CN117466994A - Monkey pox virus monoclonal neutralizing antibody and application thereof - Google Patents
Monkey pox virus monoclonal neutralizing antibody and application thereof Download PDFInfo
- Publication number
- CN117466994A CN117466994A CN202310889094.1A CN202310889094A CN117466994A CN 117466994 A CN117466994 A CN 117466994A CN 202310889094 A CN202310889094 A CN 202310889094A CN 117466994 A CN117466994 A CN 117466994A
- Authority
- CN
- China
- Prior art keywords
- seq
- variable region
- chain variable
- antibody
- antigen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 241000700627 Monkeypox virus Species 0.000 title claims abstract description 56
- 230000003472 neutralizing effect Effects 0.000 title claims abstract description 28
- 102000036639 antigens Human genes 0.000 claims abstract description 64
- 108091007433 antigens Proteins 0.000 claims abstract description 64
- 239000000427 antigen Substances 0.000 claims abstract description 62
- 241000700647 Variola virus Species 0.000 claims abstract description 23
- 241000700618 Vaccinia virus Species 0.000 claims abstract description 16
- 206010069586 Orthopox virus infection Diseases 0.000 claims abstract description 9
- 239000003814 drug Substances 0.000 claims abstract description 5
- 230000027455 binding Effects 0.000 claims description 41
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 34
- 239000012634 fragment Substances 0.000 claims description 32
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 24
- 241000700629 Orthopoxvirus Species 0.000 claims description 9
- 239000013604 expression vector Substances 0.000 claims description 9
- 239000000203 mixture Substances 0.000 claims description 8
- 239000008194 pharmaceutical composition Substances 0.000 claims description 8
- 238000002360 preparation method Methods 0.000 claims description 6
- 241000282414 Homo sapiens Species 0.000 claims description 5
- 239000002552 dosage form Substances 0.000 claims description 5
- 108091033319 polynucleotide Proteins 0.000 claims description 4
- 102000040430 polynucleotide Human genes 0.000 claims description 4
- 239000002157 polynucleotide Substances 0.000 claims description 4
- 239000000843 powder Substances 0.000 claims description 4
- 239000003795 chemical substances by application Substances 0.000 claims description 3
- 239000003937 drug carrier Substances 0.000 claims description 3
- 239000008187 granular material Substances 0.000 claims description 3
- 239000002674 ointment Substances 0.000 claims description 3
- 241000699666 Mus <mouse, genus> Species 0.000 claims description 2
- 239000007902 hard capsule Substances 0.000 claims description 2
- 238000002347 injection Methods 0.000 claims description 2
- 239000007924 injection Substances 0.000 claims description 2
- 238000004519 manufacturing process Methods 0.000 claims description 2
- 239000008188 pellet Substances 0.000 claims description 2
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 2
- 239000006187 pill Substances 0.000 claims description 2
- 230000002265 prevention Effects 0.000 claims description 2
- 239000007901 soft capsule Substances 0.000 claims description 2
- 239000006190 sub-lingual tablet Substances 0.000 claims description 2
- 239000000829 suppository Substances 0.000 claims description 2
- 239000003826 tablet Substances 0.000 claims description 2
- 241000283690 Bos taurus Species 0.000 claims 1
- 241000283707 Capra Species 0.000 claims 1
- 241000700199 Cavia porcellus Species 0.000 claims 1
- 241000282693 Cercopithecidae Species 0.000 claims 1
- 241000699800 Cricetinae Species 0.000 claims 1
- 241000283073 Equus caballus Species 0.000 claims 1
- 241000282326 Felis catus Species 0.000 claims 1
- 241000282341 Mustela putorius furo Species 0.000 claims 1
- 241000283973 Oryctolagus cuniculus Species 0.000 claims 1
- 241001494479 Pecora Species 0.000 claims 1
- 241000009328 Perro Species 0.000 claims 1
- 241000700159 Rattus Species 0.000 claims 1
- 241000282898 Sus scrofa Species 0.000 claims 1
- 239000007888 film coating Substances 0.000 claims 1
- 238000009501 film coating Methods 0.000 claims 1
- 239000004503 fine granule Substances 0.000 claims 1
- 239000007788 liquid Substances 0.000 claims 1
- 239000006186 oral dosage form Substances 0.000 claims 1
- 229940023488 pill Drugs 0.000 claims 1
- 239000011505 plaster Substances 0.000 claims 1
- 241000894007 species Species 0.000 claims 1
- 229940098466 sublingual tablet Drugs 0.000 claims 1
- 230000000699 topical effect Effects 0.000 claims 1
- 102000004169 proteins and genes Human genes 0.000 abstract description 20
- 108090000623 proteins and genes Proteins 0.000 abstract description 20
- 230000008685 targeting Effects 0.000 abstract 2
- HDOVUKNUBWVHOX-QMMMGPOBSA-N Valacyclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCOC(=O)[C@@H](N)C(C)C)C=N2 HDOVUKNUBWVHOX-QMMMGPOBSA-N 0.000 description 20
- 210000004027 cell Anatomy 0.000 description 16
- 241000700626 Cowpox virus Species 0.000 description 13
- 241000700605 Viruses Species 0.000 description 7
- 230000000694 effects Effects 0.000 description 7
- 208000015181 infectious disease Diseases 0.000 description 7
- 208000005871 monkeypox Diseases 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 238000011534 incubation Methods 0.000 description 6
- 210000001806 memory b lymphocyte Anatomy 0.000 description 5
- 238000006386 neutralization reaction Methods 0.000 description 5
- 238000012163 sequencing technique Methods 0.000 description 5
- 229930040373 Paraformaldehyde Natural products 0.000 description 4
- 210000003719 b-lymphocyte Anatomy 0.000 description 4
- 238000000034 method Methods 0.000 description 4
- 239000011259 mixed solution Substances 0.000 description 4
- 229920002866 paraformaldehyde Polymers 0.000 description 4
- 229920001184 polypeptide Polymers 0.000 description 4
- 108090000765 processed proteins & peptides Proteins 0.000 description 4
- 102000004196 processed proteins & peptides Human genes 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 3
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 3
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 102000053602 DNA Human genes 0.000 description 2
- 101000619564 Homo sapiens Putative testis-specific prion protein Proteins 0.000 description 2
- 102100022208 Putative testis-specific prion protein Human genes 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 2
- 239000001768 carboxy methyl cellulose Substances 0.000 description 2
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 238000004043 dyeing Methods 0.000 description 2
- 239000013613 expression plasmid Substances 0.000 description 2
- 238000011990 functional testing Methods 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 210000001165 lymph node Anatomy 0.000 description 2
- 108700021021 mRNA Vaccine Proteins 0.000 description 2
- 229940126582 mRNA vaccine Drugs 0.000 description 2
- 239000002808 molecular sieve Substances 0.000 description 2
- 238000007857 nested PCR Methods 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- VYNDHICBIRRPFP-UHFFFAOYSA-N pacific blue Chemical compound FC1=C(O)C(F)=C2OC(=O)C(C(=O)O)=CC2=C1 VYNDHICBIRRPFP-UHFFFAOYSA-N 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 229940083538 smallpox vaccine Drugs 0.000 description 2
- URGAHOPLAPQHLN-UHFFFAOYSA-N sodium aluminosilicate Chemical compound [Na+].[Al+3].[O-][Si]([O-])=O.[O-][Si]([O-])=O URGAHOPLAPQHLN-UHFFFAOYSA-N 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 238000002255 vaccination Methods 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- 210000002845 virion Anatomy 0.000 description 2
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 102100027207 CD27 antigen Human genes 0.000 description 1
- 102100025877 Complement component C1q receptor Human genes 0.000 description 1
- 241000450599 DNA viruses Species 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102100035716 Glycophorin-A Human genes 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 1
- 101000933665 Homo sapiens Complement component C1q receptor Proteins 0.000 description 1
- 101001074244 Homo sapiens Glycophorin-A Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 208000035472 Zoonoses Diseases 0.000 description 1
- WXJFKKQWPMNTIM-VWLOTQADSA-N [(2s)-1-(4-amino-2-oxopyrimidin-1-yl)-3-hydroxypropan-2-yl]oxymethyl-(3-hexadecoxypropoxy)phosphinic acid Chemical compound CCCCCCCCCCCCCCCCOCCCOP(O)(=O)CO[C@H](CO)CN1C=CC(N)=NC1=O WXJFKKQWPMNTIM-VWLOTQADSA-N 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 229950005107 brincidofovir Drugs 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- CSKDFZIMJXRJGH-VWLPUNTISA-N tecovirimat Chemical compound C1=CC(C(F)(F)F)=CC=C1C(=O)NN1C(=O)[C@@H]([C@@H]2[C@H]3C[C@H]3[C@H]3C=C2)[C@@H]3C1=O CSKDFZIMJXRJGH-VWLPUNTISA-N 0.000 description 1
- 229950009384 tecovirimat Drugs 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 229940036109 vaccinia immunoglobulin Drugs 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 206010048282 zoonosis Diseases 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/081—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0684—Cells of the urinary tract or kidneys
- C12N5/0686—Kidney cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/10—Plasmid DNA
- C12N2800/106—Plasmid DNA for vertebrates
- C12N2800/107—Plasmid DNA for vertebrates for mammalian
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Virology (AREA)
- General Engineering & Computer Science (AREA)
- Urology & Nephrology (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Immunology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Physics & Mathematics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Plant Pathology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention belongs to the field of biological medicine, and in particular relates to a monoclonal neutralizing antibody for monkey pox virus B6 and M1 antigens and application thereof. The invention provides two monoclonal neutralizing antibodies targeting the B6 antigen and two monoclonal neutralizing antibodies targeting the M1 antigen of the monkey pox virus, which can be widely combined with proteins homologous to B6 or M1 in the B6 or M1 antigen of the monkey pox virus, vaccinia virus, smallpox virus and vaccinia virus, can neutralize orthopoxvirus infection represented by the vaccinia virus, can be used for preventing and treating orthopoxvirus infection including but not limited to the monkey pox virus, the vaccinia virus, the smallpox virus, the vaccinia virus and the like, and has a great application prospect.
Description
Technical Field
The invention belongs to the field of biological medicine, and in particular relates to a monoclonal neutralizing antibody for monkey pox virus B6 and M1 antigens and application thereof.
Background
Monkey Poxviruses (MPXV) belong to the genus orthopoxvirus, which also includes Variola virus (VARV), vaccinia virus (vaccina virus, VACV), and Vaccinia virus (cowpoxvirus, CPXV), and the like, and infections in humans can cause diseases of varying severity, jeopardizing human health.
Monkey pox (Mpox) belongs to zoonotic disease, and the first time a human infection case was found in 1970, and then spread locally in the middle and western regions of Africa for a long time, but since the diagnosis of monkey pox cases in the United kingdom in month 5 of 2022, the diagnosis of monkey pox cases was confirmed in multiple countries worldwide, indicating that the epidemic situation of monkey pox has assumed a global epidemic situation. Studies show that although smallpox vaccine has a certain immunity protection effect on smallpox, most of people (birth after 1980) lack resistance to orthopoxviruses such as smallpox virus and smallpox virus along with the elimination of smallpox and the stop of vaccination. Currently, although chemicals such as Tecovirimat, brincidofovir have been approved for the treatment of smallpox and vaccinia immunoglobulins (vaccinia immunoglobulin, VIG) have been approved for complications resulting from smallpox vaccination, and also for infection with orthopoxviruses such as monkey pox, their efficacy in other orthopoxviruses such as monkey pox has been limited. Currently, no effective drug against monkey poxvirus is used for the treatment of diseases.
Orthopoxviruses such as monkey pox virus belong to double stranded DNA viruses, have a genome size of about 200kb, encode up to 200 proteins, and have two different forms of infectious viral particles, intracellular mature particles (Intracellular mature virion, IMV) and extracellular capsular particles (Extracellular enveloped virion, EEV), respectively, with different capsular structures, modes of infection and surface antigens. M1, H3, A29, E8 on the surface of IMV and B6, A35 on the surface of EEV are shown to induce the generation of neutralizing antibodies, and thus become important targets for research of therapeutic antibodies, vaccines and the like.
The invention aims at screening monoclonal antibodies with neutralizing activity against the B6 antigen on the EEV surface and the M1 antigen on the IMV surface of the monkey pox virus.
Disclosure of Invention
The invention takes MPXV B6 expressed by mammalian cells as antigen, screens memory B cells which can specifically bind to the MPXV B6 antigen from PBMCs of smallpox vaccine vaccinated population by flow sorting, then carries out reverse transcription PCR and nested PCR on the sorted single B cells, amplifies the variable region sequence of the antibody by using specific primers, and is further connected with an antibody constant region into an expression vector. Through expressing and purifying the antibody by mammalian cells, a series of functional tests including binding capacity, neutralizing activity and the like are carried out, so that two human monoclonal antibodies D21 and D68 which have broad-spectrum binding MPXV, VACV, VARV, CPXV and can neutralize VACV infection are obtained. Meanwhile, the invention takes MPXV M1 expressed by mammalian cells as an antigen, screens B cells which can specifically bind to the MPXV M1 antigen from a surviving mouse lymph node inoculated with a monkey pox virus mRNA vaccine and protected by virus attack through flow separation, and then carries out 10 Xgenomic sequencing on the screened B cells to obtain an antibody variable region sequence, further synthesizes the variable region sequence and links the variable region sequence with an antibody constant region into an expression vector. Through expressing and purifying the antibody by mammal cells, a series of functional tests including binding capacity, neutralizing activity and the like are carried out, so that two strains of mouse monoclonal antibodies 39# and 40# which have broad-spectrum binding MPXV, VACV, VARV, CPXV and can neutralize VACV infection are obtained. Thus, the present invention has been completed.
The invention provides neutralizing antibodies and antigen binding fragments thereof against the B6 and M1 antigens of the monkey pox virus, in particular neutralizing antibodies D21, D68 or antigen binding fragments thereof against the B6 antigen of the monkey pox virus, or neutralizing antibodies 39#,40# or antigen binding fragments thereof against the M1 antigen of the monkey pox virus,
the three complementarity determining region CDRs of the D21 heavy chain variable region thereof have amino acid sequences selected from the group consisting of:
CDR1 as shown in SEQ ID NO. 1,
CDR2 as shown in SEQ ID NO. 2, and
CDR3 as shown in SEQ ID NO. 3;
the three complementarity determining region CDRs of the D21 light chain variable region thereof have amino acid sequences selected from the group consisting of:
CDR1 as shown in SEQ ID NO. 4,
CDR2 as shown in SEQ ID NO. 5, and
CDR3 as shown in SEQ ID NO. 6.
The three complementarity determining region CDRs of the D68 heavy chain variable region thereof have amino acid sequences selected from the group consisting of:
CDR1 as shown in SEQ ID NO. 7,
CDR2 as shown in SEQ ID NO. 8, and
CDR3 as shown in SEQ ID NO 9;
the three complementarity determining region CDRs of the D68 light chain variable region thereof have amino acid sequences selected from the group consisting of:
CDR1 as shown in SEQ ID NO. 10,
CDR2 as shown in SEQ ID NO. 11, and
CDR3 as shown in SEQ ID NO. 12.
The three complementarity determining region CDRs of the 39# heavy chain variable region thereof have amino acid sequences selected from the group consisting of:
CDR1 as shown in SEQ ID NO. 13,
CDR2 as shown in SEQ ID NO. 14, and
CDR3 as shown in SEQ ID NO. 15;
the three complementarity determining region CDRs of the 39# light chain variable region thereof have amino acid sequences selected from the group consisting of:
CDR1 as shown in SEQ ID NO. 16,
CDR2 as shown in SEQ ID NO 17, and
CDR3 as shown in SEQ ID NO. 18.
The three complementarity determining region CDRs of the 40# heavy chain variable region thereof have amino acid sequences selected from the group consisting of:
CDR1 as shown in SEQ ID NO. 19,
CDR2 as shown in SEQ ID NO. 20, and
CDR3 as shown in SEQ ID NO. 21;
the three complementarity determining region CDRs of the 40# light chain variable region thereof have amino acid sequences selected from the group consisting of:
CDR1 as shown in SEQ ID NO. 22,
CDR2 as shown in SEQ ID NO. 23, and
CDR3 as shown in SEQ ID NO. 24.
Where "antigen binding fragment" refers to antigen binding fragments of antibodies and antibody analogs, it generally includes at least a portion of the antigen binding or variable regions of the parent antibody, e.g., one or more CDRs. Fragments of the antibodies retain at least some of the binding specificity of the parent antibody.
In one embodiment, the D21 antibody or antigen binding fragment thereof comprises:
a heavy chain variable region as shown in SEQ ID NO. 25, and
the light chain variable region as shown in SEQ ID NO. 26.
In one embodiment, the D68 antibody or antigen binding fragment thereof comprises:
a heavy chain variable region as shown in SEQ ID NO 27, and
the light chain variable region as shown in SEQ ID NO. 28.
In one embodiment, the 39# antibody or antigen binding fragment thereof comprises:
a heavy chain variable region as shown in SEQ ID NO. 29, and
the light chain variable region as shown in SEQ ID NO. 30.
In one embodiment, the 40# antibody or antigen binding fragment thereof comprises:
a heavy chain variable region as shown in SEQ ID NO. 31, and
the light chain variable region as shown in SEQ ID NO. 32.
In one embodiment, the antibody or antigen binding fragment thereof comprises:
a heavy chain constant region as shown in SEQ ID NO. 33, and
the light chain constant region as shown in SEQ ID NO. 34.
In one embodiment, wherein the antigen binding fragment is selected from the group consisting of Fab, fab '-SH, fv, scFv, F (ab') 2, diabodies, antibody compositions.
Wherein "Fab" consists of one light chain and one heavy chain variable region and CH 1.
"Fab' fragment" containsOne light chain and a portion of one heavy chain comprising a variable region and a region between CH1 or CH1 and CH2 domains, an interchain disulfide bond being formed between the two heavy chains of the two Fab 'fragments to form F (ab') 2 A molecule.
“F(ab′) 2 The fragment "comprises two light chains and two heavy chains comprising portions of the constant region between the CH1 and CH2 domains, thereby forming an interchain disulfide bond between the two heavy chains. Thus, F (ab') 2 Fragments consist of two Fab' fragments held together by disulfide bonds between the two heavy chains.
The "Fv region" comprises variable regions from both the heavy and light chains, but lacks constant regions.
"Single chain Fv antibody (scFv antibody)" refers to an antigen-binding fragment comprising the variable regions of an antibody, which domains are contained in a single polypeptide chain. In general, scfvs comprise a polypeptide linker between the heavy and light chain variable regions that enables the scFv to form the desired structure for antigen binding.
A "diabody" is an antigen-binding fragment having two antigen-binding sites. The fragments comprise a VH (VH-VL or VL-VH) linked to a VL in the same polypeptide chain. By using a linker that is so short that it is not possible to pair between two domains of the same strand, the domains pair with complementary domains of the other strand and form two antigen binding sites.
An "antibody composition" comprises a mixture of antibodies.
The present invention provides a polynucleotide encoding a neutralizing antibody or antigen binding fragment or polypeptide thereof of any one of the preceding claims.
The present invention provides an expression vector comprising the polynucleotide described above.
The present invention provides a host cell comprising the above expression vector.
The invention provides the use of a neutralizing antibody or antigen binding fragment thereof of any of the above in the manufacture of a medicament for the treatment and prevention of orthopoxvirus infections including, but not limited to, monkey pox virus, vaccinia virus, smallpox virus, vaccinia virus, and the like.
The present invention provides a pharmaceutical composition comprising a neutralizing antibody or antigen binding fragment thereof of any one of the preceding claims and a pharmaceutically acceptable carrier.
The invention also provides pharmaceutical compositions comprising the monkey poxvirus neutralizing antibodies or antigen binding fragments thereof of the invention. For the preparation of pharmaceutical compositions, the antibodies or antigen-binding fragments thereof may be formulated into various desired dosage forms by mixing with pharmaceutically acceptable carriers or excipients. Examples of the type of the dosage form of the pharmaceutical composition of the present invention include tablets, powders, pills, powders, granules, fine granules, soft/hard capsules, film-coated agents, pellets, sublingual tablets, ointments and the like, which are oral preparations, and non-oral preparations include injections, suppositories, transdermal preparations, ointments, plasters, external solutions and the like, and those skilled in the art can select an appropriate dosage form depending on the route of administration, the administration subject and the like.
The amount of the active ingredient to be administered of the pharmaceutical composition of the present invention varies depending on the administration subject, the organ to be administered, the symptoms, the administration method, etc., and can be determined by considering the type of the dosage form, the administration method, the age and weight of the patient, the symptoms of the patient, etc., and the judgment of the doctor.
The invention has the beneficial effects that:
the screening of the invention obtains two target monkey pox virus B6 antigens and two target M1 antigen monoclonal neutralizing antibodies, which can be widely combined with the monkey pox virus B6 or M1 antigen and proteins homologous to B6 or M1 in vaccinia virus, smallpox virus and vaccinia virus, and can neutralize orthopoxvirus infection represented by vaccinia virus, and has the potential of treating and preventing orthopoxvirus infection including but not limited to monkey pox virus, vaccinia virus, smallpox virus, vaccinia virus and the like.
Drawings
Fig. 1: a kinetic profile of broad-spectrum binding of the D21 antibody to the B6-homologous antigen in MPXV B6 and VACV, VARV, CPXV;
fig. 2: kinetics curves for broad-spectrum binding of the D68 antibody to B6-homologous antigen in MPXV B6 and VACV, VARV, CPXV;
fig. 3: the # 39 antibody broad-spectrum binds to the kinetics profile of the M1-homologous antigen in MPXV M1 and VACV, VARV, CPXV;
fig. 4: a kinetic profile of broad-spectrum binding of antibody 40 to M1 homologous antigen in MPXV M1 and VACV, VARV, CPXV;
fig. 5: d21 and D68 neutralize the effect of orthopoxvirus infection typified by VACV.
Fig. 6: neutralization of the effects of the orthopoxvirus infection represented by VACV in # 39 and # 40.
The specific information of each sequence of the invention is as follows:
SEQ ID NO:1:GFSISTYP
SEQ ID NO:2:ISHDGRNK
SEQ ID NO:3:ARAYPYAFDVSEQ ID NO:4:QSVRND
SEQ ID NO:5:GAS
SEQ ID NO:6:QQYKDWPPWT
SEQ ID NO:7:GGTFSDYA
SEQ ID NO:8:ILPIVGVP
SEQ ID NO:9:ARRSGINGHGLDV
SEQ ID NO:10:QSLLNTNGYNY
SEQ ID NO:11:LGS
SEQ ID NO:12:MQTLQTQGYT
SEQ ID NO:13:GYTFTSYW
SEQ ID NO:14:INPSTGYT
SEQ ID NO:15:TRSDSTNYLFVY
SEQ ID NO:16:QSLLNSRTRKNH
SEQ ID NO:17:WAS
SEQ ID NO:18:KQSYNLMYT
SEQ ID NO:19:GYIFTRYW
SEQ ID NO:20:INPSTGYT
SEQ ID NO:21:ARSDYTNYVFEY
SEQ ID NO:22:QSLVHSNGNTY
SEQ ID NO:23:KVS
SEQ ID NO:24:SQSTHVPYT
SEQ ID NO:25:QVQLVQSGGGVVQPGRSLRLSCVASGFSISTYPLHWVRQAPGKGLE WVAVISHDGRNKYYADSVKGRFSISRDNSKNTVYLQMNSLRVEDTAVYYCARAYPYAFDV WGQGTLVTVSS
SEQ ID NO:26:EIVLTQSPATLSVSPGETATLSCRASQSVRNDLAWYQQKPGQAPRLLI YGASTRASGIPARFSGSGSGTEFTLTISSLQSEDFAIYYCQQYKDWPPWTFGQGTKVEIK
SEQ ID NO:27:QVQLVQSGAEVKKPGSSVKVSCKSSGGTFSDYAINWVRQAPGQGL EWMGRILPIVGVPNYAQKFQGRVTITADKSSSTAYKEVSGLRSEDTAVYYCARRSGINGHGL DVWGQGTTVIVSS
SEQ ID NO:28:DIVMTQSPLSLPVTPGEPASISCRSSQSLLNTNGYNYLEWYLHKPGQ SPQLLIYLGSHRASGVPDRFSGSGSGTDFTLKISRAEPEDVGVYYCMQTLQTQGYTFGQGT KLEIK
SEQ ID NO:29:QVQLQQSGAELAKPGASVKMSCKASGYTFTSYWMHWVKQRPGQG LEWIGYINPSTGYTEYNQKFKDKATLTADKSSSTAYMQLSSLTSEDSAVYYCTRSDSTNYLF VYWGQGTLVTVSS
SEQ ID NO:30:DIVMSQSPSSLAVSAGEKVTMRCKSSQSLLNSRTRKNHLAWYQQKP GQSPTLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLMYTFGGG TKLEIK
SEQ ID NO:31:QVQLQQSGAEVAKPGASVRMSCKASGYIFTRYWMHWVKQRPGQG LEWIGYINPSTGYTEYNQKFKDKAALTADKSSGTAYMQLSSLTSEDSAVYYCARSDYTNYV FEYWGQGTLVTVSS
SEQ ID NO:32:DVVMTQTPLSLPVSLGDHASISCRSSQSLVHSNGNTYLHWSLQKPG QSPKLLIFKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPYTFGGGTEL EIK
SEQ ID NO:33:ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
SEQ ID NO:34:RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECS。
Detailed Description
The present invention will be further described in detail below with reference to specific embodiments and with reference to the accompanying drawings, in order to make the objects, technical solutions and advantages of the present invention more apparent.
Example 1: isolation of MPXV B6 protein-specific memory B cells
In volunteersWith informed consent, approximately 15mL of blood was collected and PBMCs were isolated by centrifugation using lymphocyte separation tubes (available from Daidae). Isolated PBMCs were incubated with MPXV B6 protein (400 nM final concentration) on ice for 30min, then washed 2 times with PBS, and incubated with the following antibodies (from BD or Miltenyi): anti-human CD3/PE-Cy5, anti-human CD16/PE-Cy5, anti-human CD235a/PE-Cy5, anti-human CD19/APC-Cy7, anti-human CD27/Pacific Blue, anti-human IgG/FITC, and anti-His/PE. After incubation with antibody on ice for 30min, wash with PBS 2 times and transfer into flow tubes. Sorting by FACSAria III, collecting PE-Cy5 - APC-Cy7 + Pacific Blue + FITC + PE + I.e. antigen-specific binding memory B cells, were collected directly into 96-well plates, 1 cell per well.
Example 2: single memory B cell BCR sequence amplification and IgG total antibody expression vector construction
The memory B cells obtained in example 1 were reverse transcribed by thermostable M-MVL reverse transcriptase (purchased from Beijing Jialan) while template switching and ligation were performed by TSO primers at 42℃for 90min; then 50 ℃,2min,42 ℃,2min and 10 cycles; 70 ℃ for 15min; cDNA was obtained.
The reverse transcription product cDNA was used as a template for enrichment by dsDNA amplification using the HotStar Tap Plus enzyme (QIAgen). The reaction conditions were as follows: 95 ℃ for 5min;95 ℃,30s,60 ℃,30s,72 ℃ and 90s;30 cycles; 72℃for 10min.
Using the PCR product as a template, the variable region sequence of the antibody was amplified specifically by nested PCR, and the first round of PCR (PCRa) reaction conditions were as follows: 95 ℃ for 5min;95 ℃,30s,55 ℃ (H chain/kappa chain) or 50 ℃ (lambda chain), 30s,72 ℃,90s,35 cycles; 72℃for 7min. This product was used as template and subjected to a second round of PCR (PCRb) under the following reaction conditions: 95 ℃ for 5min;95 ℃,30s,58 ℃ (H chain) or 60 ℃ (kappa chain) or 64 ℃ (lambda chain), 30s,72 ℃,90s,35 cycles; PCR products were obtained at 72℃for 7min.
The PCR products were separated by electrophoresis on a 1.2% agarose gel, and the cut gel with a band size of 400bp was recovered and sequenced. The sequences measured were analyzed using IgBlast or IMGT online websites.
And (3) connecting the variable region sequence of the antibody obtained by analysis with the constant region of the corresponding heavy chain/light chain through homologous recombination, and cloning the variable region sequence into an expression vector pCAGGS (laboratory preservation) to obtain the IgG full-antibody light and heavy chain recombinant expression plasmid. And (3) carrying out cotransfection of the antibody light and heavy chain plasmids on HEK293T cells to express the antibody, purifying the protein by a protein A affinity chromatography column and a molecular sieve chromatography column in sequence, and carrying out SDS-PAGE identification to obtain the high-purity antibody protein.
Wherein, the amino acid sequence of the D21 heavy chain variable region is shown as SEQ ID NO. 25, and the amino acid sequence of the light chain variable region is shown as SEQ ID NO. 26 after sequencing; the amino acid sequence of the heavy chain variable region of D68 is shown as SEQ ID NO. 27, and the amino acid sequence of the light chain variable region is shown as SEQ ID NO. 28.
The three complementarity determining regions CDRs of the D21 heavy chain variable region were analyzed to have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 1, CDR2 as shown in SEQ ID NO. 2, and CDR3 as shown in SEQ ID NO. 3; the three complementarity determining region CDRs of the D21 light chain variable region have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 4, CDR2 as shown in SEQ ID NO. 5, and CDR3 as shown in SEQ ID NO. 6.
The three complementarity determining region CDRs of the D68 heavy chain variable region have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 7, CDR2 as shown in SEQ ID NO. 8, and CDR3 as shown in SEQ ID NO. 9; the three complementarity determining region CDRs of the D68 light chain variable region have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 10, CDR2 as shown in SEQ ID NO. 11, and CDR3 as shown in SEQ ID NO. 12.
Example 3: isolation of MPXV M1 protein-specific B cells, 10 Xgenomic sequencing and construction of IgG full-antibody expression vector
The lymph nodes of the vaccinated monkey pox mRNA vaccine and the surviving challenge mice were collected, ground to form a single cell suspension, added with the monkey pox virus M1 antigen protein at a final concentration of 400nM for incubation with the cells, placed on ice for 30min, washed twice with PBS, stained with antibodies including Anti-mouse CD138/APC, anti-mouse CD93/APC, anti-mouse CD38/PE-Cy7, anti-mouse IgD/BV510, anti-mouse GL-7/FITC, anti-mouse B220/BV421 and Anti-His/PE, incubated for 30min on ice in the absence of light, and after washing twice with PBS, the cells were transferred to the flow tube. Cell populations of CD93-CD138-CD38-/+ IgD-GL-7+ B220+ His+ cell populations were sorted into flow tubes using a flow sorter BDAria III, and immediately after sorting, a 10 XGenomics single cell sequencing procedure (completed by Co.). After obtaining the antibody sequences, the variable region locus characteristics of the antibody were first analyzed, the variable region sequences of the antibody were synthesized and ligated to the constant regions of IgG1/igκ/igλ to form the complete antibody expression plasmid (pCAGGS vector). And (3) carrying out cotransfection of the antibody light and heavy chain plasmids on HEK293T cells to express the antibody, purifying the protein by a protein A affinity chromatography column and a molecular sieve chromatography column in sequence, and carrying out SDS-PAGE identification to obtain the high-purity antibody protein.
Wherein, the amino acid sequence of the 39# heavy chain variable region is shown as SEQ ID NO. 29, and the amino acid sequence of the light chain variable region is shown as SEQ ID NO. 30 after sequencing; the amino acid sequence of the 40# heavy chain variable region is shown as SEQ ID NO. 31, and the amino acid sequence of the light chain variable region is shown as SEQ ID NO. 32.
The three complementarity determining region CDRs of the 39# heavy chain variable region were analyzed to have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 13, CDR2 as shown in SEQ ID NO. 14, and CDR3 as shown in SEQ ID NO. 15; the three complementarity determining region CDRs of the 39# light chain variable region have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 16, CDR2 as shown in SEQ ID NO. 17, and CDR3 as shown in SEQ ID NO. 18.
The three complementarity determining region CDRs of the 40# heavy chain variable region have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 19, CDR2 as shown in SEQ ID NO. 20, and CDR3 as shown in SEQ ID NO. 21; the three complementarity determining region CDRs of the 40# light chain variable region have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 22, CDR2 as shown in SEQ ID NO. 23, and CDR3 as shown in SEQ ID NO. 24.
Example 4: surface Plasmon Resonance (SPR) technology for detecting ability of antibody to bind antigen
Surface plasmon resonance analysis was performed using Biacore 8K (GE Healthcare). The method comprises the following specific steps:
protein A chip (GE Healthcare) is selected, antibody protein is fixed on the chip through combination of protein A and antibody Fc, the fixed amount of the antibody is about 500RU, the antigen protein is diluted by the ratio of PBST solution (pH 7.4), the sample flows through the surface of the chip, and the change of the response value is recorded. Kinetic profile analysis of antibody binding antigen was performed using BIAevaluation software 8K (GE Healthcare) software, as shown in fig. 1-4, and the kinetic constants of antibody binding antigen are shown in tables 1 and 2 below. The results show that the D21 and D68 antibodies have higher affinity with MPXV B6, 1.9nM and 6.2nM respectively, and that D21 is able to bind to VACV, VARV and CPXV homologous proteins in a broad spectrum with comparable ability to MPXV B6, and that D68 binds to VACV homologous proteins with comparable ability to it to MPXV B6, but with slightly reduced ability to bind to VARV and CPXV homologous proteins; the 39# antibody has a higher affinity with MPXV M1 of 1.2nM and binds VACV, VARV and CPXV with comparable or slightly higher affinity; the 40# antibody bound VACV and CPXV with higher affinity than 39#, 0.36nM and 0.17nM, respectively, and bound MPXV and CPXV without dissociation (kd <1.0 e-5). In conclusion, all four antibodies bind to the antigen with high affinity and have good broad spectrum.
Kinetic constants of binding of antibodies D21 and D68 to homologous proteins of orthopoxviruses such as MPXV B6 in Table 1
Note that: the data in the table are the mean ± standard deviation of three independent experiments.
Table 2, kinetic constants of binding of # 39 and # 40 antibodies to homologous proteins of orthopoxviruses such as MPXV M1
Example 5: plaque assay to detect neutralizing effect of antibodies on VACV virus
VACV EEV neutralization: d21 and D68 antibodies were raised from 100. Mu.g/mLStarting 3-fold ratio dilution, and diluting 10 gradients altogether; adding complement to each diluted antibody dilution; adding an antibody for blocking IMV to each antibody dilution; adding diluted virus solution (about 120 PFU/well) to each well; placing the mixed solution in a 37 ℃ incubator for incubation for 2 hours; adding the incubated antibody and virus mixed solution into cells, and infecting the cells for 1h at 37 ℃; the mixture was discarded, cells were washed once with PBS per well, then 1mL (2 XDMEM/carboxymethylcellulose 1:1 mixture) was added, and incubation was continued for 48h; adding 4% paraformaldehyde fixing solution into each hole, and fixing for more than 2 hours; removing paraformaldehyde, adding crystal violet dye liquor into each hole, and observing a result after dyeing for 2 hours; the neutralization activity value (PRNT) of the antibody was calculated based on the number of plaques 50 ). As shown in FIG. 5, the antibodies D21 and D68 can efficiently neutralize VACV virus infection, the activities are respectively 0.075 mug/mL and 0.06 mug/mL, and the broad spectrum characteristics of the antibodies indicate that the antibodies can well neutralize other orthopoxvirus infection such as monkey pox virus.
VACV IMV neutralization: the 39# and 40# antibodies were diluted 2-fold from 100 μg/mL for 10 gradients total; adding diluted virus solution (about 120 PFU/well) to each well; placing the mixed solution in a 37 ℃ incubator for incubation for 2 hours; adding the incubated antibody and virus mixed solution into cells, and infecting the cells for 1h at 37 ℃; the mixture was discarded, cells were washed once with PBS per well, then 1mL (2 XDMEM/carboxymethylcellulose 1:1 mixture) was added, and incubation was continued for 48h; adding 4% paraformaldehyde fixing solution into each hole, and fixing for more than 2 hours; removing paraformaldehyde, adding crystal violet dye liquor into each hole, and observing a result after dyeing for 2 hours; the neutralization activity value (PRNT) of the antibody was calculated based on the number of plaques 50 ). As shown in FIG. 6, it was found that antibodies 39# and 40# were able to neutralize VACV virus infection with high efficiency, the activities were 0.075. Mu.g/mL and 0.06. Mu.g/mL, respectively, and according to the broad-spectrum properties of the antibodies, they were also able to neutralize other orthopoxviruses such as monkey pox virus.
Claims (10)
1. A neutralizing antibody against the B6 antigen (a) or the M1 antigen (B) of the monkey pox virus,
(a) Neutralizing antibodies against the monkey poxvirus B6 antigen, preferably, the three complementarity determining region CDRs of the heavy chain variable region thereof have an amino acid sequence selected from the group consisting of: CDR1 as shown in SEQ ID NO. 1, CDR2 as shown in SEQ ID NO. 2, and CDR3 as shown in SEQ ID NO. 3; the three complementarity determining region CDRs of the light chain variable region thereof have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 4, CDR2 as shown in SEQ ID NO. 5, and CDR3 as shown in SEQ ID NO. 6;
alternatively, the three complementarity determining region CDRs of the heavy chain variable region thereof have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 7, CDR2 as shown in SEQ ID NO. 8, and CDR3 as shown in SEQ ID NO. 9; the three complementarity determining region CDRs of the light chain variable region thereof have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 10, CDR2 as shown in SEQ ID NO. 11, and CDR3 as shown in SEQ ID NO. 12;
(b) Neutralizing antibodies against the monkey poxvirus M1 antigen, preferably, the three complementarity determining region CDRs of the heavy chain variable region thereof have an amino acid sequence selected from the group consisting of: CDR1 as shown in SEQ ID NO. 13, CDR2 as shown in SEQ ID NO. 14, and CDR3 as shown in SEQ ID NO. 15; the three complementarity determining region CDRs of the light chain variable region thereof have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 16, CDR2 as shown in SEQ ID NO. 17, and CDR3 as shown in SEQ ID NO. 18;
alternatively, the three complementarity determining region CDRs of the heavy chain variable region thereof have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 19, CDR2 as shown in SEQ ID NO. 20, and CDR3 as shown in SEQ ID NO. 21; the three complementarity determining region CDRs of the light chain variable region thereof have amino acid sequences selected from the group consisting of: CDR1 as shown in SEQ ID NO. 22, CDR2 as shown in SEQ ID NO. 23, and CDR3 as shown in SEQ ID NO. 24.
2. The monkey poxvirus neutralizing antibody or antigen-binding fragment thereof according to claim 1, wherein the antibody against the monkey poxvirus B6 antigen comprises a heavy chain variable region as shown in SEQ ID No. 25 and a light chain variable region as shown in SEQ ID No. 26;
alternatively, it comprises a heavy chain variable region as set forth in SEQ ID NO. 27 and a light chain variable region as set forth in SEQ ID NO. 28;
the antibody against the monkey pox virus M1 antigen comprises a heavy chain variable region as shown in SEQ ID NO. 29 and a light chain variable region as shown in SEQ ID NO. 30;
alternatively, it contains a heavy chain variable region as shown in SEQ ID NO. 31 and a light chain variable region as shown in SEQ ID NO. 32.
3. The monkey poxvirus neutralizing antibody or antigen binding fragment thereof according to claim 1 or 2, wherein the antibody type is IgG1, igG2, igG3, igG4, igA, igM, igE or IgD;
preferably, the antibody or antigen binding fragment thereof removes CDR regions, and the remaining sequence-derived species include, but are not limited to, one or more of mouse, rat, guinea pig, hamster, rabbit, ferret, cat, dog, goat, sheep, cow, pig, horse, monkey, and human;
preferably, the antibody further comprises a heavy chain constant region and a light chain constant region;
preferably, the antibody comprises the sequence of the constant region of one of the human antibodies IgG1, igG2, igG3, igG4, igA, igM, igE or IgD;
preferably, the amino acid sequence of the heavy chain constant region of the antibody is shown in SEQ ID NO. 33;
preferably, the amino acid sequence of the light chain constant region of the antibody is shown in SEQ ID NO. 34.
4. A monkey poxvirus neutralizing antibody or antigen binding fragment thereof according to any one of claims 1 to 3, characterised in that it is a Fab, fab '-SH, fv, scFv, F (ab') 2, diabody, antibody composition.
5. A polynucleotide encoding the monkey poxvirus neutralizing antibody or antigen binding fragment thereof of any one of claims 1 to 4.
6. An expression vector comprising the polynucleotide of claim 5.
7. A host cell comprising the expression vector of claim 6.
8. Use of a monkey poxvirus neutralizing antibody or antigen binding fragment thereof according to any one of claims 1 to 4 in the manufacture of a medicament for the treatment and prevention of an orthopoxvirus infection, in particular an orthopoxvirus including but not limited to a monkey poxvirus, a vaccinia virus, a smallpox virus, a vaccinia virus.
9. A pharmaceutical composition comprising the monkey poxvirus neutralizing antibody or antigen binding fragment thereof according to any one of claims 1 to 4 and a pharmaceutically acceptable carrier, optionally further comprising excipients.
10. The pharmaceutical composition of claim 9, wherein the pharmaceutical composition is in a dosage form that is an oral or non-oral dosage form; more specifically, the oral agent is a tablet, a powder, a pill, a powder, a granule, a fine granule, a soft/hard capsule, a film coating agent, a pellet, a sublingual tablet, a paste, or the like; the non-oral preparation is injection, suppository, transdermal preparation, ointment, plaster, topical liquid, etc.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310889094.1A CN117466994A (en) | 2023-07-19 | 2023-07-19 | Monkey pox virus monoclonal neutralizing antibody and application thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310889094.1A CN117466994A (en) | 2023-07-19 | 2023-07-19 | Monkey pox virus monoclonal neutralizing antibody and application thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
CN117466994A true CN117466994A (en) | 2024-01-30 |
Family
ID=89628143
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202310889094.1A Pending CN117466994A (en) | 2023-07-19 | 2023-07-19 | Monkey pox virus monoclonal neutralizing antibody and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN117466994A (en) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN117659177A (en) * | 2024-01-31 | 2024-03-08 | 深圳湾实验室 | Antibodies against monkey poxvirus or antigen binding fragments thereof and uses thereof |
CN117683122A (en) * | 2024-01-31 | 2024-03-12 | 深圳湾实验室 | Antibody against monkey poxvirus, and preparation method and application thereof |
-
2023
- 2023-07-19 CN CN202310889094.1A patent/CN117466994A/en active Pending
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN117659177A (en) * | 2024-01-31 | 2024-03-08 | 深圳湾实验室 | Antibodies against monkey poxvirus or antigen binding fragments thereof and uses thereof |
CN117683122A (en) * | 2024-01-31 | 2024-03-12 | 深圳湾实验室 | Antibody against monkey poxvirus, and preparation method and application thereof |
CN117683122B (en) * | 2024-01-31 | 2024-05-07 | 深圳湾实验室 | Antibody against monkey poxvirus, and preparation method and application thereof |
CN117659177B (en) * | 2024-01-31 | 2024-05-14 | 深圳湾实验室 | Antibodies against monkey poxvirus or antigen binding fragments thereof and uses thereof |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN117466994A (en) | Monkey pox virus monoclonal neutralizing antibody and application thereof | |
CN113563475B (en) | Bispecific antibody for resisting novel coronavirus and application thereof | |
CN110317267B (en) | Bispecific antibodies against rabies virus and uses thereof | |
CN113444169B (en) | Human monoclonal antibodies to novel coronaviruses and uses thereof | |
EP4045533A1 (en) | Human monoclonal antibodies to severe acute respiratory syndrome coronavirus 2 (sars-cov-2) | |
CN113292649B (en) | Human monoclonal antibodies to novel coronaviruses and uses thereof | |
RU2128222C1 (en) | Murine monoclonal antibody nmo1, hybridoma cellular line, fragment of murine monoclonal antibody (variants) | |
CN115850461A (en) | Saebia virus broad-spectrum neutralizing antibody and application thereof | |
CN114621343B (en) | Japanese encephalitis virus antibody 2G1 and application thereof | |
Balcioğlu et al. | SARS-CoV-2 neutralizing antibody development strategies | |
US20230065377A1 (en) | Human antibodies to alphaviruses | |
CN114805579B (en) | Anti-human ACE2 protein monoclonal antibody, nucleic acid molecule and application | |
WO2022258068A1 (en) | Antibody against respiratory syncytial virus and use thereof | |
CN115087667B (en) | Antigen binding proteins that specifically bind SARS-CoV-2 | |
CN113292650B (en) | Human monoclonal antibodies to novel coronaviruses and uses thereof | |
CN116514960A (en) | Fully human monoclonal antibody of respiratory syncytial virus and application thereof | |
CN103755805B (en) | The specific human monoclonal antibodies of HIV-1 Env | |
CN113354731A (en) | Human monoclonal antibodies to coronaviruses and uses thereof | |
CN114736291A (en) | Human monoclonal antibody specifically binding to envelope protein Gn of fever with thrombocytopenia syndrome virus and use thereof | |
WO2023030312A1 (en) | Gene sequence construct for gene therapy for hiv infection | |
CN114805570B (en) | Anti-human ACE2 monoclonal antibody and application thereof | |
US20240018217A1 (en) | Fully Human Monoclonal Antibodies that Broadly Neutralize SARS-COV-2 | |
WO2018169785A2 (en) | Therapeutic antibodies to marburg virus | |
WO2023131262A1 (en) | Antigen-binding protein specifically bound to sars-cov-2 | |
CN115466326B (en) | Humanized monoclonal antibody of respiratory syncytial virus and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination |