CN117683759A - 3-dehydroshikimate dehydratase mutant and recombinant escherichia coli for producing protocatechuic acid - Google Patents
3-dehydroshikimate dehydratase mutant and recombinant escherichia coli for producing protocatechuic acid Download PDFInfo
- Publication number
- CN117683759A CN117683759A CN202311752427.2A CN202311752427A CN117683759A CN 117683759 A CN117683759 A CN 117683759A CN 202311752427 A CN202311752427 A CN 202311752427A CN 117683759 A CN117683759 A CN 117683759A
- Authority
- CN
- China
- Prior art keywords
- gene
- escherichia coli
- acid
- mutant
- protocatechuic acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- YQUVCSBJEUQKSH-UHFFFAOYSA-N 3,4-dihydroxybenzoic acid Chemical compound OC(=O)C1=CC=C(O)C(O)=C1 YQUVCSBJEUQKSH-UHFFFAOYSA-N 0.000 title claims abstract description 74
- 241000588724 Escherichia coli Species 0.000 title claims abstract description 43
- 108010055053 3-dehydroshikimate dehydratase Proteins 0.000 title claims abstract description 22
- 230000005764 inhibitory process Effects 0.000 claims abstract description 11
- 101150040872 aroE gene Proteins 0.000 claims abstract description 10
- 101100163490 Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) aroA1 gene Proteins 0.000 claims abstract description 5
- 108050008280 Shikimate dehydrogenase Proteins 0.000 claims abstract description 5
- 101150037081 aroA gene Proteins 0.000 claims abstract description 5
- 230000014509 gene expression Effects 0.000 claims description 16
- 230000001276 controlling effect Effects 0.000 claims description 14
- 108090000623 proteins and genes Proteins 0.000 claims description 13
- 101150102858 aroD gene Proteins 0.000 claims description 9
- 101100002724 Thermus thermophilus aroH gene Proteins 0.000 claims description 8
- 101150076125 aroG gene Proteins 0.000 claims description 8
- 101150097303 glyA gene Proteins 0.000 claims description 8
- 101150115934 proV gene Proteins 0.000 claims description 8
- 108020001482 shikimate kinase Proteins 0.000 claims description 8
- 101150040618 talB gene Proteins 0.000 claims description 8
- 101150014795 tktA gene Proteins 0.000 claims description 7
- 101100462232 Bacillus subtilis (strain 168) opuBA gene Proteins 0.000 claims description 6
- 108091000080 Phosphotransferase Proteins 0.000 claims description 6
- LCTONWCANYUPML-UHFFFAOYSA-N Pyruvic acid Chemical compound CC(=O)C(O)=O LCTONWCANYUPML-UHFFFAOYSA-N 0.000 claims description 6
- 101150079604 glyA1 gene Proteins 0.000 claims description 6
- 108020004707 nucleic acids Proteins 0.000 claims description 6
- 102000039446 nucleic acids Human genes 0.000 claims description 6
- 150000007523 nucleic acids Chemical class 0.000 claims description 6
- 229930029653 phosphoenolpyruvate Natural products 0.000 claims description 6
- 101150106193 tal gene Proteins 0.000 claims description 6
- 101150024271 TKT gene Proteins 0.000 claims description 5
- 102000020233 phosphotransferase Human genes 0.000 claims description 5
- 230000001105 regulatory effect Effects 0.000 claims description 5
- JXOHGGNKMLTUBP-HSUXUTPPSA-N shikimic acid Chemical compound O[C@@H]1CC(C(O)=O)=C[C@@H](O)[C@H]1O JXOHGGNKMLTUBP-HSUXUTPPSA-N 0.000 claims description 5
- JXOHGGNKMLTUBP-JKUQZMGJSA-N shikimic acid Natural products O[C@@H]1CC(C(O)=O)=C[C@H](O)[C@@H]1O JXOHGGNKMLTUBP-JKUQZMGJSA-N 0.000 claims description 5
- 101100138542 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) phbH gene Proteins 0.000 claims description 4
- 101100299477 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) phbI gene Proteins 0.000 claims description 4
- 101100435931 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) aroK gene Proteins 0.000 claims description 4
- 101150083869 aroK gene Proteins 0.000 claims description 4
- 101150007004 aroL gene Proteins 0.000 claims description 4
- 101150108612 aroQ gene Proteins 0.000 claims description 4
- 230000002018 overexpression Effects 0.000 claims description 4
- 238000002360 preparation method Methods 0.000 claims description 4
- 101150045242 ptsH gene Proteins 0.000 claims description 4
- 101150118630 ptsI gene Proteins 0.000 claims description 4
- 101150015622 pyk gene Proteins 0.000 claims description 4
- 101150053304 pykF gene Proteins 0.000 claims description 4
- 101150076849 rpoS gene Proteins 0.000 claims description 4
- 239000013598 vector Substances 0.000 claims description 4
- 108010015895 Glycerone kinase Proteins 0.000 claims description 3
- 230000001419 dependent effect Effects 0.000 claims description 3
- 229940107700 pyruvic acid Drugs 0.000 claims description 3
- 102000003960 Ligases Human genes 0.000 claims description 2
- 108090000364 Ligases Proteins 0.000 claims description 2
- 230000002101 lytic effect Effects 0.000 claims description 2
- 102000004169 proteins and genes Human genes 0.000 claims description 2
- 230000009466 transformation Effects 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 1
- DTBNBXWJWCWCIK-UHFFFAOYSA-N phosphoenolpyruvic acid Chemical compound OC(=O)C(=C)OP(O)(O)=O DTBNBXWJWCWCIK-UHFFFAOYSA-N 0.000 claims 1
- SLWWJZMPHJJOPH-UHFFFAOYSA-N DHS Natural products OC1CC(C(O)=O)=CC(=O)C1O SLWWJZMPHJJOPH-UHFFFAOYSA-N 0.000 abstract description 13
- 230000000694 effects Effects 0.000 abstract description 9
- SLWWJZMPHJJOPH-PHDIDXHHSA-N 3-dehydroshikimic acid Chemical compound O[C@@H]1CC(C(O)=O)=CC(=O)[C@H]1O SLWWJZMPHJJOPH-PHDIDXHHSA-N 0.000 abstract description 7
- 108090001042 Hydro-Lyases Proteins 0.000 abstract description 6
- 102000004867 Hydro-Lyases Human genes 0.000 abstract description 6
- YVYKOQWMJZXRRM-PUFIMZNGSA-N 3-dehydroshikimate Chemical compound O[C@@H]1C[C@H](C(O)=O)C=C(O)[C@@H]1O YVYKOQWMJZXRRM-PUFIMZNGSA-N 0.000 abstract description 4
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 abstract description 4
- 235000004279 alanine Nutrition 0.000 abstract description 4
- 150000001413 amino acids Chemical group 0.000 abstract description 4
- 230000015572 biosynthetic process Effects 0.000 abstract description 4
- 229910052799 carbon Inorganic materials 0.000 abstract description 4
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 abstract description 3
- 239000004475 Arginine Substances 0.000 abstract description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 abstract description 2
- 230000000903 blocking effect Effects 0.000 abstract 1
- 238000000855 fermentation Methods 0.000 description 32
- 230000004151 fermentation Effects 0.000 description 32
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 13
- 239000008103 glucose Substances 0.000 description 13
- 238000004519 manufacturing process Methods 0.000 description 11
- 239000002773 nucleotide Substances 0.000 description 11
- 125000003729 nucleotide group Chemical group 0.000 description 11
- 239000000047 product Substances 0.000 description 11
- 239000007788 liquid Substances 0.000 description 8
- 102000004190 Enzymes Human genes 0.000 description 7
- 108090000790 Enzymes Proteins 0.000 description 7
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 6
- 210000004027 cell Anatomy 0.000 description 6
- 238000006243 chemical reaction Methods 0.000 description 6
- 239000001963 growth medium Substances 0.000 description 6
- DTBNBXWJWCWCIK-UHFFFAOYSA-K phosphonatoenolpyruvate Chemical compound [O-]C(=O)C(=C)OP([O-])([O-])=O DTBNBXWJWCWCIK-UHFFFAOYSA-K 0.000 description 6
- 239000002609 medium Substances 0.000 description 5
- 238000000329 molecular dynamics simulation Methods 0.000 description 5
- 230000035772 mutation Effects 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 241000196324 Embryophyta Species 0.000 description 4
- 241000282326 Felis catus Species 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- VLTRZXGMWDSKGL-UHFFFAOYSA-N perchloric acid Chemical compound OCl(=O)(=O)=O VLTRZXGMWDSKGL-UHFFFAOYSA-N 0.000 description 4
- 239000000843 powder Substances 0.000 description 4
- NGHMDNPXVRFFGS-IUYQGCFVSA-N D-erythrose 4-phosphate Chemical compound O=C[C@H](O)[C@H](O)COP(O)(O)=O NGHMDNPXVRFFGS-IUYQGCFVSA-N 0.000 description 3
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 239000001888 Peptone Substances 0.000 description 3
- 108010080698 Peptones Proteins 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 238000012258 culturing Methods 0.000 description 3
- 101150038914 dhaL gene Proteins 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 238000011081 inoculation Methods 0.000 description 3
- 238000012417 linear regression Methods 0.000 description 3
- WRUGWIBCXHJTDG-UHFFFAOYSA-L magnesium sulfate heptahydrate Chemical compound O.O.O.O.O.O.O.[Mg+2].[O-]S([O-])(=O)=O WRUGWIBCXHJTDG-UHFFFAOYSA-L 0.000 description 3
- 229940061634 magnesium sulfate heptahydrate Drugs 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 229910021645 metal ion Inorganic materials 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 229910052760 oxygen Inorganic materials 0.000 description 3
- 239000001301 oxygen Substances 0.000 description 3
- 235000019319 peptone Nutrition 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 2
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 2
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 2
- 108010021582 Glucokinase Proteins 0.000 description 2
- 102000030595 Glucokinase Human genes 0.000 description 2
- 102000002667 Glycine hydroxymethyltransferase Human genes 0.000 description 2
- 108010043428 Glycine hydroxymethyltransferase Proteins 0.000 description 2
- 108020004530 Transaldolase Proteins 0.000 description 2
- 102100028601 Transaldolase Human genes 0.000 description 2
- 102000014701 Transketolase Human genes 0.000 description 2
- 108010043652 Transketolase Proteins 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 235000001014 amino acid Nutrition 0.000 description 2
- 235000011114 ammonium hydroxide Nutrition 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 229960002413 ferric citrate Drugs 0.000 description 2
- 238000009776 industrial production Methods 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- 238000000034 method Methods 0.000 description 2
- 230000000813 microbial effect Effects 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 108010080376 3-Deoxy-7-Phosphoheptulonate Synthase Proteins 0.000 description 1
- 108050006180 3-dehydroquinate synthase Proteins 0.000 description 1
- WVMWZWGZRAXUBK-JLEYCGRDSA-N 3-dehydroquinic acid Chemical compound O[C@H]1C[C@](O)(C(O)=O)CC(=O)[C@@H]1O WVMWZWGZRAXUBK-JLEYCGRDSA-N 0.000 description 1
- WVMWZWGZRAXUBK-UHFFFAOYSA-N 3-dehydroquinic acid Natural products OC1CC(O)(C(O)=O)CC(=O)C1O WVMWZWGZRAXUBK-UHFFFAOYSA-N 0.000 description 1
- PJWIPEXIFFQAQZ-PUFIMZNGSA-N 7-phospho-2-dehydro-3-deoxy-D-arabino-heptonic acid Chemical compound OP(=O)(O)OC[C@@H](O)[C@@H](O)[C@H](O)CC(=O)C(O)=O PJWIPEXIFFQAQZ-PUFIMZNGSA-N 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 229910021591 Copper(I) chloride Inorganic materials 0.000 description 1
- 241000186226 Corynebacterium glutamicum Species 0.000 description 1
- 101710088194 Dehydrogenase Proteins 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241001544342 Polyspora axillaris Species 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 241000589776 Pseudomonas putida Species 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 239000001361 adipic acid Substances 0.000 description 1
- 238000005273 aeration Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 235000019270 ammonium chloride Nutrition 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 230000003064 anti-oxidating effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 230000002155 anti-virotic effect Effects 0.000 description 1
- 101150090235 aroB gene Proteins 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000003570 biosynthesizing effect Effects 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 125000004432 carbon atom Chemical group C* 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- OXBLHERUFWYNTN-UHFFFAOYSA-M copper(I) chloride Chemical compound [Cu]Cl OXBLHERUFWYNTN-UHFFFAOYSA-M 0.000 description 1
- 239000002537 cosmetic Substances 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 230000017858 demethylation Effects 0.000 description 1
- 238000010520 demethylation reaction Methods 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 235000013399 edible fruits Nutrition 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- -1 ferric citrate amine Chemical class 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 239000005003 food packaging material Substances 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000004190 glucose uptake Effects 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 238000013537 high throughput screening Methods 0.000 description 1
- 239000000543 intermediate Substances 0.000 description 1
- NPFOYSMITVOQOS-UHFFFAOYSA-K iron(III) citrate Chemical compound [Fe+3].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NPFOYSMITVOQOS-UHFFFAOYSA-K 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 235000019796 monopotassium phosphate Nutrition 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 150000007965 phenolic acids Chemical class 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- PJNZPQUBCPKICU-UHFFFAOYSA-N phosphoric acid;potassium Chemical compound [K].OP(O)(O)=O PJNZPQUBCPKICU-UHFFFAOYSA-N 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 238000011112 process operation Methods 0.000 description 1
- 235000018102 proteins Nutrition 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000009420 retrofitting Methods 0.000 description 1
- 238000011218 seed culture Methods 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- WKOLLVMJNQIZCI-UHFFFAOYSA-N vanillic acid Chemical compound COC1=CC(C(O)=O)=CC=C1O WKOLLVMJNQIZCI-UHFFFAOYSA-N 0.000 description 1
- TUUBOHWZSQXCSW-UHFFFAOYSA-N vanillic acid Natural products COC1=CC(O)=CC(C(O)=O)=C1 TUUBOHWZSQXCSW-UHFFFAOYSA-N 0.000 description 1
- 238000009423 ventilation Methods 0.000 description 1
- 239000003643 water by type Substances 0.000 description 1
Landscapes
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The invention discloses a 3-dehydroshikimic acid dehydratase mutant and recombinant escherichia coli for producing protocatechuic acid, and the mutant ApAroz R363A The amino acid sequence of (2) is shown as SEQ ID NO.3, and is obtained by mutating the 363 rd arginine of the starting sequence into alanine; the invention also constructs a recombinant escherichia coli based on the mutant, and specifically: knocking out 3-dehydroshikimic acid in E.coli by blocking the carbon flow from the 3-dehydroshikimic acid flow to downstream shikimic acidThe shikimate dehydrogenase gene aroE successfully constructs a chassis strain with high yield of 3-dehydroshikimate, and introduces a high-activity 3-dehydroshikimate dehydratase mutant ApAroz with resistance to product inhibition R363A And constructing a protocatechuic acid biosynthesis path in the chassis strain, and finally constructing an escherichia coli recombinant strain for efficiently biosynthesis of protocatechuic acid.
Description
Technical Field
The invention belongs to the technical field of biology, and particularly relates to a 3-dehydroshikimate dehydratase mutant and recombinant escherichia coli for producing protocatechuic acid.
Background
Protocatechuic acid (3, 4-dihydroxybenzoic acid, PCA) is a natural phenolic acid that is widely found in plants. Researches show that the compound has biological activities of antioxidation, anti-inflammation, antibiosis, antivirus, anti-tumor and the like, and can also be used as a material monomer for synthesizing high-performance polymers and food packaging materials, so that the compound is widely applied to pharmaceutical, health-care food, cosmetics and novel material industries. Currently, PCA production mainly involves plant extraction and chemical synthesis. A common PCA production method is extraction from plants, but its industrial production is limited due to low yield (e.g., 10.81. Mu.g/g extracted from Gordonia axillaris fruits). Chemical PCA synthesis by means of vanillic acid demethylation has several drawbacks, such as the use of environmental contaminants (hydrochloric acid) and the need for high temperature conditions (250 ℃). In this case, the microbial fermentation to produce PCA represents a green, more efficient, sustainable alternative to obtaining this compound, and is therefore of increasing interest to researchers, with a broad market prospect.
The biosynthesis of 3-dehydroshikimate in E.coli starts with glucose and two intermediates phosphoenolpyruvate (PEP) and erythrose-4-phosphate (E4P) are metabolized by the central carbon and converted to 3-dehydroshikimate by 3-deoxy-D-arabinoheptulo-7-phosphate synthase (DAHP), DHQ synthase (aroB) and DHQ dehydratase (aroD). Subsequently, 3-dehydroshikimic acid is catalyzed by heterologous 3-dehydroshikimic acid dehydratase to protocatechuic acid. To date, many groups at home and abroad have engineered different microbial host strains, including E.coli, corynebacterium glutamicum, and Pseudomonas putida, for the production of PCA. However, complicated fermentation processes and low yields limit the commercial production of protocatechuic acid. The escherichia coli has the characteristics of multiple genetic tools, clear genetic information, rapid growth and high carbon absorptivity, is an ideal host for producing protocatechuic acid, but the high-efficiency production of protocatechuic acid in the escherichia coli is limited by the reduction of the 3-dehydroshikimase activity of the PCA product inhibition and the toxicity of the product to cells.
Disclosure of Invention
In order to solve the problems, the invention provides a 3-dehydroshikimic acid dehydratase mutant and an escherichia coli recombinant strain for efficiently biosynthesizing protocatechuic acid, which are based on high-throughput screening work of mutation sites, so as to obtain a mutant for removing the product inhibition of protocatechuic acid to ApAroZ, and the recombinant escherichia coli containing the mutant is subjected to metabolic modification, so that the escherichia coli with high yield of protocatechuic acid is finally obtained, and the fed-batch yield of a 5L fermentation tank reaches 37.02g/L.
The first object of the invention is to provide a 3-dehydroshikimate dehydratase mutant, the amino acid sequence of which is shown in SEQ ID NO.3, and which is obtained by mutating arginine at 363 rd position of the starting sequence into alanine. Specifically, the sequence is as follows:
MNILRLTTLALGLMVSGIAAAQTYVVDRYQDDSNKGSLRWAIEQANANPGEASDILIQAVGKAPYAIKLNSALPEIKAPVKIIGTQWDKTGEYIAIDGSNYIKGEGAKACPGANPEQYGTNVRTMTLPGLVLRDVNNVTLKGLDIHRFCIGVLINRSSNNLIQHNRISNNYGGAGVMLTGDDGQGNPTATTTNNNKVLDNIFQDNGDGLELTRGAAFNLIANNHFVSTKANPEPSQGIEILWGNDNAVVGNKFENYSDGLQINWGKRNYIAYNEMTNNSIGFNMTGDGNILDSNKVHGNRIGVAIRSEKDANAKITLTKNLIWDNGKDIKRCEAGGSCVPDQRLGAIVFAVPALEHAGFVGSAGGGVIVDPSKQQKTCTQPNEQGCNAQPNQGIKAPKLTANKGLVAVEVNGLPNQRYQVEFFSNQNAASKEAEQYLGAITVATDAQGIAKANWKPSVKVASITANITDRFGATSELSSALQTK。
a second object of the present invention is to provide a nucleic acid encoding the above 3-dehydroshikimate dehydratase mutant.
Further, the nucleotide sequence is shown as SEQ ID NO. 1.
It is a third object of the present invention to provide a vector carrying the above nucleic acid.
A fourth object of the present invention is to provide cells expressing the above 3-dehydroshikimate dehydratase mutants.
Further, the cell is a bacterial, fungal, plant cell or animal cell.
A fifth object of the invention is to provide the use of the above-mentioned 3-dehydroshikimate dehydratase mutants, nucleic acids, vectors, cells for the preparation of a protocatechuic acid containing product.
The sixth object of the present invention is to provide a recombinant escherichia coli producing protocatechuic acid, which is obtained by modifying escherichia coli as a host, wherein the modifying comprises: over-expressing a gene encoding the above 3-dehydroshikimate dehydratase mutant.
Further, a strong promoter P is used J23119 Controlling the expression of the 3-dehydroshikimate dehydratase gene.
Further, ligating a pro-lytic tag that includes, but is not limited to, SUMO (SEQ ID NO. 2), in one embodiment of the invention by a ligating peptide (GGGGS), enhances soluble expression of 3-dehydroshikimate dehydratase 3 SUMO and ApAroz R363A And (5) connection.
Further, the retrofitting also includes any of the following: knocking out shikimate kinase I encoding gene aroK, shikimate kinase II encoding gene aroL, phosphotransporter encoding gene ptsH, phosphoenolpyruvate phosphotransferase encoding gene ptsI, PEP-dependent dihydroxyacetone kinase encoding gene dhaL and shikimate dehydrogenase encoding gene aroE; using growth-coupled promoter P rrnC Dynamically regulating and controlling a pyruvic acid kinase I coding gene pykF; and overexpress the gene aroG encoding the anti-feedback inhibition DAHP synthase FBR 3-take-offThe coding genes aroD, the transaldolase coding gene talB, the transketolase coding gene tktA, the serine hydroxymethyltransferase coding gene glyA, the Pseudomonas mobaraensis glucose-promoting protein coding gene Zmglf, the glucokinase coding gene Zmglk and the shikimate tolerance gene proV of the hydroquinic acid dehydratase.
Further, the aroG is overexpressed FBR And aroD Gene by using a strong promoter P J23119 Separately controlling aroG FBR Expression of aroD Gene, overexpression of the talB Gene was achieved by the use of the strong promoter P J23101 Controlling the expression of talB and over-expressing the tktA gene by using a strong promoter P J23108 Controlling tktA expression, over-expressing glyA gene by using strong promoter P tac Controlling glyA expression, over-expressing the proV gene by using the pressure responsive promoter P rpoS Regulating and controlling expression of shikimic acid tolerance gene proV.
Further, NCBI coding for shikimate kinase I gene aroK is YP_026215.2, NCBI coding for shikimate kinase II gene aroL is NP_414922.1, NCBI coding for phosphotransporter gene ptsH is NP_416910.1, NCBI coding for phosphoenolpyruvate phosphotransferase gene ptsI is NP_416911.1, NCBI coding for PEP-dependent dihydroxyacetone kinase gene dhaL is NP_415717.1, and NCBI coding for shikimate dehydrogenase gene aroE is NP_417740.1.
Further, the method comprises the steps of, NCBI number NP_416191.1 for the pyruvic acid kinase I encoding gene pykF, NCBI number NP_416208.1 for the 3-dehydroquinic acid dehydratase encoding gene aroD, NCBI number NP_414549.1 for the transaldolase encoding gene talB, NCBI number YP_026188.1 for the transketolase encoding gene tkTA, NCBI number NP_417046.1 for the serine hydroxymethyltransferase encoding gene glyA, NCBI number NP_417163.1 for the shikimate tolerance gene proV; DAHP synthetase encoding gene aroG FBR The nucleotide sequence of the gene Zmglf is shown as SEQ ID NO.4, the nucleotide sequence of the gene Zmglf is shown as SEQ ID NO.5, and the nucleotide sequence of the gene Zmglk is shown as SEQ ID NO. 6.
Further, growth-coupled promoter P rrnC The nucleotide sequence of (B) is shown as SEQ ID NO.7, and the strong promoter P J23119 The nucleotide sequence of (C) is shown as SEQ ID NO.8, and the strong promoter P J23101 The nucleotide sequence of (B) is shown as SEQ ID NO.9, and the strong promoter P J23108 The nucleotide sequence of (B) is shown as SEQ ID NO.10, and the pressure response promoter P rpoS The nucleotide sequence of (2) is shown as SEQ ID NO. 11.
A seventh object of the present invention is to provide the use of the recombinant E.coli described above for the preparation of a protocatechuic acid-containing product.
Further, the application is that the recombinant escherichia coli is adopted to ferment in a fermentation medium to obtain fermentation liquor containing protocatechuic acid.
Further, in the fermentation process, when the glucose in the initial culture medium is exhausted, 500-800 g/L glucose is fed in, and the glucose concentration is controlled below 5 g/L.
Further, in the fermentation process, the pH is controlled to be 6.5-7.1, the fermentation temperature is controlled to be 36-38 ℃, and the dissolved oxygen is controlled to be 10% -30%.
Further, the formula of the fermentation medium is as follows: 18-22 g/L of glucose, 8-12 g/L of yeast powder, 4-6 g/L of peptone, 1.3-1.7 g/L of ferric citrate amine, 4-6 g/L of dipotassium hydrogen phosphate, 0.8-1.2 g/L of magnesium sulfate heptahydrate, 0.08-0.12 g/L of tryptophan, 0.08-0.12 g/L of tyrosine, 0.08-0.12 g/L of phenylalanine and 0.8-1.2 mL/L of metal ion solution.
The invention has the beneficial effects that:
the invention discovers a mutant which can effectively relieve the product inhibition of protocatechuic acid on ApAroz by carrying out mutation site screening on 3-dehydroshikimate dehydratase, and constructs Escherichia coli FMME-PCA01 of high-yield protocatechuic acid based on the mutant, wherein the 3-dehydroshikimate dehydrogenase gene aroE in escherichia coli is knocked out, and the high-activity 3-dehydroshikimate dehydratase mutant ApAroz with resistance to product inhibition is overexpressed R363A . The recombinant escherichia coli has better genetic stability, can be continuously passed for 12 generations, and can also stably produce about 37.02g/L protocatechuic acid, and the invention is used for fermentation productionThe protocatechuic acid has simple and easy process operation and low cost of culture medium, and is suitable for industrial production.
Drawings
FIG. 1 is a MD simulation graph of a complex of ApAroz-PCA.
FIG. 2 is a MD simulation of alanine mutations at various residues.
FIG. 3 is a diagram showing the production of protocatechuic acid by modifying E.coli based on the target point.
FIG. 4 is a mutant ApAroz overexpressing 3-dehydroshikimate dehydratase R363A Gene plasmid pEM-SUMO-ApAroz R363A A schematic structural diagram.
FIG. 5 is a fermenter fed-batch fermentation result for the construction of engineering strain E.coli FMME-PCA 01.
Detailed Description
The present invention will be further described with reference to the accompanying drawings and specific examples, which are not intended to be limiting, so that those skilled in the art will better understand the invention and practice it.
Sequence information related to the present invention:
SEQ ID NO.1 is 3-dehydroshikimate dehydratase mutant ApAroz R363A Nucleotide sequence of the gene; SEQ ID NO.2 is the nucleotide sequence of the dissolution promoting tag SUMO; SEQ ID NO.3 ApAroz R363A Is a sequence of amino acids of (a).
The invention relates to materials and methods:
(1) 1mL/L of metal ion liquid
Each 1L of culture medium contains 1mL of microelement liquid; microelement liquid: feCl 2 ·6H 2 O 2.4g/L、CoCl 2 ·6H 2 O 0.3g/L、CuCl 2 0.15g/L、ZnCl 2 ·4H 2 O 0.3g/L、NaMnO 4 0.3g/L、H 3 BO 3 0.075g/L、MnCl 2 ·4H 2 O0.495 g/L, dissolved in 0.1M HCl.
(2) Determination of glucose:
pretreatment of fermentation liquor: taking fermentation liquor 12000r/min, centrifuging for 5min, and taking supernatant. Diluting to a proper multiple, and detecting the glucose concentration of the fermentation broth by using an M-100 biosensing analyzer.
(3) Measurement of protocatechuic acid:
high performance liquid chromatography: preparing 1g/L concentration protocatechuic acid solution, diluting to 0.1, 0.2, 0.3, 0.4 and 0.5g/L, detecting by using a High Performance Liquid Chromatograph (HPLC) to obtain peak time and peak areas corresponding to different concentrations of protocatechuic acid, drawing a standard curve by taking the concentration of the protocatechuic acid solution as an abscissa and the peak areas as an ordinate, and obtaining a linear regression equation. The regression coefficient of the linear regression equation should be above 0.990. The instrument is a waters high performance liquid chromatograph, and the chromatographic column adopts a ZORBAX SB-C18 liquid chromatographic column; the mobile phase is 20% methanol+0.07% perchloric acid; the flow rate was set at 1mL/min; the detector is an ultraviolet detector, the detection wavelength is 278nm, and the column temperature is 40 ℃.
Pretreatment of fermentation liquor: taking fermentation liquor 12000r/min, centrifuging for 10min, and taking supernatant. After dilution by a proper multiple, the sample is subjected to membrane treatment, HPLC is used for detection, the obtained peak area is substituted into a linear regression equation, and the obtained result is multiplied by the dilution multiple to obtain the protocatechuic acid concentration in the fermentation broth.
(4) Enzyme activity determination:
activity of AroZ and its mutants were tested using pure enzyme: 200. Mu.L of the reaction system contained 0.1. Mu.M enzyme, 20mM DHS, 75mM HEPES buffer (pH 7.5). The reaction was quenched with 20% methanol containing 0.07% perchloric acid. After 1min of reaction at 37 ℃, the initial conversion rate of PCA was determined by HPLC to calculate the enzyme activity. The activity of 1 unit is defined as the amount of enzyme required to convert to 1. Mu.M PCA per minute. 200. Mu.L reactions were characterized by kinetic parameters using 75mM Hepes (pH 7.5), 0.1. Mu.M enzyme and different concentrations of 3-DHS (0-40 mM). All experiments were performed in 3 replicates.
Example 1: screening of mutation sites
By MD simulation of the complex of ApAroz-PCA, it was found that the conformation of a small peptide chain (amino acid residues 360 to 370) in the loop L5 of the longest ApAroz was significantly changed, resulting in a closed conformation that almost completely blocked the catalytic pocket (FIG. 1). Since there is no significant change in the conformation of the region where L2 interacts with L5 in MD simulation, we next primarily modulate the conformational dynamics of L5 to increase the open flexibility of L5. Based on analysis of the structure of L5, candidate mutant residues selected include S362, R363, V367, I368, V369, D370 in the region of conformational change, and the surrounding bulky amino acids L354, E355, K373, and Q374 that may affect conformational change. To confirm critical residues around the L5 region that increase conformational dynamics, we performed MD simulations for wild-type and alanine substitutions for each candidate residue based on closed conformational structure and evaluated changes in Root Mean Square (RMSF) dynamics of the C atom. The results showed that a significant change in RMSF in the L5 region was observed from the R363A mutant (fig. 2). Therefore, we selected R363A as the best mutant, hopefully impairing product inhibition by conformational changes of L5 by increasing the kinetics of L5.
Example 2: enzyme activity and kinetic parameter determination
To assess the effect of mutations on product inhibition, we constructed the R363A mutant. The results showed that the kinetic and inhibition constants of mutant R363A (K p Value) compared to wild type (0.75 mM), K of mutant R363A p At 1.21mM, 61.33% higher, k cat The value is increased by 2.07 times, k cat /K m The constant value is increased by 19.78%. This suggests that mutant R363A resulted in a significant decrease in product inhibition and an increase in DHS conversion efficiency.
The kinetic parameters described above are shown in table 1 below.
TABLE 1
AroZ | K cat (s -1 ) | K m (mΜ) | K cat /K m (mΜ -1 S -1 ) | K p (mΜ) |
wt | 185.4±4.9 | 1.0±0.1 | 191.1±5.0 | 0.75 |
R363A | 384.6±25.6 | 1.7±0.4 | 228.9±15.3 | 1.21 |
Example 3: construction of Chassis strains
Coli W3110 was selected as the host for transformation. Knocking out coding genes aroK and aroL of shikimate kinase I and shikimate kinase II, and constructing a recombinant escherichia coli SA01 strain. On the basis, in order to increase the content of the precursor PEP, glucose uptake reduction is avoided by knocking out genes dhaL, ptsH and ptsI and simultaneously introducing glucose promoting protein genes Zmglf and glucokinase Zmglk; replacement of the pykF native promoter with the growth-coupled promoter P rrnC Recombinant E.coli SA02 was obtained. To increase the precursor E4P, a strong promoter P was introduced into the genome J23101 Controlled talB and midpromoter P J23108 Controlled tktA, recombinant e.coli SA03 was obtained. Use of the strong promoter P J23119 Separately controlling aroG FBR aroD gene expression to enhance protocatechuic acid core pathway gene expression, recombinant E.coli SA04 was obtained. Using P tac The promoter controls the expression of glyA, and some basic resources are synthesized to obtain recombinant escherichia coli SA05. To enhance the tolerance of recombinant E.coli SA05, proV was controlled to P rpoS Control of the promoterProduction delays caused by metabolic burden are successfully avoided. This was designated as E.coli (Escherichia coli) FMME-SA07.
The promoter sequences mentioned above are shown in Table 2 below.
TABLE 2
Example 4: construction of protocatechuic acid producing Strain
The E.coli SA07 was used as chassis cell to obtain the mutant strain DHS01 by knocking out aroE gene on the genome of E.coli SA07 strain to block carbon flow from 3-dehydroshikimic acid to downstream shikimic acid. ApAroz is then applied R363A Introducing into strain DHS01 to obtain strain PCA01, fermenting strain PCA01 in a 5L fermenter, wherein the yield, the yield and the production strength of protocatechuic acid reach 37.02g/L, 0.24g/g and 1.32g/L/h respectively in 28 h.
Example 5: fed-batch fermentation of recombinant E.coli (Escherichia coli) FMME-PCA01
(1) Seed activation and culture
Solid medium configuration: 10g/L of peptone, 5g/L of yeast powder, 10g/L of sodium chloride and 20g/L of agar powder;
primary seed medium configuration: disodium hydrogen phosphate 6.78g/L, potassium dihydrogen phosphate 3g/L, sodium chloride 0.5g/L, ammonium chloride 1g/L, magnesium sulfate heptahydrate 0.5g/L, calcium chloride 0.011g/L, glucose 4g/L, tryptophan 10mg/L, tyrosine 10mg/L, phenylalanine 10mg/L;
slope activation: inoculating a loop of strain to a slant culture medium from a preservation tube, and culturing for 12 hours at a constant temperature of 36 ℃;
seed culture: picking single colony from the plate, inoculating to 500mL triangular flask containing 50mL culture medium, reciprocating shaking table 200rpm/min, culturing at 37deg.C for about 12 hrAfter 10 times dilution of the seed solution, OD 660 The value is between 0.6 and 0.8.
(2) Fermentation culture
Fermenting and culturing the recombinant strain in a 5L fermentation tank under the following specific fermentation conditions:
fermentation medium: 20g/L of glucose, 10g/L of yeast powder, 5g/L of peptone, 1.5g/L of ferric citrate, 5g/L of dipotassium hydrogen phosphate, 1g/L of magnesium sulfate heptahydrate, 0.1g/L of tryptophan, 0.1g/L of tyrosine, 0.1g/L of phenylalanine and 1mL/L of metal ion liquid.
Sterilizing at 121deg.C for 15min. After sterilization, the mixture is arranged on a control console, the temperature is automatically controlled, ammonia water is added to adjust the pH value to 6.6 after the temperature is cooled to 37 ℃, and inoculation is prepared.
Inoculation amount: inoculating the prepared seed liquid into a fermentation tank at an inoculation amount of 10%;
fermentation temperature: in the fermentation process, the starting temperature is automatically controlled, and the fermentation temperature is maintained at 37 ℃;
fermentation pH: ammonia water is used for regulating the pH value to be between 6.6 and 6.7;
dissolved oxygen condition: initial conditions: aeration rate 2vvm, rotational speed 300rpm;
in the fermentation process, dissolved oxygen in the fermentation process is maintained between 10 and 30 percent by adjusting ventilation and rotating speed of a stirring paddle.
In the fermentation process, after the initial glucose in the fermentation culture medium is completely exhausted, 800g/L of glucose solution is fed in a pulse mode, and the glucose concentration is controlled below 5 g/L.
The production indexes of the recombinant escherichia coli PCA01 for fermentation production of protocatechuic acid are shown in the following table.
TABLE 2
Production index | Mutant strains | Wild strain |
Yield of products | ≥37g/L | ≥28g/L |
Yield rate | 0.22-0.24g/gglucose | 0.19-0.21g/gglucose |
Production strength | ≥1.30-1.35g/L/h | ≥1.00-1.05g/L/h |
It is apparent that the above examples are given by way of illustration only and are not limiting of the embodiments. Other variations and modifications of the present invention will be apparent to those of ordinary skill in the art in light of the foregoing description. It is not necessary here nor is it exhaustive of all embodiments. And obvious variations or modifications thereof are contemplated as falling within the scope of the present invention.
Claims (10)
1. The 3-dehydroshikimate dehydratase mutant is characterized in that the amino acid sequence of the 3-dehydroshikimate dehydratase mutant is shown as SEQ ID NO. 3.
2. A nucleic acid encoding the 3-dehydroshikimate dehydratase mutant of claim 1.
3. A vector carrying the nucleic acid of claim 2.
4. A cell expressing the 3-dehydroshikimate dehydratase mutant of claim 1.
5. Use of the 3-dehydroshikimate dehydratase mutant of claim 1, the nucleic acid of claim 2, the vector of claim 3 or the cell of claim 4 for the preparation of protocatechuic acid.
6. A recombinant escherichia coli producing protocatechuic acid, characterized in that the recombinant escherichia coli producing protocatechuic acid is obtained by taking escherichia coli as a host, and the transformation comprises: overexpression of the gene encoding the 3-dehydroshikimate dehydratase mutant according to claim 1.
7. The recombinant E.coli according to claim 6, wherein the attachment of the pro-lytic tag enhances the soluble expression of 3-dehydroshikimate dehydratase.
8. The recombinant escherichia coli of claim 6, wherein the engineering further comprises any one of: knocking out shikimate kinase I encoding gene aroK, shikimate kinase II encoding gene aroL, phosphotransporter encoding gene ptsH, phosphoenolpyruvate phosphotransferase encoding gene ptsI, PEP-dependent dihydroxyacetone kinase encoding gene dhaL and shikimate dehydrogenase encoding gene aroE; using growth-coupled promoter P rrnC Dynamically regulating and controlling a pyruvic acid kinase I coding gene pykF; overexpression feedback inhibition resistant DAHP synthetase coding gene aroG FBR The coding genes aroD, talB, tktA, glyA, zmglf, zmglk and proV of glucose-promoting protein, respectively.
9. The recombinant escherichia coli of claim 8, wherein aroG is overexpressed FBR And aroD Gene by using a strong promoter P J23119 Separately controlling aroG FBR Expression of aroD Gene, overexpression of the talB Gene was achieved by the use of the strong promoter P J23101 Controlling the expression of talB and over-expressing the tktA gene by using a strong promoter P J23108 Controlling tktA expression, over-expressing glyA gene by using strong promoter P tac Controlling glyA expression, over-expressing the proV gene by using the pressure responsive promoter P rpoS Regulating and controlling expression of shikimic acid tolerance gene proV.
10. Use of a recombinant escherichia coli according to any one of claims 6-9 for the preparation of a protocatechuic acid containing product.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202311752427.2A CN117683759A (en) | 2023-12-19 | 2023-12-19 | 3-dehydroshikimate dehydratase mutant and recombinant escherichia coli for producing protocatechuic acid |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202311752427.2A CN117683759A (en) | 2023-12-19 | 2023-12-19 | 3-dehydroshikimate dehydratase mutant and recombinant escherichia coli for producing protocatechuic acid |
Publications (1)
Publication Number | Publication Date |
---|---|
CN117683759A true CN117683759A (en) | 2024-03-12 |
Family
ID=90135087
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202311752427.2A Pending CN117683759A (en) | 2023-12-19 | 2023-12-19 | 3-dehydroshikimate dehydratase mutant and recombinant escherichia coli for producing protocatechuic acid |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN117683759A (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2017169399A1 (en) * | 2016-03-28 | 2017-10-05 | 公益財団法人地球環境産業技術研究機構 | Transformant, and method for producing protocatechuic acid or salt thereof using same |
CN113717994A (en) * | 2021-09-27 | 2021-11-30 | 中国科学院天津工业生物技术研究所 | Method for producing protocatechuic acid |
-
2023
- 2023-12-19 CN CN202311752427.2A patent/CN117683759A/en active Pending
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2017169399A1 (en) * | 2016-03-28 | 2017-10-05 | 公益財団法人地球環境産業技術研究機構 | Transformant, and method for producing protocatechuic acid or salt thereof using same |
CN113717994A (en) * | 2021-09-27 | 2021-11-30 | 中国科学院天津工业生物技术研究所 | Method for producing protocatechuic acid |
Non-Patent Citations (2)
Title |
---|
MING WANG等: "Efficient production of protocatechuic acid using systems engineering of Escherichia coli", METABOLIC ENGINEERING, vol. 82, 16 February 2024 (2024-02-16), pages 134 - 146 * |
韩超等: "大肠杆菌生产莽草酸的基因工程菌构建", 发酵科技通讯, vol. 46, no. 03, 31 August 2017 (2017-08-31), pages 143 - 146 * |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2009234625B2 (en) | Mutant microorganisms having high ability to produce putrescine and method for producing putrescine using the same | |
KR101764933B1 (en) | Method for producting high amount of glycolic acid by fermentation | |
CN102317436A (en) | Be used to increase mikrobe to the tolerance of 3-hydroxy-propionic acid (3-HP) and method, system and the compsn that increases 3-hydroxy-propionic acid output | |
EP2391708B1 (en) | A method for producing succinic acid using a yeast belonging to the genus yarrowia | |
CN112204146A (en) | Acid-tolerant yeast having inhibited ethanol production pathway and method for producing lactic acid using the same | |
CN105051181B (en) | The preparation method of the increased recombinant microorganism of the generative capacity of 2,3-butanediol and the 2,3-butanediol using it | |
CN117384817B (en) | Parcoumaric acid production strain, construction method and application thereof | |
KR20000052825A (en) | Microbial preparation of substances from aromatic metabolism/i | |
Zhang et al. | Strengthening the (R)-pantoate pathway to produce D-pantothenic acid based on systematic metabolic analysis | |
CN109929786B (en) | Escherichia coli for producing tyrosine by fermentation method and construction method and application thereof | |
CN114085801B (en) | Recombinant escherichia coli for producing L-tryptophan and application thereof | |
CN117683759A (en) | 3-dehydroshikimate dehydratase mutant and recombinant escherichia coli for producing protocatechuic acid | |
CN116948932A (en) | Construction and application of caffeic acid strain synthesized from head by taking glucose as substrate | |
CN114941001A (en) | Construction method and application of metabolic engineering strain for producing sakuranetin by saccharomyces cerevisiae | |
KR20150051081A (en) | Acid resistant increased Kluyveromyces marxianus expressing reprogrammed gene by engineering transcriptional factor | |
JP2005102625A (en) | Method for producing d-lactic acid | |
JP2011205979A (en) | Method for producing recombinant protein | |
CN116426455B (en) | Recombinant escherichia coli, construction method thereof and application thereof in production of 3-dehydroshikimic acid | |
CN117844728B (en) | L-valine production strain and construction method and application thereof | |
CN112322601B (en) | Mutant of phosphoenolpyruvate synthetase and application thereof in producing tryptophan | |
CN115820518A (en) | Recombinant escherichia coli for efficiently producing shikimic acid and application thereof | |
CN116606828A (en) | Shikimate dehydrogenase mutant, gene, expression vector, recombinant bacterium and application | |
CN115838683A (en) | Genetically engineered bacterium for producing L-serine and construction method and application thereof | |
CN118291350A (en) | Gallic acid producing strain and application thereof | |
CN117384814A (en) | Plasmid-free genetically engineered bacterium for high yield of D-pantothenic acid, construction method and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination |