CCCCN3C(=O)C(=O)[C@@]4(O)O[C@@H]([C@H](C[C@H]4C)OC)[C@@H](C[C@H](C)CC(=C[C@@H](CC=C)C(=O)C[C@H](O)[C@H]2C)C)OC QJJXYPPXXYFBGM-SHYZHZOCSA-N 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 229940126585 therapeutic drug Drugs 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Landscapes
- Peptides Or Proteins (AREA)
Abstract
The invention relates to a monoclonal anti-GPRC 5D antibody and an anti-GPRC 5D-CAR-NK cell, wherein the amino acid sequence of a heavy chain variable region of the antibody is shown as any one of SEQ ID NO.1-3, and the amino acid sequence of a light chain variable region of the antibody is shown as any one of SEQ ID NO. 8-10. The GPRC5D sequence with higher affinity is obtained through screening, and the CAR-NK structure constructed by combining the GPRC5D sequence with NK can show higher in-vitro killing effect.
Description
Technical Field
The invention relates to the field of cellular immunotherapy, in particular to a monoclonal anti-GPRC 5D antibody and an anti-GPRC 5D-CAR-NK cell.
Background
Multiple Myeloma (MM) is the second most common hematological malignancy next to non-hodgkin's lymphoma. Traditional methods of treating MM include the use of immunomodulators, proteasome inhibitors, and anti-cd 38 antibodies. However, these treatments have limited efficacy in MM patients and generally suffer from poor overall prognosis. In recent years, despite great progress in chemotherapy, proteasome inhibitors and the immunomodulator thalidomide derivatives, the vast majority of patients eventually relapse. Thus, there is an urgent need for new therapeutic regimens.
Compared with BCMA, GPRC5D has better specificity, the expression of the GPRC5D is not reduced along with the time, and the expression of the GPRC5D are independent, so that the single-targeting and double-targeting development of therapeutic drugs can be realized, the overexpression of the GPRC5D is related to the poor prognosis and tumor burden of patients with multiple myeloma, and the association makes the GPRC5D a potential candidate target for treating the multiple myeloma. Enterprises at home and abroad use the leading technology to develop GPRC5D antibodies and cell therapy medicines.
Tacrolimus is a GPRC5D x CD3 bispecific antibody developed by robusta, leading far among many GPRC5D targeted drugs. GPRC5D is a target expressed on multiple myeloma cells, whose expression does not decrease over time, whereas CD3 is a T cell receptor, associated with activated T cells.
OriC-321 and OriCAR-017 are two GPRC5D CAR-T products of the original organism for the indication multiple myeloma. The original organism utilizes a proprietary CAR-T technology platform to construct a unique signal activation domain element Ori. After the original is inserted into a new generation of CAR structure, the amplification efficiency of the memory immune cells can be improved by times, the physical barrier of extracellular matrixes in TME is effectively broken through, the anti-tumor activity and durability of CAR-T in vivo are obviously enhanced, and the anti-tumor effect of CAR-T in vivo have better relapse prevention potential.
MCARH109 is another GPRC5D CAR-T product developed by the commemorative Style Josepioline center (MSKCC) in combination with Yoareke (Eureka Therapeutics). In vitro studies MCARH109,109 showed good efficacy, while it also showed better activity in BCMA drug resistance model. The MM patients (including those who relapse after BCMA CAR T cell therapy) who failed the group multi-line therapy of the phase i dose expansion study were given MCARH treatments at 4 dose levels.
RG6234 (GPRC 5 DxCD) is a GPRC5D T cell engagement bispecific antibody developed by Roche, comprising two protein domains that bind to a target and one protein domain that binds to CD 3. Rogowski indicates that this bispecific antibody is "the most potent". In early clinical trials in patients with multiple myeloma, ORR exceeded 71% and CR exceeded 35%.
LM-305 is a novel targeted GPRC5D antibody conjugated drug (ADC) consisting of an anti-GPRC 5D monoclonal antibody, a degradable protease linker and a cytotoxin-loaded monomethyl auristatin E (MMAE). The novel medicine is a second product independently developed based on an exclusive ADC platform. LM-305 is the GPRC5D-ADC of the first clause worldwide into clinical phase.
At present, for the GPRC5D medicines, neither CAR-T nor ADC, or bispecific antibodies target MM tumors with the specificity of GPRC5D so as to bring killing to achieve clinical treatment effects. The low affinity makes the treatment effect poor and increases the risk of tumor escape, so that the screening of the GPRC5D sequence with high affinity is an effective method for improving the treatment effect.
Disclosure of Invention
Problems to be solved by the invention
The invention aims to solve the current situation that the therapeutic effect is poor and the recurrence rate is high due to low affinity of target protein of multiple myeloma.
Solution for solving the problem
The present invention provides a monoclonal anti-GPRC 5D antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises one or more of the following sequences:
(1) An amino acid sequence as set forth in any one of SEQ ID NO. 1-3;
(2) An amino acid sequence having at least 80%, 82%, 85%, 87%, 90%, 92%, 95%, 96%, 97%, 98%, 99% identity to the amino acid sequence set forth in any one of SEQ ID nos. 1 to 3, and which retains the activity of the amino acid sequence set forth in any one of SEQ ID nos. 1 to 3;
(3) An amino acid sequence in which 1 or more amino acid residues are added, substituted, deleted or inserted in the amino acid sequence shown in any one of SEQ ID NO.1 to 3, and which retains the activity of the amino acid sequence shown in any one of SEQ ID NO.1 to 3;
The amino acid sequence of the light chain variable region comprises one or more of the following sequences:
(1) An amino acid sequence as set forth in any one of SEQ ID NO. 8-10;
(2) An amino acid sequence having at least 80%, 82%, 85%, 87%, 90%, 92%, 95%, 96%, 97%, 98%, 99% identity to the amino acid sequence set forth in any one of SEQ ID nos. 8 to 10, and which retains the activity of the amino acid sequence set forth in any one of SEQ ID nos. 8 to 10;
(3) An amino acid sequence in which 1 or more amino acid residues are added, substituted, deleted or inserted in the amino acid sequence shown in any one of SEQ ID NO.8-10, and which retains the activity of the amino acid sequence shown in any one of SEQ ID NO. 8-10;
wherein, SEQ ID NO.1 is paired with SEQ ID NO.8, SEQ ID NO.2 is paired with SEQ ID NO.9, and SEQ ID NO.3 is paired with SEQ ID NO. 10.
Preferably, the antibody is a single chain antibody and/or a double chain antibody that binds to a cell surface GPRC5D protein.
The invention also provides a single chain variable region fragment scFv, said scFv comprising a heavy chain variable region and a light chain variable region; wherein the heavy chain variable region comprises one or more of the following sequences:
(1) An amino acid sequence as set forth in any one of SEQ ID NO. 1-3;
(2) An amino acid sequence having at least 80%, 82%, 85%, 87%, 90%, 92%, 95%, 96%, 97%, 98%, 99% identity to the amino acid sequence set forth in any one of SEQ ID nos. 1 to 3, and which retains the activity of the amino acid sequence set forth in any one of SEQ ID nos. 1 to 3;
(3) An amino acid sequence in which 1 or more amino acid residues are added, substituted, deleted or inserted in the amino acid sequence shown in any one of SEQ ID NO.1 to 3, and which retains the activity of the amino acid sequence shown in any one of SEQ ID NO.1 to 3;
The amino acid sequence of the light chain variable region comprises one or more of the following sequences:
(1) An amino acid sequence as set forth in any one of SEQ ID NO. 8-10;
(2) An amino acid sequence having at least 80%, 82%, 85%, 87%, 90%, 92%, 95%, 96%, 97%, 98%, 99% identity to the amino acid sequence set forth in any one of SEQ ID nos. 8 to 10, and which retains the activity of the amino acid sequence set forth in any one of SEQ ID nos. 8 to 10;
(3) An amino acid sequence in which 1 or more amino acid residues are added, substituted, deleted or inserted in the amino acid sequence shown in any one of SEQ ID NO.8-10, and which retains the activity of the amino acid sequence shown in any one of SEQ ID NO. 8-10;
wherein, SEQ ID NO.1 is paired with SEQ ID NO.8, SEQ ID NO.2 is paired with SEQ ID NO.9, and SEQ ID NO.3 is paired with SEQ ID NO. 10.
Preferably, the scFv further comprises a connecting peptide; wherein the sequence of the connecting peptide is shown as SEQ ID NO.15, and the scFv comprises one or more of the following sequences:
(1) An amino acid sequence as set forth in any one of SEQ ID NO. 16-18;
(2) An amino acid sequence having at least 80%, 82%, 85%, 87%, 90%, 92%, 95%, 96%, 97%, 98%, 99% identity to the amino acid sequence set forth in any one of SEQ ID nos 16 to 18, and which retains the activity of the amino acid sequence set forth in any one of SEQ ID nos 16 to 18;
(3) An amino acid sequence of 1 or more amino acid residues added, substituted, deleted or inserted in the amino acid sequence shown in any one of SEQ ID NO. 16-18, and which retains the activity of the amino acid sequence shown in any one of SEQ ID NO. 16-18.
The invention also provides a chimeric antigen receptor CAR comprising:
(1) The above-mentioned scFv is used for the preparation of a medicine,
(2) A transmembrane domain comprising a transmembrane domain,
(3) A costimulatory domain, and
(4) The domain is activated.
Preferably, the CAR has the structure of formula I:
L-scFv-H-TM-C-CD3ζ(I),
Wherein,
Each "-" is independently a connecting peptide or peptide bond;
l is an optional signal peptide sequence;
The scFv is the scFv;
H is an optional hinge region;
TM is a transmembrane domain;
C is a costimulatory signaling molecule;
cd3ζ is a cytoplasmic signaling sequence derived from cd3ζ.
The present invention also provides a drug conjugate comprising:
(1) The antibody, or the scFv; and
(2) A coupling moiety;
wherein the coupling moiety is selected from one or more of a detectable label, a drug, a toxin, a cytokine, an enzyme, or a combination thereof.
The invention also provides a polynucleotide encoding the antibody, or the scFv, or the CAR.
The invention also provides a vector comprising the polynucleotide; wherein the vector is selected from one or more of DNA, RNA, plasmid, lentiviral vector, adenoviral vector, retroviral vector, or a combination thereof.
The invention also provides a genetically engineered cell comprising the vector, the polynucleotide integrated in the chromosome, or expressing the antibody, or expressing the scFv, or expressing the CAR.
Preferably, the cells are NK cells.
The invention also provides a pharmaceutical composition comprising one or more of the antibody, or the scFv, or the CAR, or the drug conjugate, or the cell; wherein the pharmaceutical composition further comprises a pharmaceutically acceptable carrier, diluent and/or excipient.
The invention also provides an application of the antibody, the scFv, the CAR, the drug conjugate, the cell or the pharmaceutical composition in preparing medicines for preventing and/or treating cancers or tumor related diseases.
Preferably, the tumor-associated disease is multiple myeloma.
ADVANTAGEOUS EFFECTS OF INVENTION
The GPRC5D sequence with higher affinity is obtained through screening, and the in vitro killing effect on the CAR-NK can be higher.
Drawings
Figure 1 shows the binding capacity of GPRC5D mab to mm.1 s.
FIG. 2 shows the binding capacity of GPRC5D mab to CHOK1-GPRC 5D.
FIG. 3 shows the structure of CAR-NK.
Figure 4 shows the electrotransformation and positive rate of GPRC5D CAR.
Figure 5 shows killing of mm.1s by GPRC 5D-CAR-NK.
Figure 6 shows killing of NCI-H929 by GPRC 5D-CAR-NK.
Detailed Description
In order to make the technical scheme and the beneficial effects of the application more obvious and understandable, the following detailed description is given by way of example. Wherein the drawings are not necessarily to scale, and wherein local features may be exaggerated or reduced to more clearly show details of the local features; unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this application belongs.
Before the embodiments of the invention are explained in further detail, it is to be understood that the invention is not limited in its scope to the particular embodiments described below; it is also to be understood that the terminology used in the examples of the invention is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the invention; in the description and claims of the invention, the singular forms "a", "an" and "the" include plural referents unless the context clearly dictates otherwise.
Where numerical ranges are provided in the examples, it is understood that unless otherwise stated herein, both endpoints of each numerical range and any number between the two endpoints are significant both in the numerical range. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. In addition to the specific methods, devices, materials used in the embodiments, any methods, devices, and materials of the prior art similar or equivalent to those described in the embodiments of the present invention may be used to practice the present invention according to the knowledge of one skilled in the art and the description of the present invention.
Unless otherwise indicated, the experimental methods, detection methods, and preparation methods disclosed in the present invention employ techniques conventional in the art of molecular biology, biochemistry, chromatin structure and analysis, analytical chemistry, cell culture, recombinant DNA techniques, and related arts.
As used herein, the term "about" may refer to a value or composition that is within an acceptable error of a particular value or composition as determined by one of ordinary skill in the art, which will depend in part on how the value or composition is measured or measured.
As used herein, the term "antibody" refers to an immunoglobulin that is a tetrapeptide chain structure formed from two identical heavy chains and two identical light chains joined by an interchain disulfide bond. The immunoglobulin heavy chain constant region differs in amino acid composition and sequence, and thus, in antigenicity. Accordingly, immunoglobulins can be assigned to five classes, or different types of immunoglobulins, i.e., igM, igD, igG, igA and IgE, and the heavy chain constant regions corresponding to the different classes of immunoglobulins are called α, δ, ε, γ and μ, respectively. IgG represents the most important class of immunoglobulins, which can be divided into 4 subclasses again due to differences in chemical structure and biological function: igG1, igG2, igG3 and IgG4. Light chains are classified as either kappa or lambda chains by the difference in constant regions. Subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known to those skilled in the art.
The sequences of the heavy and light chains of the antibody near the N-terminus vary widely, being the variable region (V region); the remaining amino acid sequence near the C-terminus is relatively stable and is a constant region (C-region). The variable region includes 3 hypervariable regions (HVRs) and 4 FR Regions (FR) that are relatively conserved in sequence. The amino acid sequences of the 4 FRs are relatively conserved and do not directly participate in the binding reaction. The 3 hypervariable regions determine the specificity of the antibody, also known as Complementarity Determining Regions (CDRs). Each of the Light Chain Variable Region (LCVR) and Heavy Chain Variable Region (HCVR) consists of 3 CDR regions and 4 FR regions, arranged in sequence from amino-to carboxy-terminus in the order FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The 3 CDR regions of the light chain, namely the light chain hypervariable region (LCDR), refer to LCDR1, LCDR2 and LCDR3; the 3 CDR regions of the heavy chain, namely heavy chain hypervariable regions (HCDR), refer to HCDR1, HCDR2 and HCDR3. The CDR amino acid residues of the LCVR and HCVR regions of the antibodies or antigen-binding fragments of the invention are in numbers and positions that meet the known Kabat numbering convention (LCDR 1-3, HCDR 2-3), or that meet the numbering convention of Kabat and chothia (HDR 1). The four FR regions in the natural heavy and light chain variable regions are generally in a β -sheet configuration, connected by three CDRs forming the connecting loops, which in some cases may form a partially folded structure. The CDRs in each chain are held closely together by the FR regions and form together with the CDRs of the other chain an antigen binding site of the antibody. It is possible to determine which amino acids constitute the FR or CDR regions by comparing the amino acid sequences of the same type of antibody. The constant regions are not directly involved in binding of the antibody to the antigen, but they exhibit different effector functions, such as participation in antibody-dependent cytotoxicity of the antibody.
The invention includes not only whole antibodies but also fragments of antibodies having immunological activity or fusion proteins of antibodies with other sequences. Thus, the invention also includes fragments, derivatives and analogues of said antibodies.
In the present invention, antibodies include murine, chimeric, humanized or fully human antibodies prepared by techniques well known to those skilled in the art. Recombinant antibodies, such as chimeric and humanized monoclonal antibodies, including human and non-human portions, can be prepared using DNA recombination techniques well known in the art.
As used herein, the term "monoclonal antibody" refers to an antibody secreted from a clone derived from a single cell source. Monoclonal antibodies are highly specific, being directed against a single epitope. The cells may be eukaryotic, prokaryotic or phage clonal cell lines.
As used herein, the term "domain" refers to a region in a polypeptide that folds into a particular structure independently of the other regions.
As used herein, the term "single chain variable region fragment" or "scFv" refers to a single chain polypeptide derived from an antibody that retains the ability to bind an antigen. Examples of ScFv include antibody polypeptides formed by recombinant DNA techniques, and wherein Fv regions of immunoglobulin heavy (H chain) and light (L chain) chain fragments are linked via a spacer sequence. Various methods of engineering scfvs are known to those skilled in the art.
As used herein, the term "tumor antigen" refers to a biomolecule that is antigenic, the expression of which results in cancer.
As used herein, the term "chimeric antigen receptor" or "CAR" refers to a fusion protein comprising an extracellular domain capable of binding an antigen, a transmembrane domain derived from a polypeptide different from the polypeptide from which the extracellular domain is derived, and at least one intracellular domain. "chimeric antigen receptor" is sometimes also referred to as "chimeric receptor", "T-body" or "Chimeric Immune Receptor (CIR)". An "extracellular domain capable of binding an antigen" refers to any oligopeptide or polypeptide that can bind to a particular antigen. An "intracellular domain" refers to any oligopeptide or polypeptide known to function in a cell as a domain that transmits a signal to cause activation or inhibition of a biological process.
As used herein, the term "hinge region" generally refers to the region between the CH1 and CH2 functional regions of an immunoglobulin heavy chain. The hinge region is a region located between the extracellular antigen binding domain (e.g., scFv) and the NK cell membrane. The hinge region is typically derived from the IgG family, e.g., can be derived from IgG1 and IgG4, and can also be derived from IgD and CD8.
As used herein, the term "transmembrane region" generally refers to the transmembrane segment that connects the extracellular antigen binding domain and the intracellular signaling domain, typically from a dimeric membrane protein, including predominantly cd3ζ, CD4, CD8, CD28, and the like, capable of anchoring the CAR structure to the NK cell membrane. Different designs of the transmembrane region can affect the expression of the introduced CAR gene.
As used herein, the term "signaling domain" generally refers to functional signaling domains from cd3ζ, cd3γ, cd3δ, cd3ε, fcrγ (FCER 1G), fcrβ (Fc Epsilon R1 b), CD79a, CD79b, fcγriia, DAP10, and DAP12 proteins.
As used herein, the term "co-stimulatory domain" generally refers to a functional signaling domain of a protein from one or more of the following: CD27, CD28, 41BB (CD 137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen 1 (LFA-1), CD2, CD7, NKG2C, B-H3, ligand 、CDS、ICAM-1、GITR、BAFFR、HVEM(LIGHTR)、SLAMF7、NKp80(KLRF1)、CD160、CD19、CD4、CD8α、CD8β、IL2Rβ、IL2Rγ、IL7Rα、ITGA4、VLA1、CD49a、ITGA4、IA4、CD49D、ITGA6、VLA-6、CD49f、ITGAD、CD11d、ITGAE、CD103、ITGAL、CD11a、LFA-1、ITGAM、CD11b、ITGAX、CD11c、ITGB1、CD29、ITGB2、CD18、LFA-1、ITGB7、TNFR2、TRANCE/RANKL、DNAM1(CD226)、SLAMF4(CD244、2B4)、CD84、CD96、CEACAM1、CRTAM、Ly9(CD229)、CD160(BY55)、PSGL1、CD100(SEMA4D)、CD69、SLAMF6(NTB-A、Ly108)、SLAM(SLAMF1、CD150、IPO-3)、BLAME(SLAMF8)、SELPLG(CD162)、LTBR、LAT、GADS、SLP-76、PAG/Cbp、NKp44、NKp30、NKp46 that specifically binds CD83, and NKG2D.
As used herein, the term "CAR-NK cell" refers to a CAR-expressing NK cell, typically obtained by transducing a NK cell with an expression vector encoding the CAR. Commonly used expression vectors are viral vectors, such as lentiviral expression vectors. NK cells modified by chimeric antigen receptor (CAR-NK) are not limited by major histocompatibility complex, and have specific targeting killing activity and lasting amplification capability. In addition to NK cells, other lymphocytes, such as T cells, can also be transformed with an expression vector encoding the CAR to obtain a targeted killer cell expressing the CAR.
As used herein, the terms "nucleic acid molecule," "nucleic acid," and "polynucleotide" are used interchangeably to refer to a polymer of nucleotides. Such nucleotide polymers may contain natural and/or unnatural nucleotides and include, but are not limited to, DNA, RNA, and PNA. "nucleic acid sequence" or "nucleotide sequence" refers to a linear sequence of nucleotides contained in a nucleic acid molecule or polynucleotide.
As used herein, the terms "sequence identity", "sequence identity" and "sequence identity" are used interchangeably to refer to the amount of degree of identity between two amino acid or nucleotide sequences (e.g., a query sequence and a reference sequence), typically expressed as a percentage. Typically, sequence alignment (alignment) is performed and gaps (gaps), if any, introduced prior to calculating the percent identity between two amino acid or nucleotide sequences. If at a certain alignment the amino acid residues or bases in the two sequences are identical, then the two sequences are considered to be identical or matched at that position; amino acid residues or bases in the two sequences differ, and are considered to be inconsistent or mismatched at that position. In some algorithms, the number of matching positions is divided by the total number of positions in the alignment window to obtain sequence identity. In other algorithms, the number of gaps and/or the gap length are also considered. For the purposes of the present invention, the disclosed alignment software BLAST can be used to obtain optimal sequence alignments by using default settings and to calculate sequence identity between two amino acid or nucleotide sequences.
As used herein, the term "vector" refers to a nucleic acid molecule (e.g., a nucleic acid, plasmid, virus, etc.) that can be engineered to contain a polynucleotide of interest (e.g., a coding sequence for a polypeptide of interest) or that can replicate in a host cell. The carrier may include one or more of the following components: an origin of replication, one or more regulatory sequences (such as promoters and/or enhancers) that regulate the expression of the polynucleotide of interest, and/or one or more selectable marker genes (such as an antibiotic resistance gene and a gene useful in colorimetric assays, e.g., β -galactose). The term "expression vector" refers to a vector used to express a polypeptide of interest in a host cell.
As used herein, the term "host cell" refers to a mammalian immune effector cell, particularly a human cell, such as a T cell or NK cell, that can express a CAR provided herein. Host cells include the progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or genomic DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation. Host cells also include cells transfected in vivo with the nucleic acid molecules or expression vectors provided herein.
As used herein, the term "pharmaceutically acceptable carrier" refers to a solid or liquid diluent, filler, antioxidant, stabilizer, etc., which may be safely administered, and which is suitable for administration to humans and/or animals without undue adverse side effects, while maintaining the viability of the drug or active agent located therein. Depending on the route of administration, a variety of different carriers well known in the art may be used, including, but not limited to, sugars, starches, cellulose and its derivatives, maltose, gelatin, talc, calcium sulfate, vegetable oils, synthetic oils, polyols, alginic acid, phosphate buffers, emulsifying agents, isotonic saline, and/or pyrogen-free water and the like. The pharmaceutical composition provided herein can be prepared into clinically acceptable dosage forms such as powder, injection and the like. The pharmaceutical compositions of the invention may be administered to a subject using any suitable route, for example, by oral, intravenous infusion, intramuscular injection, subcutaneous injection, intraperitoneal, rectal, sublingual, or via inhalation, transdermal, etc.
The present invention provides a monoclonal anti-GPRC 5D antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises one or more of the following sequences:
(1) An amino acid sequence as set forth in any one of SEQ ID NO. 1-3;
(2) An amino acid sequence having at least 80%, 82%, 85%, 87%, 90%, 92%, 95%, 96%, 97%, 98%, 99% identity to the amino acid sequence set forth in any one of SEQ ID nos. 1 to 3, and which retains the activity of the amino acid sequence set forth in any one of SEQ ID nos. 1 to 3;
(3) An amino acid sequence of 1 or more amino acid residues is added, substituted, deleted or inserted in the amino acid sequence shown in any one of SEQ ID NO.1 to 3, and retains the activity of the amino acid sequence shown in any one of SEQ ID NO.1 to 3.
In certain embodiments, the heavy chain variable region has an amino acid sequence as set forth in SEQ ID No. 1:
EVQLVESGGDLVKPGGSLKLSCAASGFTFSNYGMSWVRQTPDKRLEWVATISNGGSYTYYPDNVKGRFTISRDNAKNTLYLQMSSLKSEDTATYYCARHAWDYWGQGTTLTVSS.
In certain embodiments, the heavy chain variable region has an amino acid sequence as set forth in SEQ ID No. 2:
EVQLQQSGPELVKPGASVKISCKASGFSFTGYTMNWVKQTHGKNLEWIGLINPYTGGTTYKQKFKGKATLTVDKSSNTAYMELLSLTSEDSAVYYCTRGGFYRYDGDYWGQGTTLTVSS.
In certain embodiments, the heavy chain variable region has an amino acid sequence as set forth in SEQ ID No. 3:
EVQLQQSGPELVKPGASVKISCKASGFSFTGYTMNWVKQSHGKNLEWIGLINPYNGGTTYKQKFKGKATLTVDKSSNTAYMELLSLTSEDSAVYYCTRGGFYRYDGDYWGQGTTLTVSS.
The amino acid sequence of the light chain variable region comprises one or more of the following sequences:
(1) An amino acid sequence as set forth in any one of SEQ ID NO. 8-10;
(2) An amino acid sequence having at least 80%, 82%, 85%, 87%, 90%, 92%, 95%, 96%, 97%, 98%, 99% identity to the amino acid sequence set forth in any one of SEQ ID nos. 8 to 10, and which retains the activity of the amino acid sequence set forth in any one of SEQ ID nos. 8 to 10;
(3) An amino acid sequence of 1 or more amino acid residues added, substituted, deleted or inserted in the amino acid sequence shown in any one of SEQ ID NO. 8-10, and which retains the activity of the amino acid sequence shown in any one of SEQ ID NO. 8-10.
In certain embodiments, the amino acid sequence of the light chain variable region is as set forth in SEQ ID No. 8:
QIVLTQSPAIMSAFPGEKVTMTCNASSSVSYMYWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISIMEAEDAATYYCQHWSTNPLTFGAGTKLELK.
in certain embodiments, the amino acid sequence of the light chain variable region is as set forth in SEQ ID No. 9:
DIQMTQSPSSLSASLGERVSLTCRASQDIGNYLTWLQQEPDGTIKRLIYATSSLHSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYSSSPWTFGGGTKLEIR.
in certain embodiments, the amino acid sequence of the light chain variable region is as set forth in SEQ ID No. 10:
VIQLTQSPSSLSASLGERVSLTCRASQDIGNYLTWLQKEPNGTIKRLIYATFSLHSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYSSSPWTFGGGTKLEIR.
In certain embodiments, the SEQ ID NO.1 is paired with SEQ ID NO. 8.
In certain embodiments, the SEQ ID NO.2 is paired with SEQ ID NO. 9.
In certain embodiments, the SEQ ID NO.3 is paired with SEQ ID NO. 10.
In certain embodiments, the antibody is a single chain antibody and/or a double chain antibody that binds to a cell surface GPRC5D protein.
In certain embodiments, the antibody is a single chain antibody that binds to a cell surface GPRC5D protein.
In certain embodiments, the antibody is a diabody that binds to a cell surface GPRC5D protein.
In certain embodiments, the antibody is selected from one or more of an animal-derived antibody, a chimeric antibody, and/or a humanized antibody.
In certain embodiments, the antibody is an animal-derived antibody.
The invention also provides a single chain variable region fragment scFv, said scFv comprising a heavy chain variable region and a light chain variable region; wherein the heavy chain variable region comprises one or more of the following sequences:
(1) An amino acid sequence as set forth in any one of SEQ ID NO. 1-3;
(2) An amino acid sequence having at least 80%, 82%, 85%, 87%, 90%, 92%, 95%, 96%, 97%, 98%, 99% identity to the amino acid sequence set forth in any one of SEQ ID nos. 1 to 3, and which retains the activity of the amino acid sequence set forth in any one of SEQ ID nos. 1 to 3;
(3) An amino acid sequence of 1 or more amino acid residues is added, substituted, deleted or inserted in the amino acid sequence shown in any one of SEQ ID NO.1 to 3, and retains the activity of the amino acid sequence shown in any one of SEQ ID NO.1 to 3.
In certain embodiments, the heavy chain variable region has an amino acid sequence as set forth in SEQ ID No. 1:
EVQLVESGGDLVKPGGSLKLSCAASGFTFSNYGMSWVRQTPDKRLEWVATISNGGSYTYYPDNVKGRFTISRDNAKNTLYLQMSSLKSEDTATYYCARHAWDYWGQGTTLTVSS.
In certain embodiments, the heavy chain variable region has an amino acid sequence as set forth in SEQ ID No. 2:
EVQLQQSGPELVKPGASVKISCKASGFSFTGYTMNWVKQTHGKNLEWIGLINPYTGGTTYKQKFKGKATLTVDKSSNTAYMELLSLTSEDSAVYYCTRGGFYRYDGDYWGQGTTLTVSS.
In certain embodiments, the heavy chain variable region has an amino acid sequence as set forth in SEQ ID No. 3:
EVQLQQSGPELVKPGASVKISCKASGFSFTGYTMNWVKQSHGKNLEWIGLINPYNGGTTYKQKFKGKATLTVDKSSNTAYMELLSLTSEDSAVYYCTRGGFYRYDGDYWGQGTTLTVSS.
The amino acid sequence of the light chain variable region comprises one or more of the following sequences:
(1) An amino acid sequence as set forth in any one of SEQ ID NO. 8-10;
(2) An amino acid sequence having at least 80%, 82%, 85%, 87%, 90%, 92%, 95%, 96%, 97%, 98%, 99% identity to the amino acid sequence set forth in any one of SEQ ID nos. 8 to 10, and which retains the activity of the amino acid sequence set forth in any one of SEQ ID nos. 8 to 10;
(3) An amino acid sequence of 1 or more amino acid residues added, substituted, deleted or inserted in the amino acid sequence shown in any one of SEQ ID NO. 8-10, and which retains the activity of the amino acid sequence shown in any one of SEQ ID NO. 8-10.
In certain embodiments, the amino acid sequence of the light chain variable region is as set forth in SEQ ID No. 8:
QIVLTQSPAIMSAFPGEKVTMTCNASSSVSYMYWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISIMEAEDAATYYCQHWSTNPLTFGAGTKLELK.
in certain embodiments, the amino acid sequence of the light chain variable region is as set forth in SEQ ID No. 9:
DIQMTQSPSSLSASLGERVSLTCRASQDIGNYLTWLQQEPDGTIKRLIYATSSLHSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYSSSPWTFGGGTKLEIR.
in certain embodiments, the amino acid sequence of the light chain variable region is as set forth in SEQ ID No. 10:
In certain embodiments, the SEQ ID NO.1 is paired with SEQ ID NO. 8.
In certain embodiments, the SEQ ID NO.2 is paired with SEQ ID NO. 9.
In certain embodiments, the SEQ ID NO.3 is paired with SEQ ID NO. 10.
In certain embodiments, the scFv further comprises a connecting peptide; wherein the sequence of the connecting peptide is shown as SEQ ID NO.15, and the scFv comprises one or more of the following sequences.
In certain embodiments, the sequence of the connecting peptide is as shown in SEQ ID No. 15:
GGGGSGGGGSGGGGS。
(1) An amino acid sequence as set forth in any one of SEQ ID NO. 16-18;
(2) An amino acid sequence having at least 80%, 82%, 85%, 87%, 90%, 92%, 95%, 96%, 97%, 98%, 99% identity to the amino acid sequence set forth in any one of SEQ ID nos 16 to 18, and which retains the activity of the amino acid sequence set forth in any one of SEQ ID nos 16 to 18;
(3) An amino acid sequence of 1 or more amino acid residues added, substituted, deleted or inserted in the amino acid sequence shown in any one of SEQ ID NO. 16-18, and which retains the activity of the amino acid sequence shown in any one of SEQ ID NO. 16-18.
In certain embodiments, the scFv has an amino acid sequence as set forth in SEQ ID No. 16:
EVQLVESGGDLVKPGGSLKLSCAASGFTFSNYGMSWVRQTPDKRLEWVATISNGGSYTYYPDNVKGRFTISRDNAKNTLYLQMSSLKSEDTATYYCARHAWDYWGQGTTLTVSSGGGGSGGGGSGGGGSQIVLTQSPAIMSAFPGEKVTMTCNASSSVSYMYWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISIMEAEDAATYYCQHWSTNPLTFGAGTKLELK.
in certain embodiments, the scFv has an amino acid sequence as set forth in SEQ ID No. 17:
EVQLQQSGPELVKPGASVKISCKASGFSFTGYTMNWVKQTHGKNLEWIGLINPYTGGTTYKQKFKGKATLTVDKSSNTAYMELLSLTSEDSAVYYCTRGGFYRYDGDYWGQGTTLTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASLGERVSLTCRASQDIGNYLTWLQQEPDGTIKRLIYATSSLHSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYSSSPWTFGGGTKLEIR.
In certain embodiments, the scFv has an amino acid sequence set forth in SEQ ID No. 18:
EVQLQQSGPELVKPGASVKISCKASGFSFTGYTMNWVKQSHGKNLEWIGLINPYNGGTTYKQKFKGKATLTVDKSSNTAYMELLSLTSEDSAVYYCTRGGFYRYDGDYWGQGTTLTVSSGGGGSGGGGSGGGGSVIQLTQSPSSLSASLGERVSLTCRASQDIGNYLTWLQKEPNGTIKRLIYATFSLHSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYSSSPWTFGGGTKLEIR.
the invention also provides a chimeric antigen receptor CAR comprising:
(1) The above-mentioned scFv is used for the preparation of a medicine,
(2) A transmembrane domain comprising a transmembrane domain,
(3) A costimulatory domain, and
(4) The domain is activated.
In certain embodiments, the CAR has the structure of formula I:
L-scFv-H-TM-C-CD3ζ(I),
Wherein,
Each "-" is independently a connecting peptide or peptide bond;
l is an optional signal peptide sequence;
The scFv is the scFv;
H is an optional hinge region;
TM is a transmembrane domain;
C is a costimulatory signaling molecule;
cd3ζ is a cytoplasmic signaling sequence derived from cd3ζ.
The present invention also provides a drug conjugate comprising:
(1) The antibody, or the scFv; and
(2) A coupling moiety;
wherein the coupling moiety is selected from one or more of a detectable label, a drug, a toxin, a cytokine, an enzyme, or a combination thereof.
The invention also provides a polynucleotide encoding the antibody, or the scFv, or the CAR.
The invention also provides a vector comprising the polynucleotide; wherein the vector is selected from one or more of DNA, RNA, plasmid, lentiviral vector, adenoviral vector, retroviral vector, or a combination thereof.
The invention also provides a genetically engineered cell comprising the vector, the polynucleotide integrated in the chromosome, or expressing the antibody, or expressing the scFv, or expressing the CAR.
In certain embodiments, the cell is an NK cell.
The invention also provides a pharmaceutical composition comprising one or more of the antibody, or the scFv, or the CAR, or the drug conjugate, or the cell; wherein the pharmaceutical composition further comprises a pharmaceutically acceptable carrier, diluent and/or excipient.
The invention also provides an application of the antibody, the scFv, the CAR, the drug conjugate, the cell or the pharmaceutical composition in preparing medicines for preventing and/or treating cancers or tumor related diseases.
In certain embodiments, the tumor-associated disease is multiple myeloma.
Example 1: anti-GPRC 5D antibody sequence obtained by DNA and cell immunization of 8BALBC mice
Monoclonal anti-GPRC 5D antibody sequences were obtained by DNA immunization of 8BALBC mice with cells, by affinity screening. The specific implementation steps are as follows: coating an anti-human FC antibody, blocking for 1 hour at 4 ℃, adding a primary antibody to be detected after 2% BSA, incubating for 2 hours at room temperature, adding a GPRC 5D-goat anti-human secondary antibody after DPBS cleaning, incubating for 1 hour at room temperature, adding TMB for color development for 5 minutes after DPBS cleaning, adding 2M hydrochloric acid to terminate the reaction, and reading an OD450 value.
The amino acid sequence of the heavy chain variable region of ICA2002-18D8C7-1-hIgG1 is shown in SEQ ID NO. 1:
EVQLVESGGDLVKPGGSLKLSCAASGFTFSNYGMSWVRQTPDKRLEWVATISNGGSYTYYPDNVKGRFTISRDNAKNTLYLQMSSLKSEDTATYYCARHAWDYWGQGTTLTVSS
the amino acid sequence of the light chain variable region of ICA2002-18D8C7-1-hIgG1 is shown in SEQ ID NO. 8:
QIVLTQSPAIMSAFPGEKVTMTCNASSSVSYMYWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISIMEAEDAATYYCQHWSTNPLTFGAGTKLELK
the amino acid sequence of the heavy chain variable region of ICA2002-50A5-1-hIgG1 is shown in SEQ ID NO. 2:
EVQLQQSGPELVKPGASVKISCKASGFSFTGYTMNWVKQTHGKNLEWIGLINPYTGGTTYKQKFKGKATLTVDKSSNTAYMELLSLTSEDSAVYYCTRGGFYRYDGDYWGQGTTLTVSS
the amino acid sequence of the light chain variable region of ICA2002-50A5-1-hIgG1 is shown in SEQ ID NO. 9:
DIQMTQSPSSLSASLGERVSLTCRASQDIGNYLTWLQQEPDGTIKRLIYATSSLHSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYSSSPWTFGGGTKLEIR
the amino acid sequence of the heavy chain variable region of ICA2002-50C1-1-hIgG1 is shown in SEQ ID NO. 3:
EVQLQQSGPELVKPGASVKISCKASGFSFTGYTMNWVKQSHGKNLEWIGLINPYNGGTTYKQKFKGKATLTVDKSSNTAYMELLSLTSEDSAVYYCTRGGFYRYDGDYWGQGTTLTVSS
the amino acid sequence of the light chain variable region of ICA2002-50C1-1-hIgG1 is shown in SEQ ID NO. 10:
VIQLTQSPSSLSASLGERVSLTCRASQDIGNYLTWLQKEPNGTIKRLIYATFSLHSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYSSSPWTFGGGTKLEIR
the amino acid sequence of the heavy chain variable region of ICA2002-12B6-1-hIgG1 is shown in SEQ ID NO. 4:
EVQLQQSGPELVKPSTSMKISCKASGYSFTGYTMNWVKQSHGKNLEWIGLFNPYNGGTTYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAVYYCARGGIRRPPGDYWGQGTSVTVSS
The amino acid sequence of the light chain variable region of ICA2002-12B6-1-hIgG1 is shown in SEQ ID NO. 11:
DIVMTQSHKIMSTSVGDRVSITCKASQDVGPSVAWYQQKAGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQYSSYPFTFGAGTKLELK
the amino acid sequence of the heavy chain variable region of ICA2002-22E11A8-1-hIgG1 is shown in SEQ ID NO. 5:
EVQLVETGGGLVQPKGSLKLSCATSGFTFNTNAMNWVRQAPGKGLEWVARIRSKSYNYATYYADSVKDRFTISRDDSQSMVYLQMNNLKTEDTAMYYCVRTGAGTWGQGTLVTVSA
The amino acid sequence of the light chain variable region of ICA2002-22E11A8-1-hIgG1 is shown in SEQ ID NO. 12:
DVVMTQSPLTLSFTVGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGRGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIK
The amino acid sequence of the heavy chain variable region of ICA2002-69H5-1-hIgG1 is shown in SEQ ID NO. 6:
EVQLVESGGGLVRPGGSLKLSCAASGFTFNTYGMSWVRQTPDKRLELVATINSNGGNTYYPDSVKGRFTISRDNAKNTLYLQLSSLKSEDTSMYYCARAYTYAMDYWGQGTSVTVSS
the amino acid sequence of the light chain variable region of ICA2002-69H5-1-hIgG1 is shown in SEQ ID NO. 13:
QIVLTQSPTIMSASPGERVTMTCSASSSVSSSYMFWFQQKSGSSPKLWICSISNLTSGVPARFSGSGSGTSYSLTINSMAADDAATYYGQQWSGNTPTFGAGTTLELK
The amino acid sequence of the heavy chain variable region of ICA2002-195B7-2A11-1E4-hIgG1 is shown in SEQ ID NO. 7:
EVQLQQSGPELVKPGASVKMSCKASGYTFTTYVIHWVKRKPGQGLEWIGFFNPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCARRQLRYSMDYWGQGTSVTVSS
the amino acid sequence of the light chain variable region of ICA2002-195B7-2A11-1E4-hIgG1 is shown in SEQ ID NO. 14:
DIQMTQSPSSLSASLGERVSLTCRASQDIGSSLNWLQQEPDGTIKRLIYATSSLDSGVPKRFSGSRSGSDYSLTISGLESEDFVDYYCLQYASSPYTFGGGTKLEIK
The amino acid sequence of the connecting peptide is shown in SEQ ID NO. 15:
GGGGSGGGGSGGGGS
Example 2: expression and purification results of anti-GPRC 5D monoclonal antibody
The screened monoclonal antibody is constructed on a eukaryotic expression vector of HIgG1 (Fc). And carrying out transient expression and purifying by a Protein A affinity column (Protein A column), wherein due to the special antibody sequence, the purification process is complicated, partial antibodies are difficult to obtain, and finally the 12B6, 18D8C7, 22E11A8, 50A5 and 50C1 antibodies are obtained. The purification results are shown in the following table:
TABLE 1 purification results of GPRC5D monoclonal antibodies
The single-chain variable region fragment of ICA2002-18D8C7-1-hIgG1 is shown in SEQ ID NO. 16:
EVQLVESGGDLVKPGGSLKLSCAASGFTFSNYGMSWVRQTPDKRLEWVATISNGGSYTYYPDNVKGRFTISRDNAKNTLYLQMSSLKSEDTATYYCARHAWDYWGQGTTLTVSSGGGGSGGGGSGGGGSQIVLTQSPAIMSAFPGEKVTMTCNASSSVSYMYWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISIMEAEDAATYYCQHWSTNPLTFGAGTKLELK
the single-chain variable region fragment of ICA2002-50A5-1-hIgG1 is shown in SEQ ID NO. 17:
EVQLQQSGPELVKPGASVKISCKASGFSFTGYTMNWVKQTHGKNLEWIGLINPYTGGTTYKQKFKGKATLTVDKSSNTAYMELLSLTSEDSAVYYCTRGGFYRYDGDYWGQGTTLTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASLGERVSLTCRASQDIGNYLTWLQQEPDGTIKRLIYATSSLHSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYSSSPWTFGGGTKLEIR
The single-chain variable region fragment of ICA2002-50C1-1-hIgG1 is shown in SEQ ID NO. 18:
EVQLQQSGPELVKPGASVKISCKASGFSFTGYTMNWVKQSHGKNLEWIGLINPYNGGTTYKQKFKGKATLTVDKSSNTAYMELLSLTSEDSAVYYCTRGGFYRYDGDYWGQGTTLTVSSGGGGSGGGGSGGGGSVIQLTQSPSSLSASLGERVSLTCRASQDIGNYLTWLQKEPNGTIKRLIYATFSLHSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYSSSPWTFGGGTKLEIR
The single-chain variable region fragment of ICA2002-12B6-1-hIgG1 is shown in SEQ ID NO. 19:
EVQLQQSGPELVKPSTSMKISCKASGYSFTGYTMNWVKQSHGKNLEWIGLFNPYNGGTTYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAVYYCARGGIRRPPGDYWGQGTSVTVSSGGGGSGGGGSGGGGSDIVMTQSHKIMSTSVGDRVSITCKASQDVGPSVAWYQQKAGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQYSSYPFTFGAGTKLELK
The single-chain variable region fragment of ICA2002-22E11A8-1-hIgG1 is shown in SEQ ID NO. 20:
EVQLVETGGGLVQPKGSLKLSCATSGFTFNTNAMNWVRQAPGKGLEWVARIRSKSYNYATYYADSVKDRFTISRDDSQSMVYLQMNNLKTEDTAMYYCVRTGAGTWGQGTLVTVSAGGGGSGGGGSGGGGSDVVMTQSPLTLSFTVGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGRGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIK
example 3: binding force detection of anti-GPRC 5D antibodies and cell surface GPRC5D proteins
The detection of the binding capacity of cell surface GPRC5D antigen to antibody was performed by flow cytometry using DPBS containing 1% FBS as buffer. That is, 1E 5/well of cells (MM.1S, CHOK1-GPRC 5D) were prepared, 100 μl/well of 96-well U-shaped bottom plate (Corning 3799) was added, the antibody was prepared to 100nM using the buffer, and then diluted according to 5-fold dilution of the antibody for 8 concentration gradients. The prepared antibodies with different concentration gradients are added into the paved target cells according to 100 mu l/hole, and the mixture is uniformly mixed, and incubated for 1 hour at 4 ℃. Adding the prepared buffer solution according to 100 μl/hole, 1500rpm,4 ℃,5 min, discarding the supernatant, adding the prepared buffer solution according to 200 μl/hole, 1500rpm,4 ℃,5 min, discarding the supernatant. According to 1:200 secondary antibodies were added, 100 μl/well and incubated for 1 hour at 4deg.C. Adding the prepared buffer solution according to 100 μl/hole, 1500rpm,4 ℃,5 min, discarding the supernatant, adding the prepared buffer solution according to 200 μl/hole, 1500rpm,4 ℃,5 min, discarding the supernatant. And adding the prepared buffer solution according to 100 mu l/hole, and detecting the binding force of the GPRC5D antibody and the cell surface antigen by using a BD flow cell sorter.
The binding capacity of the flow assay to tumor cells and GPRC 5D-overexpressing cells is shown in figures 1,2, in mm.is cells and CHOK1-GPRC5D cells, 3 of the 5 sequences of the invention, 3 of which had much higher affinities than the GPRC5D x CD3 bispecific antibody BMK group developed by robusta.
Example 4: electrotransport plasmid construction
Electrotransformation of empty plasmid and GPRC5D core plasmid (12B 6, 18D8C7, 22E11A8, 50A5, 50C 1) the synthesis of the gene from Biotechnology Co., ltd was designated PL-TCAR (G, X) (X is 1,2,3,4, 5), and the CAR structure in the present application is shown in FIG. 3.
Example 5: detection of electrical transitions and positive rates of GPRC5D CARs
First, the plasmid was transferred into NK92 cells by using a cytoelectrotransport. 5 mug of electrotransport plasmids are uniformly mixed in an electrotransport buffer, transferred into NK92 cells of 5E6 through a cell electrotransport device under 480V voltage, and the cells after electrotransport are placed into a pre-heated NK92 cell culture medium (without PS). Incubated at 37℃with 5% CO 2 overnight. Second, detection of NK92 cell positive rate after electrotransformation. Counting cells of the previous day, using the corresponding cells of each NK92 cell zone 1E5 for flow detection, namely adding the cells prepared by 1E 5/hole into a 96-hole U-shaped bottom plate (Corning 3799), supplementing each hole to 200 mu l/hole by using prepared flow buffer, 1500 turns/min, 4 ℃ for 5 minutes, discarding the supernatant, adding the prepared buffer again according to 200 mu l/hole for 1500 turns/min, 4 ℃ for 5 minutes, and discarding the supernatant. The antibody for detection was prepared according to 1:100 was mixed with DPBS in 1% FBS and incubated at 4℃for 1 hour at 100 μl/well. Adding the prepared buffer solution according to 100 μl/hole, 1500rpm,4 ℃,5 min, discarding the supernatant, adding the prepared buffer solution according to 200 μl/hole, 1500rpm,4 ℃,5 min, discarding the supernatant. And adding the prepared buffer solution according to 100 μl/hole, and detecting the GPRC5D CAR positive rate by using a BD flow cell sorter.
The results are shown in FIG. 4, and positive rates are analyzed by a flow cytometer after the electric transfer, wherein the positive rate of positive control NK92-TCAR (BMK 1) is 28.6%, and the positive rates of experimental group NK92-TCAR (G, 1), NK92-TCAR (G, 2), NK92-TCAR (G, 3) and NK92-TCAR (G, 4) are 37.4% respectively; 30.3%;24%;23.9% of the above groups represent successful transduction of the CAR structure, with a positive rate of 1.06% for the negative control NT-NK 92.
Example 6: killing of NK92 CAR (expression of CAR and killing on mm.1s-luc)
The ability of GPRC5D to kill target cells MM.1S-Luc cells and NCI-H929 cells was examined by a luciferase luminescence method. Positive rates of NK92 cells of electrotransferred GPRC5D were adjusted to be consistent, target cells mm.1s-Luc were seeded to 96-well U-shaped bottom plates (corning 3799) according to 1E4/50 μl/well, and effector cells with consistent positive rates were seeded to 4:1,2:1,1:1,1:2 into target cells, followed by 100g,2 minutes. Incubated at 37℃with 5% CO 2 overnight. After 24 hours, 50 μl/hole of luciferase reagent is added into each hole, and the luciferase reagent is transferred to a 96-hole black wall plate in a dark place for 5 minutes and put into a multifunctional microplate reader for reading data.
As shown in fig. 5 and 6, GPRC5D has a killing effect equivalent to BMK1 in mm.1s and stronger than NT-NK 92; on NCI-H929-LUC cells, the killing effect is slightly higher than BMK1 and stronger than NT-NK92
It should be understood that the above examples are illustrative and are not intended to encompass all possible implementations encompassed by the claims. Various modifications and changes may be made in the above embodiments without departing from the scope of the disclosure. Likewise, the individual features of the above embodiments can also be combined arbitrarily to form further embodiments of the invention which may not be explicitly described. Therefore, the above examples merely represent several embodiments of the present invention and do not limit the scope of protection of the patent of the present invention.
Claims (13)
1. A monoclonal anti-GPRC 5D antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region has an amino acid sequence as set forth in any one of SEQ ID nos. 1-2;
the amino acid sequence of the light chain variable region is shown in any one of SEQ ID NO. 8-9;
Wherein, SEQ ID NO.1 is paired with SEQ ID NO.8, and SEQ ID NO.2 is paired with SEQ ID NO. 9.
2. The antibody of claim 1, wherein the antibody is a single chain antibody and/or a double chain antibody that binds to a cell surface GPRC5D protein.
3. A single chain variable fragment scFv, wherein said scFv comprises a heavy chain variable region and a light chain variable region; wherein the amino acid sequence of the heavy chain variable region is shown in any one of SEQ ID NO. 1-2;
The amino acid sequence of the light chain variable region is shown in any one of SEQ ID NO. 8-9;
Wherein, SEQ ID NO.1 is paired with SEQ ID NO.8, and SEQ ID NO.2 is paired with SEQ ID NO. 9.
4. The scFv according to claim 3, wherein the scFv further comprises a linker peptide; wherein the sequence of the connecting peptide is shown as SEQ ID NO.15, and the amino acid sequence of the scFv is shown as any one of SEQ ID NO. 16-17.
5. A chimeric antigen receptor CAR, the CAR comprising:
(1) The scFv of claim 4,
(2) A transmembrane domain comprising a transmembrane domain,
(3) A costimulatory domain, and
(4) The domain is activated.
6. The CAR of claim 5, wherein the CAR has the structure of formula I:
L-scFv-H-TM-C-CD3ζ(I),
Wherein,
Each "-" is independently a connecting peptide or peptide bond;
l is an optional signal peptide sequence;
an scFv is the scFv of claim 4;
H is an optional hinge region;
TM is a transmembrane domain;
C is a costimulatory signaling molecule;
cd3ζ is a cytoplasmic signaling sequence derived from cd3ζ.
7. A drug conjugate, the drug conjugate comprising:
(1) The antibody of any one of claims 1-2, or the scFv of any one of claims 3-4; and
(2) A coupling moiety;
wherein the coupling moiety is selected from one or more of a detectable label, a drug, a toxin, a cytokine, an enzyme, or a combination thereof.
8. A polynucleotide encoding the antibody of any one of claims 1-2, or the scFv of any one of claims 3-4, or the CAR of any one of claims 5-6.
9. A vector comprising the polynucleotide of claim 8; wherein the vector is selected from one or more of DNA, RNA, plasmid, lentiviral vector, adenoviral vector, retroviral vector, or a combination thereof.
10. Genetically engineered cell, characterized in that it comprises a vector according to claim 9, a chromosome into which the polynucleotide according to claim 8 is integrated, or an antibody according to any one of claims 1-2 is expressed, or an scFv according to any one of claims 3-4 is expressed, or a CAR according to any one of claims 5-6 is expressed.
11. The genetically engineered cell of claim 10, wherein the cell is an NK cell.
12. A pharmaceutical composition comprising one or more of the antibody of any one of claims 1-2, or the scFv of any one of claims 3-4, or the CAR of any one of claims 5-6, or the drug conjugate of claim 7, or the cell of any one of claims 10-11; wherein the pharmaceutical composition further comprises a pharmaceutically acceptable carrier, diluent and/or excipient.
13. Use of an antibody according to any one of claims 1-2, or an scFv according to any one of claims 3-4, or a CAR according to any one of claims 5-6, or a drug conjugate according to claim 7, or a cell according to any one of claims 10-11, or a pharmaceutical composition according to claim 12, in the manufacture of a medicament for the prevention and/or treatment of multiple myeloma.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202410166101.XA CN117700558B (en) | 2024-02-06 | 2024-02-06 | Monoclonal anti-GPRC 5D antibody and anti-GPRC 5D-CAR-NK cell |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202410166101.XA CN117700558B (en) | 2024-02-06 | 2024-02-06 | Monoclonal anti-GPRC 5D antibody and anti-GPRC 5D-CAR-NK cell |
Publications (2)
Publication Number | Publication Date |
---|---|
CN117700558A CN117700558A (en) | 2024-03-15 |
CN117700558B true CN117700558B (en) | 2024-05-03 |
Family
ID=90162896
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202410166101.XA Active CN117700558B (en) | 2024-02-06 | 2024-02-06 | Monoclonal anti-GPRC 5D antibody and anti-GPRC 5D-CAR-NK cell |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN117700558B (en) |
Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN113597433A (en) * | 2019-01-18 | 2021-11-02 | 詹森生物科技公司 | GPRC5D chimeric antigen receptors and cells expressing these receptors |
CN115232209A (en) * | 2021-04-22 | 2022-10-25 | 南京北恒生物科技有限公司 | Antibody targeting GPRC5D and use thereof |
CN115386010A (en) * | 2021-05-23 | 2022-11-25 | 上海邦耀生物科技有限公司 | Chimeric antigen receptor targeting GPRC5D and application thereof |
CN115386006A (en) * | 2021-05-23 | 2022-11-25 | 上海祥耀生物科技有限责任公司 | anti-GPRC 5D antibody, preparation method and application thereof |
CN116003598A (en) * | 2022-08-30 | 2023-04-25 | 苏州缔码生物科技有限公司 | Recombinant humanized monoclonal antibody targeting human GPRC5D and application thereof |
CN116925229A (en) * | 2023-09-19 | 2023-10-24 | 南京驯鹿生物技术股份有限公司 | GPRC5D targeting antibody and application thereof |
CN117229407A (en) * | 2023-11-14 | 2023-12-15 | 成都优赛诺生物科技有限公司 | Single-domain antibody targeting GPRC5D, chimeric antigen receptor and application thereof |
-
2024
- 2024-02-06 CN CN202410166101.XA patent/CN117700558B/en active Active
Patent Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN113597433A (en) * | 2019-01-18 | 2021-11-02 | 詹森生物科技公司 | GPRC5D chimeric antigen receptors and cells expressing these receptors |
CN115232209A (en) * | 2021-04-22 | 2022-10-25 | 南京北恒生物科技有限公司 | Antibody targeting GPRC5D and use thereof |
CN115386010A (en) * | 2021-05-23 | 2022-11-25 | 上海邦耀生物科技有限公司 | Chimeric antigen receptor targeting GPRC5D and application thereof |
CN115386006A (en) * | 2021-05-23 | 2022-11-25 | 上海祥耀生物科技有限责任公司 | anti-GPRC 5D antibody, preparation method and application thereof |
CN116003598A (en) * | 2022-08-30 | 2023-04-25 | 苏州缔码生物科技有限公司 | Recombinant humanized monoclonal antibody targeting human GPRC5D and application thereof |
CN116925229A (en) * | 2023-09-19 | 2023-10-24 | 南京驯鹿生物技术股份有限公司 | GPRC5D targeting antibody and application thereof |
CN117229407A (en) * | 2023-11-14 | 2023-12-15 | 成都优赛诺生物科技有限公司 | Single-domain antibody targeting GPRC5D, chimeric antigen receptor and application thereof |
Also Published As
Publication number | Publication date |
---|---|
CN117700558A (en) | 2024-03-15 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN110050000B (en) | Fusion protein containing TGF-beta receptor and medical application thereof | |
CN106029697B (en) | Canine antibodies with modified CH2-CH3 sequences | |
KR101780877B1 (en) | Antibodies that bind to human programmed death ligand 1 (pd-l1) | |
CN104968682A (en) | Bispecific antibodies against CD3[epsilon] and BCMA | |
MX2010013565A (en) | Anti-human interleukin-20 antibodies. | |
CN114560941B (en) | Antibodies to CLDN18.2 and uses thereof | |
CN111744013B (en) | Methods and pharmaceutical combinations for treating diseases using anti-TIGIT antibodies in combination with PD-1 inhibitors | |
CN104822704A (en) | Humanized antibodies to cluster of differentiation 3 (CD3) | |
US20220049008A1 (en) | Antibodies specific to cd44 | |
WO2021013142A1 (en) | Anti-4-1bb antibody, antigen-binding fragment thereof, and bispecific antibody | |
WO2022033057A1 (en) | Single-domain antibody-based bcma chimeric antigen receptor, and application thereof | |
CN113474372A (en) | Monoclonal antibody of anti-CEACAM 5, preparation method and application thereof | |
CA3229014A1 (en) | Bispecific antibody and use thereof | |
TW202309083A (en) | Anti-cldn4/anti-cd137 bispecific antibody | |
US20220041749A1 (en) | Antibodies specific to muc18 | |
CN116635071A (en) | anti-TSPAN 8-anti-CD 3 bispecific antibodies and anti-TSPAN 8 antibodies | |
CN112079927B (en) | CD123 binding protein, CAR containing same and application thereof | |
CN117700558B (en) | Monoclonal anti-GPRC 5D antibody and anti-GPRC 5D-CAR-NK cell | |
RU2761638C1 (en) | Antibodies against the programmed death ligand (pd-l1) and application thereof | |
AU2017201102A1 (en) | Compositions and methods for treating proliferative disorders | |
CN115715297A (en) | anti-FLT 3 antibodies and compositions | |
WO2023185256A1 (en) | Antibody that specifically binds to cd7 and use thereof in preparing chimeric antigen receptor | |
KR102548256B1 (en) | Antibody specific for CD22 and uses thereof | |
CN115947855B (en) | Preparation of anti-CD 24 antibodies and uses thereof | |
CN111971303B (en) | anti-CD 27 antibodies and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |