CN117659200A - Pfu DNA polymerase antibody combination and application thereof - Google Patents
Pfu DNA polymerase antibody combination and application thereof Download PDFInfo
- Publication number
- CN117659200A CN117659200A CN202311648966.1A CN202311648966A CN117659200A CN 117659200 A CN117659200 A CN 117659200A CN 202311648966 A CN202311648966 A CN 202311648966A CN 117659200 A CN117659200 A CN 117659200A
- Authority
- CN
- China
- Prior art keywords
- seq
- dna polymerase
- sequence
- pfu dna
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 108010002747 Pfu DNA polymerase Proteins 0.000 title claims abstract description 74
- 101100112922 Candida albicans CDR3 gene Proteins 0.000 claims description 12
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 claims description 12
- 102100035361 Cerebellar degeneration-related protein 2 Human genes 0.000 claims description 12
- 101000737793 Homo sapiens Cerebellar degeneration-related antigen 1 Proteins 0.000 claims description 12
- 101000737796 Homo sapiens Cerebellar degeneration-related protein 2 Proteins 0.000 claims description 12
- 230000003321 amplification Effects 0.000 claims description 10
- 238000003199 nucleic acid amplification method Methods 0.000 claims description 10
- 230000000694 effects Effects 0.000 abstract description 22
- 230000000903 blocking effect Effects 0.000 abstract description 14
- 238000012257 pre-denaturation Methods 0.000 abstract description 2
- 102000016911 Deoxyribonucleases Human genes 0.000 abstract 1
- 108010053770 Deoxyribonucleases Proteins 0.000 abstract 1
- 102000004190 Enzymes Human genes 0.000 description 39
- 108090000790 Enzymes Proteins 0.000 description 39
- 210000004027 cell Anatomy 0.000 description 16
- 238000003752 polymerase chain reaction Methods 0.000 description 12
- 241000699666 Mus <mouse, genus> Species 0.000 description 9
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 9
- 241000699670 Mus sp. Species 0.000 description 8
- 238000002156 mixing Methods 0.000 description 8
- 210000004408 hybridoma Anatomy 0.000 description 7
- 230000003053 immunization Effects 0.000 description 7
- 238000002649 immunization Methods 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 6
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 238000000034 method Methods 0.000 description 6
- 108090000623 proteins and genes Proteins 0.000 description 6
- 239000002671 adjuvant Substances 0.000 description 5
- 239000000203 mixture Substances 0.000 description 5
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 4
- 206010003445 Ascites Diseases 0.000 description 4
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 4
- 238000012258 culturing Methods 0.000 description 4
- 238000001962 electrophoresis Methods 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 238000003753 real-time PCR Methods 0.000 description 4
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 239000006285 cell suspension Substances 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 239000012091 fetal bovine serum Substances 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 239000012577 media supplement Substances 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000012536 storage buffer Substances 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 241000283707 Capra Species 0.000 description 2
- 108060002716 Exonuclease Proteins 0.000 description 2
- 241000205156 Pyrococcus furiosus Species 0.000 description 2
- 125000003275 alpha amino acid group Chemical group 0.000 description 2
- 238000000137 annealing Methods 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 102000013165 exonuclease Human genes 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- 102000004169 proteins and genes Human genes 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 210000004989 spleen cell Anatomy 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 230000002195 synergetic effect Effects 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- NOIIUHRQUVNIDD-UHFFFAOYSA-N 3-[[oxo(pyridin-4-yl)methyl]hydrazo]-N-(phenylmethyl)propanamide Chemical compound C=1C=CC=CC=1CNC(=O)CCNNC(=O)C1=CC=NC=C1 NOIIUHRQUVNIDD-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 230000004543 DNA replication Effects 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- 206010064571 Gene mutation Diseases 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 102000002067 Protein Subunits Human genes 0.000 description 1
- 108010001267 Protein Subunits Proteins 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 108010006785 Taq Polymerase Proteins 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 210000000683 abdominal cavity Anatomy 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 238000011091 antibody purification Methods 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 238000007664 blowing Methods 0.000 description 1
- 210000005252 bulbus oculi Anatomy 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 238000010370 cell cloning Methods 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000012295 chemical reaction liquid Substances 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 238000007849 hot-start PCR Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 229940057995 liquid paraffin Drugs 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 238000007500 overflow downdraw method Methods 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 239000003761 preservation solution Substances 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 239000012562 protein A resin Substances 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000007789 sealing Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
Landscapes
- Enzymes And Modification Thereof (AREA)
Abstract
The invention provides a Pfu DNA polymerase antibody combination, which comprises a Pfu DNA polymerase monoclonal antibody R9C8 and a Pfu DNA polymerase monoclonal antibody F10G6; the sequence of the heavy chain variable region of the monoclonal antibody R9C8 is shown as SEQ ID NO. 1, and the sequence of the light chain variable region of the monoclonal antibody R9C8 is shown as SEQ ID NO. 2; the heavy chain variable region sequence of the monoclonal antibody F10G6 is shown as SEQ ID NO. 3, and the light chain variable region sequence is shown as SEQ ID NO. 4. This combination has a preferred 5'-3' end polymerase activity of blocking Pfu DNase over a broad temperature range (0-70 ℃) prior to the pre-denaturation stage.
Description
Technical Field
The invention relates to a Pfu DNA polymerase antibody combination and application thereof, belonging to the technical field of Pfu DNA polymerase.
Background
Polymerase Chain Reaction (PCR) is a molecular biological technique used to amplify specific DNA fragments. The method has the characteristics of strong specificity, high sensitivity, rapidness, simplicity, convenience, good repeatability and the like, and is one of the most basic and important tools for molecular biology research. The principle is that under the catalysis of DNA polymerase, DNA molecules are amplified in vitro by taking a parent strand DNA as a template and taking a primer as an origin through the steps of denaturation, annealing, extension and other circulation, so that the DNA replication is realized.
Pfu DNA polymerase (Pfu enzyme) is a DNA polymerase isolated from Pyrococcus furiosus (Pyrococcus furiosus, pfu) by scientists, contains 2 protein subunits (P45 and P50), is a polymer, has a molecular weight of 90kda, and has excellent heat stability. Unlike TaqDNA polymerase, the enzyme has both 5'-3' polymerase activity and 3'-5' exonuclease activity, and the main function of 3'-5' exonuclease activity is correction, and mismatched nucleotides can be recognized and excised instantaneously, which gives Pfu enzyme extremely high fidelity. Pfu enzyme is one of the most widely used DNA polymerases due to high fidelity and high stability.
During PCR, pfu enzyme, like other DNA polymerases, generally has some polymerase activity under low temperature conditions, resulting in non-specific amplification and formation of primer dimers. At present, the purpose of hot start can be achieved through a plurality of ways, such as gene mutation, physical isolation, chemical modification, nucleic acid primer modification and the like, of enzymes. However, these methods have disadvantages such as incomplete blocking of the enzyme activity, influence on the complexity of PCR, influence on the enzyme continuity, fidelity, and complexity of the method.
In view of the above-described drawbacks of the related art, modification of Pfu enzyme with a monoclonal antibody is a relatively better method. Pfu enzyme antibodies are hot-start PCR antibodies against Pfu enzyme that inhibit DNA polymerase activity upon binding to Pfu enzyme. During PCR amplification, pfu enzyme antibody and Pfu enzyme are combined to inhibit DNA polymerase activity before high temperature denaturation, so that non-specific annealing of the primer and non-specific amplification caused by primer dimer can be effectively inhibited under low temperature condition, and the specificity of amplification and target DNA yield are improved. However, in the conventional PCR, only one Pfu DNA polymerase antibody is usually used, and if the temperature is 70℃or higher, the blocking efficiency of Pfu DNA polymerase by Pfu DNA polymerase antibody is greatly lowered, resulting in some nonspecific amplification.
Disclosure of Invention
The invention provides Pfu DNA polymerase antibody combination and application thereof, which can effectively solve the problems.
The invention is realized in the following way:
a Pfu DNA polymerase antibody combination comprising Pfu DNA polymerase monoclonal antibody R9C8 and Pfu DNA polymerase monoclonal antibody F10G6; the sequence of the heavy chain variable region of the monoclonal antibody R9C8 is shown as SEQ ID NO. 7, and the sequence of the light chain variable region of the monoclonal antibody R9C8 is shown as SEQ ID NO. 8; the sequence of the heavy chain variable region of the monoclonal antibody F10G6 is shown as SEQ ID NO. 17, and the sequence of the light chain variable region is shown as SEQ ID NO. 18.
In some embodiments, the heavy chain variable region sequence of monoclonal antibody R9C8 has a CDR1 sequence as shown in SEQ ID NO. 1, a CDR2 sequence as shown in SEQ ID NO. 2, a CDR3 sequence as shown in SEQ ID NO. 3,
in some embodiments, the light chain variable region sequence of monoclonal antibody R9C8 has a CDR1 sequence as shown in SEQ ID NO. 4, a CDR2 sequence as shown in SEQ ID NO. 5, and a CDR3 sequence as shown in SEQ ID NO. 6.
In some embodiments, the heavy chain variable region sequence of monoclonal antibody F10G6 has a CDR1 sequence as shown in SEQ ID NO. 11, a CDR2 sequence as shown in SEQ ID NO. 12, and a CDR3 sequence as shown in SEQ ID NO. 13.
In some embodiments, the light chain variable region sequence of monoclonal antibody F10G6 has a CDR1 sequence as shown in SEQ ID NO. 14, a CDR2 sequence as shown in SEQ ID NO. 15, and a CDR3 sequence as shown in SEQ ID NO. 16.
In some embodiments, the heavy chain sequence of the monoclonal antibody R9C8 is shown in SEQ ID NO. 9 and the light chain sequence is shown in SEQ ID NO. 10.
In some embodiments, the monoclonal antibody F10G6 has a heavy chain sequence as shown in SEQ ID NO. 19 and a light chain sequence as shown in SEQ ID NO. 20.
In some embodiments, the mass ratio of Pfu DNA polymerase monoclonal antibody R9C8 to Pfu DNA polymerase monoclonal antibody F10G6 is 0.5-1.5:1.
use of a Pfu DNA polymerase antibody combination as described above for reducing non-specific amplification of Pfu DNA polymerase.
In some embodiments, the mass ratio of Pfu DNA polymerase antibody combination to Pfu DNA polymerase is 1.5-2.5:1.
the beneficial effects of the invention are as follows:
the invention provides a Pfu DNA enzyme monoclonal antibody combination, which comprises an R9C8 antibody and an F10G6 antibody, wherein the R9C8 antibody and the F10G6 antibody play a synergistic effect, the combination has better 5'-3' end polymerase activity of blocking Pfu DNA enzyme in a wide temperature range (0-70 ℃) before a pre-denaturation stage, the blocking efficiency of blocking Pfu DNA polymerase 5'-3' polymerase activity at 70 ℃ is more than 97%, and the antibody combination greatly reduces non-specific amplification in PCR.
Drawings
In order to more clearly illustrate the technical solutions of the embodiments of the present invention, the drawings that are needed in the embodiments will be briefly described below, it being understood that the following drawings only illustrate some examples of the present invention and therefore should not be considered as limiting the scope, and other related drawings may be obtained according to these drawings without inventive effort for a person skilled in the art.
FIG. 1 is a graph of the blocking efficiency of polymerase activity of Pfu enzyme antibody combinations.
FIG. 2 is a graph showing the blocking efficiency of polymerase activity of Pfu enzyme R9C8 antibody.
FIG. 3 is a graph showing the blocking efficiency of polymerase activity of Pfu enzyme F10G6 antibody.
FIG. 4 is a nucleic acid electrophoresis chart of PCR results of antibody group enzyme, single antibody enzyme (R9C 8 antibody enzyme and F10G6 antibody enzyme) and PfuDNA polymerase.
Detailed Description
For the purpose of making the objects, technical solutions and advantages of the embodiments of the present invention more apparent, the technical solutions of the embodiments of the present invention will be clearly and completely described below with reference to the accompanying drawings in the embodiments of the present invention, and it is apparent that the described embodiments are some embodiments of the present invention, but not all embodiments. All other embodiments, based on the embodiments of the invention, which are apparent to those of ordinary skill in the art without inventive faculty, are intended to be within the scope of the invention. Thus, the following detailed description of the embodiments of the invention, as presented in the figures, is not intended to limit the scope of the invention, as claimed, but is merely representative of selected embodiments of the invention. All other embodiments, based on the embodiments of the invention, which are apparent to those of ordinary skill in the art without inventive faculty, are intended to be within the scope of the invention.
In the description of the present invention, the terms "first," "second," and the like are used for descriptive purposes only and are not to be construed as indicating or implying relative importance or implicitly indicating the number of technical features indicated. Thus, a feature defining "a first" or "a second" may explicitly or implicitly include one or more such feature. In the description of the present invention, the meaning of "a plurality" is two or more, unless explicitly defined otherwise.
Example 1
Pfu DNA polymerase preparation
1. Acquisition, synthesis and vector construction of Pfu DNA polymerase Gene
According to the sequence of Pfu DNA polymerase (NCBI: NC_ 003413.1) searched by NCBI, nde I restriction site is introduced at the N end of the gene, and a stop codon and Xho I restriction site are introduced at the C end of the gene, so that the gene (Shanghai biological synthesis) is synthesized. The gene and pET28a vector were digested with Nde I and Xho I restriction enzymes, respectively, and then constructed into pET28a-Pfu vector using T4 DNA ligase.
2. Construction and expression of Pfu DNA polymerase recombinant bacteria
The vector with the constructed pET28a-Pfu was transformed into E.coli BL21 (DE 3) strain (purchased from Shanghai Bio) and spread on LB plates, cultured overnight, and single colonies were picked. Inoculating to 10mL LB liquid medium, adding Kan antibiotic to final concentration of 1mM, culturing at 37 deg.C at 250rpm for overnight, transferring to 200mL LB medium at 1:100 ratio the next day, adding Kan antibiotic to final concentration of 1mM, culturing at 37 deg.C at 250rpm to OD value of 0.6-0.8, adding isopropyl thiogalactoside to final concentration of 0.01mM/L-0.2mM/L, and inducing expression at 25 deg.C for 6-8h. Collecting bacterial liquid centrifugally, and centrifuging: centrifugation is carried out at 8000rmp for 10min at 4 ℃.
3. Purification of Pfu DNA polymerase
(1) The mass ratio of the bacterial cells to BufferA (Tirs-HCl 20mM, sodium chloride 500mM, imidazole, 10mM, pH adjusted to 7.4) is 1:10, mixing, carrying out ultrasonic crushing in an ice bath, wherein the crushing conditions are as follows: the power is 300W, the ultrasonic wave is 3S, the suspension is 8S, and the crushing is carried out for 15min;
(2) Centrifuging at 12000rpm for 30min at 4deg.C, collecting supernatant, filtering with 0.22 μm filter membrane, and loading onto Ni chromatographic column;
(3) Washing the hybrid protein with BufferB (Tirs-HCl 20mM, sodium chloride 500mM, imidazole 20mM, pH adjusted to 7.4);
(4) Pfu DNA polymerase was eluted with BufferC (Tirs-HCl 20mM, sodium chloride 500mM, imidazole 200mM, DTT 8mM, pH adjusted to 7.4);
(5) Purified Pfu DNA polymerase was ultrafiltered, concentrated and stored in a storage Buffer (Tris-HCl (pH 7.4)) 20mM,KCl 100mM,DTT 1mM,0.5% Tween 20,0.1mM EDTA,glycerol 50% (v/v).
Example 2
Monoclonal antibody preparation
The invention prepares 2 monoclonal antibodies of Pfu DNA polymerase, R9C8 and F10G6 respectively.
The preparation process of the antibody is as follows:
the reagents or kits related to the present application and their sources are as follows:
freund's Complete adjuvant, freund's sAdjuvant, complete (accession number 77140,Thermo Fisher); freund's Incomplete adjuvant, freund's sAdjuvant, incomplex (cat. No. 77145,Thermo Fisher); HAT MediaSupplement (50×) (cat No. 21060017,Thermo Fisher); HT MediaSup plement (50×) (accession number H0111067030, thermo Fisher); PEG (P7181, sigma); RPMI 1640 (accession number L210KJ, shanghai source Pest); fetal bovine serum FBS (C04001-500, shanghai Xiao Peng organism); DMEM (cat No. L310KJ, shanghai source culture); penicillin-St reptomycin (cat. No. 15140122, gibco); HRP-labeled goat anti-mouse antibody (cat No. D110087, shanghai creatures); protein A Resin (cat No. SA023010, changzhou Tiandi and Biotech Co., ltd.).
1. Immunization of mice:
multiple immunizations of 8-10 week old, approximately 20g heavy, healthy Balb/c female mice with Pfu DNA polymerase were performed, the first immunization being a back subcutaneous injection of 50 μg Pfu DNA polymerase mixed with Freund's complete adjuvant in equal volumes; two weeks later, carrying out secondary immunization, and injecting 50 mug Pfu DNA polymerase into the back of each mouse in a subcutaneous mode, and mixing the Pfu DNA polymerase with Freund's incomplete adjuvant in an equal volume to obtain an immunogen; three immunizations were performed after two weeks, and 50 μg Pfu DNA polymerase was injected subcutaneously into the back of each mouse and mixed with Freund's incomplete adjuvant in equal volumes to obtain an immunogen; two weeks later, the mice were boosted and each mouse was intraperitoneally injected with 50. Mu.g of Pfu DNA polymerase mixed with an equal volume of physiological saline to obtain an immunogen.
2. Cell fusion: mice began the third day after the last immunization. BALB/c mice on the third day after the last immunization were taken, the eyeballs were removed for blood collection, and the serum of the mice was isolated as a positive control for antibody detection, while the cervical dislocation was lethal to the mice, and spleen thereof was taken to prepare spleen cell suspensions. Two weeks in advance of recovery of myeloma cells (ensuring that the cells are in logarithmic growth phase when in use), myeloma cells are obtained. The day before fusion, mouse abdominal macrophages are obtained and cultured in 96-well plates to obtain a cell plate containing feeder cells. Adopting a PEG-mediated fusion method, taking spleen cell suspension and myeloma cell suspension according to the ratio of cell number of 5:1, uniformly mixing in serum-free DMEM culture medium, centrifuging at 1200rpm for 5min, removing the supernatant, flicking the bottom of a centrifuge tube with fingers, loosely mixing the two cells, placing in a beaker filled with 37 ℃ water for heat preservation, adding 1mL of 50% PEG (pH8.0) fusion cells in 1 min while shaking, standing for 30 seconds after the addition, adding serum-free DMEM culture medium for stopping fusion, centrifuging at 1000rpm for 5min, suspending the precipitate with HAT culture medium, and subpackaging into 96-well cell plates containing feeder cells, and culturing in a cell culture box with 5% CO2 at 37 ℃. Wherein, 100mL FBS,5mL Penicillin-Streptomycin (Penicilliin-Streptomycin), 10mL HAT medium additive (HAT Media Sup plement), 385mL DMEM are required for preparing 500mL HAT medium.
3. Hybridoma cell selection: the cells are cultured in a cell culture box until the 7 th day, and positive holes are screened by a conventional indirect ELISA method when the fused cells cover 10% -50% of the bottoms of the holes. And (2) detecting hybridoma cell culture supernatant by using Pfu DNA polymerase coated plates, wherein the secondary antibody is an enzyme-labeled goat anti-mouse antibody, and screening positive hybridoma cells with higher antibody titers by using the mouse serum separated in the step (2) as a positive control.
4. Hybridoma cell cloning: the day prior to cloning feeder cells were prepared and plated according to step 2; blowing and uniformly mixing positive hybridoma cells in holes to be cloned by using a pipette, and diluting the cells in the holes to 1 cell in each hole by using an HT culture medium; 37 ℃ and 5% CO 2 Wetting and culturing for 7-10 days, and detecting antibodies after macroscopic cloning appears; observing under an inverted microscope, marking out a hole in which only a single clone grows, and finally primarily screening to obtain the monoclonal antibody hybridoma cell strain.
5. Monoclonal antibody ascites was prepared: balb/c mice were intraperitoneally injected with 0.5ml liquid paraffin, and after 10 days, the selected hybridoma cell lines were inoculated with 1X 10 6 To the abdominal cavity of Balb/c mice. After about 10 days, the abdomen of the mouse begins to swell, the cervical vertebra of the mouse is removed, the mouse is killed, and the mouse is soaked in 75% alcohol and disinfected for 5 minutes, and the disposable ascites is extracted.
6. Monoclonal antibody purification: centrifuging at 3000rpm for 10min, and collecting colorless transparent intermediate layer as ascites. By saturation (NH) 4 ) 2 SO 4 Mixing with ascites according to the following formula 1:1, after thoroughly mixing, centrifuging at 10000rpm for 10min, discarding the supernatant, redissolving the precipitate with PB solution at pH 7.0 and concentration of 20mM, passing through a protein A column, eluting with Gly-HCl at pH2.7 and concentration of 100mM, and neutralizing the eluate with Tris-HCl at pH9.0 and concentration of 1M. And (3) subsequently, 4 ℃ and dialyzing for 6 hours, and changing the preservation solution into PBS (phosphate buffered saline) solution to obtain the monoclonal antibodies R9C8 and F10G6 of the purified Pfu DNA polymerase.
Specific information was sequenced as follows:
the amino acid sequence of R9C8 is as follows:
heavy chain CDR1 sequence: YCRT (SEQ ID NO: 1)
Heavy chain CDR2 sequence: QGHDNETDKPRILS (SEQ ID NO: 2)
Heavy chain CDR3 sequence: GLSNKIHDL (SEQ ID NO: 3)
Light chain CDR1 sequence: QSLANDS (SEQ ID NO: 4)
Light chain CDR2 sequence: YSTLY (SEQ ID NO: 5)
Light chain CDR3 sequence: QQWTLPT (SEQ ID NO: 6)
The heavy chain variable region sequences are: QVQLQQSGAELVKPGTSVKLSCKASGYNFI YCRTWVKLRPGQGLEWIGQGHDNETDKPRILSKATLTVDKSSSTAYMQL SGLASADSAVYYCTR GLSNKIHDLWGQGTTLTVSS (SEQ ID NO: 7) the light chain variable region sequence is:
DVVMTQSTPSLSVSLGDRVTISCQSLYANDSWYQQKPGTVPKLLIY QSLYANDSRVPSRFSASGSGTDFSLTISNLEQEDFATYFCYSTLYFGGGTK LEIK(SEQ ID NO:8)
the heavy chain sequence is:
QVQLQQSGAELVKPGTSVKLSCKASGYNFIYCRTWVKLRPGQGLEWIGQGHDNETDKPRILSKATLTVDKSSSTAYMQLSGLASADSAVYYCTRGLSNKIHDLWGQGTTLTVSSSTPPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK(SEQ ID NO:9)
light chain sequence:
DVVMTQSTPSLSVSLGDRVTISCQSLYANDSWYQQKPGTVPKLLIYQSLYANDSRVPSRFSASGSGTDFSLTISNLEQEDFATYFCYSTLYFGGGTKLEIKRTDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC(SEQ ID NO:10)
the amino acid sequence of F10G6 is as follows:
heavy chain CDR1 sequence: YTMH (SEQ ID NO: 11)
Heavy chain CDR2 sequence: WAPSINTNYEKFKD (SEQ ID NO: 12)
Heavy chain CDR3 sequence: HGRKTFDY (SEQ ID NO: 13)
Light chain CDR1 sequence: ASQTDSYL (SEQ ID NO: 14)
Light chain CDR2 sequence: YSYLE (SEQ ID NO: 15)
Light chain CDR3 sequence: QQKENPT (SEQ ID NO: 16)
The heavy chain variable region sequences are: QVQLQQSGAELVKPGASVKLSCKMSAYNFT YTMHWVKQRPGQGLEWIGWAPSINTNYEKFKDKATLSVDTSSNTAYMQ LSSLTSEDSALYYCARHGRKTFDYWGQGTTLTVSA (SEQ ID NO: 17) the light chain variable region sequence is:
DIVMTQTTASLAVSLGDRATISCASQTDSYLWYQQKPGQPPKLLIKY SYLEGVPSRFSGSGSGTDYSLTIHPVEQEDIATYYCQQKENPTFGGGTKL EIK(SEQ ID NO:18)
the heavy chain sequence is:
QVQLQQSGAELVKPGASVKLSCKMSAYNFTYTMHWVKQRPGQGLEWIGWAPSINTNYEKFKDKATLSVDTSSNTAYMQLSSLTSEDSALYYCARHGRKTFDYWGQGTTLTVSASTPPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK(SEQ ID NO:19)
the light chain sequence is:
DIVMTQTTASLAVSLGDRATISCASQTDSYLWYQQKPGQPPKLLIKYSYLEGVPSRFSGSGSGTDYSLTIHPVEQEDIATYYCQQKENPTFGGGTKLEIKRTDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC(SEQ ID NO:20)
according to the mass ratio of 1:1 mix R9C8 with F10G6.
Example 3
Preparation of abzymes and Pfu enzymes
Combining the antibodies at a concentration of 5mg/mL with Pfu DNA polymerase at a concentration of 0.5mg/mL according to 2:1, and incubating for 30min at 37 ℃ to obtain the antibody group enzyme.
Antibody R9C8 was taken at a concentration of 5mg/mL and mixed with Pfu DNA polymerase at a concentration of 0.5mg/mL according to 2:1, and incubating for 30min at 37 ℃ to obtain the R9C8 abzyme.
Antibody F10G6 was taken at a concentration of 5mg/mL and mixed with Pfu DNA polymerase at a concentration of 0.5mg/mL according to 2:1, and incubating for 30min at 37 ℃ to obtain F10G6 abzyme.
The Pfu DNA polymerase with the concentration of 0.5mg/mL is added with the antibody storage buffer solution with the same volume, and the mixture is evenly mixed, and incubated for 30min at 37 ℃ to obtain the Pfu enzyme.
Example 4
5'-3' polymerase activity closure assay
Hairpin oligonucleotide
TAGCGAAGGATGTGAACCTAATCCCTGCTCCCGCGGCCGATCTGCCG GCCGCGG (SEQ ID NO: 21), diluted to 100. Mu. Mol/L.
Preparing 10 x Pfu buffer:250mmol/L Tris-HCl,50mmol/L (NH) 4 )·SO 4 500mmol/L KCl,1% (volume ratio) Triton X-100, pH8.8 (25 ℃ C.), 25mmol/L MgCl 2 ，25mmol/L dNTP。
Formulated according to the following table 1 formulation, all operations were performed on ice with three replicates for each experiment:
TABLE 1
Temperature program is set on the fluorescent quantitative PCR instrument:
the amplification temperature was 37 ℃, 55 ℃, 60 ℃, 65 ℃, 70 ℃, 75 ℃,80 ℃; the amplification time is 16s;120 cycles; a fluorescence acquisition channel; FAM.
Preheating a fluorescent quantitative PCR instrument for half an hour according to the temperature, placing a PCR eight-joint tube added with the reaction liquid in the fluorescent quantitative PCR instrument, and starting the polymerization reaction.
After the reaction, the difference between the fluorescence value of the 120 th cycle and the initial value was calculated from the fluorescence quantitative PCR data. Detection of enzyme 5'-3' polymerase activity blocking effect = 1-difference in fluorescence before and after test abzyme/difference in fluorescence before and after Pfu enzyme.
The results are shown in figures 1-3, R9C8 antibody can block Pfu DNA polymerase 5'-3' polymerase activity at 65 ℃, and the blocking efficiency is over 95%; F10G6 antibody seals Pfu DNA polymerase 5'-3' polymerase activity at 60 ℃, and sealing efficiency is over 98%; the blocking efficiency of both the R9C8 antibody and the F10G6 antibody was reduced at 70 ℃, but the combined antibody was able to block Pfu DNA polymerase 5'-3' polymerase activity at 70 ℃ and the blocking efficiency was 97% or more, indicating that the R9C8 antibody and the F10G6 antibody exert a synergistic effect.
Example 5
PCR detection of sample amplification effect
Primer pCDNA3.1-F was synthesized and its sequence was CTAGAGAACCCACTGCTTAC (SEQ ID NO: 22), primer pCDNA3.1-R was TAGAAGGCACAGTCGAGG (SEQ ID NO: 23), and diluted to 10. Mu. Mol/L.
The sample was vector pcdna3.1 plasmid (purchased from bio-wind) added to 50-fold diluted negative serum.
Preparing 10×pfu buffer 2:200mmol/L Tris-HCl,100mmol/L (NH) 4 )·SO 4 100mmol/L KCl,1% (volume ratio) Tritonx-100,1mg/mL BSA,20mmol/L MgSO 4 ，pH8.7(25℃)。
The experiments were divided into four groups, respectively: antibody group enzyme, R9C8 antibody enzyme group, F10G6 antibody enzyme group, pfu enzyme.
Antibody group enzyme: combining the antibodies at a concentration of 5mg/mL with Pfu DNA polymerase at a concentration of 0.5mg/mL according to 2:1, and incubating for 30min at 37 ℃ to obtain the abzyme.
R9C8 abzyme group: R9C8 antibody was taken at a concentration of 5mg/mL and mixed with Pfu DNA polymerase at a concentration of 0.5mg/mL according to 2:1, and incubating for 30min at 37 ℃ to obtain the abzyme.
F10G6 abzyme group: F10G6 antibody was taken at a concentration of 5mg/mL and mixed with Pfu DNA polymerase at a concentration of 0.5mg/mL according to 2:1, and incubating for 30min at 37 ℃ to obtain the abzyme.
Pfu enzyme group: the Pfu DNA polymerase with the concentration of 0.5mg/mL is added with the antibody storage buffer solution with the same volume, and the mixture is evenly mixed and incubated for 30min at 37 ℃.
Formulated according to the following Table 2 formulation
TABLE 2
The temperature program set on the PCR instrument is shown in table 3:
TABLE 3 Table 3
1.0g of agar powder was weighed and 100mL of TAE was added to prepare 1.0% of the electrophoresis gel. And taking the PCR tube, adding 6 mu L of Loading buffer, uniformly mixing, centrifuging, taking 20 mu L of sample, and Loading the sample into the electrophoresis gel. Electrophoresis was performed at 120V for 30min, and the electrophoresis bands were observed and photographed.
As shown in FIG. 4, the antibody enzyme PCR effect of the combined antibody-blocked Pfu DNA polymerase is significantly better than that of Pfu DNA polymerase without antibody blocking and that of Pfu DNA polymerase (R9C 8 antibody enzyme or F10G6 antibody enzyme) with single antibody, and the amplified bands are brighter and the products are more.
In summary, the invention discloses that the Pfu DNA polymerase antibody combination can be used for specifically binding to Pfu DNA polymerase, and can completely block the activity of 5'-3' polymerase within 70 ℃, and the effect of the antibody group enzyme mixed by the combined antibody and Pfu DNA polymerase in amplifying a sample is obviously better than that of Pfu DNA polymerase without antibody and Pfu DNA polymerase with single antibody.
The above description is only of the preferred embodiments of the present invention and is not intended to limit the present invention, and various modifications and variations may be made to the present invention by those skilled in the art. Any modification, equivalent replacement, improvement, etc. made within the spirit and principle of the present invention should be included in the protection scope of the present invention.
Claims (10)
1. A Pfu DNA polymerase antibody combination comprising Pfu DNA polymerase monoclonal antibody R9C8 and Pfu DNA polymerase monoclonal antibody F10G6; the sequence of the heavy chain variable region of the monoclonal antibody R9C8 is shown as SEQ ID NO. 7, and the sequence of the light chain variable region of the monoclonal antibody R9C8 is shown as SEQ ID NO. 8; the sequence of the heavy chain variable region of the monoclonal antibody F10G6 is shown as SEQ ID NO. 17, and the sequence of the light chain variable region is shown as SEQ ID NO. 18.
2. The Pfu DNA polymerase antibody combination of claim 1, wherein the CDR1 sequence of the heavy chain variable region sequence of monoclonal antibody R9C8 is shown in SEQ ID No. 1, CDR2 sequence is shown in SEQ ID No. 2, and CDR3 sequence is shown in SEQ ID No. 3.
3. The Pfu DNA polymerase antibody combination of claim 1, wherein the CDR1 sequence of the light chain variable region sequence of monoclonal antibody R9C8 is shown in SEQ ID No. 4, CDR2 sequence is shown in SEQ ID No. 5, and CDR3 sequence is shown in SEQ ID No. 6.
4. The Pfu DNA polymerase antibody combination of claim 1, wherein the CDR1 sequence of the heavy chain variable region sequence of monoclonal antibody F10G6 is shown in SEQ ID No. 11, CDR2 sequence is shown in SEQ ID No. 12, and CDR3 sequence is shown in SEQ ID No. 13.
5. The Pfu DNA polymerase antibody combination of claim 1, wherein the CDR1 sequence of the light chain variable region sequence of monoclonal antibody F10G6 is shown in SEQ ID No. 14, CDR2 sequence is shown in SEQ ID No. 15, and CDR3 sequence is shown in SEQ ID No. 16.
6. The Pfu DNA polymerase antibody combination of claim 1, wherein the heavy chain sequence of the monoclonal antibody R9C8 is shown in SEQ ID NO. 9 and the light chain sequence is shown in SEQ ID NO. 10.
7. Pfu DNA polymerase antibody combination of claim 2, wherein the heavy chain sequence of the monoclonal antibody F10G6 is shown in SEQ ID NO. 19 and the light chain sequence is shown in SEQ ID NO. 20.
8. The Pfu DNA polymerase antibody combination of claim 1, wherein the mass ratio of Pfu DNA polymerase monoclonal antibody R9C8 and Pfu DNA polymerase monoclonal antibody F10G6 is 0.5-1.5:1.
9. use of a Pfu DNA polymerase antibody combination of any one of claims 1 to 8 for reducing non-specific amplification of Pfu DNA polymerase.
10. The use according to claim 9, wherein the mass ratio of Pfu DNA polymerase antibody combination to Pfu DNA polymerase is 1.5-2.5:1.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202311648966.1A CN117659200A (en) | 2023-12-01 | 2023-12-01 | Pfu DNA polymerase antibody combination and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202311648966.1A CN117659200A (en) | 2023-12-01 | 2023-12-01 | Pfu DNA polymerase antibody combination and application thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN117659200A true CN117659200A (en) | 2024-03-08 |
Family
ID=90065611
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202311648966.1A Pending CN117659200A (en) | 2023-12-01 | 2023-12-01 | Pfu DNA polymerase antibody combination and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN117659200A (en) |
-
2023
- 2023-12-01 CN CN202311648966.1A patent/CN117659200A/en active Pending
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN113321733B (en) | TaqDNA polymerase monoclonal antibody and application thereof, polymerase reaction system containing same and application thereof | |
| CN111560073B (en) | Taq enzyme 5 '-3' polymerase activity blocking monoclonal antibody and application thereof | |
| CN111808197B (en) | Taq DNA polymerase monoclonal antibody combination and reaction system and application thereof | |
| CN111662386B (en) | Taq DNA polymerase monoclonal antibody combination, polymerase reaction system containing same and application thereof | |
| EP4130260A1 (en) | Construction method and application of antigen-specific binding polypeptide gene display vector | |
| CN115806621A (en) | Monoclonal antibody F2B2 of Taq DNA polymerase and application thereof | |
| CN117126280B (en) | Anti-human BCMA nanobody with hydrophilic amino acid residues, CAR-T and application | |
| US20220228138A1 (en) | Method for preparing phage library | |
| CN117659200A (en) | Pfu DNA polymerase antibody combination and application thereof | |
| CN117843796A (en) | Pfu DNA polymerase antibody F10G6 and application thereof | |
| CN117801112A (en) | Pfu DNA polymerase antibody R9C8 and application thereof | |
| CN115806622A (en) | Monoclonal antibody R8F3 of Taq DNA polymerase and application thereof | |
| CN116162162A (en) | Rat anti-mouse CD137 antibody or functional fragment thereof, tool antibody and application thereof | |
| CN110894236B (en) | Anti-aspergillus galactomannan monoclonal antibody and application thereof | |
| CN114605536A (en) | Affinity purification method for reducing host cell protein content in production of anti-human thymic stromal lymphopoietin monoclonal antibody | |
| CN113637079B (en) | Monoclonal antibody against SETD3 and application thereof | |
| CN107540747B (en) | Anti-human DLL4 monoclonal antibody 6F12 | |
| CN112342198A (en) | PAT/PAT monoclonal antibody hybridoma cell strain, antibody produced by same and preparation method thereof | |
| CN110702913A (en) | Monoclonal antibody composition for quantitatively detecting coxiella burnetii I strain | |
| CA2970023C (en) | A method for producing a recombinant allotypespecific rabbit monoclonal antibody | |
| CN115594768B (en) | Hybridoma cell secreting anti-DNA polymerase monoclonal antibody, monoclonal antibody and application of monoclonal antibody | |
| US20240150446A1 (en) | Method of producing antibodies from single plasma cells | |
| CN116731184B (en) | Monoclonal antibody F6H12 specifically binding to Taq enzyme and application thereof | |
| CN116217730B (en) | Monoclonal antibody F7H6 of Taq enzyme and application thereof | |
| CN115074365B (en) | sgRNA targeting GATM gene and application thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication |