CN117285625B - Anti-prolactin monoclonal antibody and application thereof - Google Patents

Anti-prolactin monoclonal antibody and application thereof Download PDF

Info

Publication number
CN117285625B
CN117285625B CN202311579376.8A CN202311579376A CN117285625B CN 117285625 B CN117285625 B CN 117285625B CN 202311579376 A CN202311579376 A CN 202311579376A CN 117285625 B CN117285625 B CN 117285625B
Authority
CN
China
Prior art keywords
prl
prolactin
clone1
monoclonal antibody
protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
CN202311579376.8A
Other languages
Chinese (zh)
Other versions
CN117285625A (en
Inventor
芮兵
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Nanjing Baikang Biotechnology Co ltd
Original Assignee
Nanjing Baikang Biotechnology Co ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Nanjing Baikang Biotechnology Co ltd filed Critical Nanjing Baikang Biotechnology Co ltd
Priority to CN202311579376.8A priority Critical patent/CN117285625B/en
Publication of CN117285625A publication Critical patent/CN117285625A/en
Application granted granted Critical
Publication of CN117285625B publication Critical patent/CN117285625B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/26—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against hormones ; against hormone releasing or inhibiting factors
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N21/00—Investigating or analysing materials by the use of optical means, i.e. using sub-millimetre waves, infrared, visible or ultraviolet light
    • G01N21/75—Systems in which material is subjected to a chemical reaction, the progress or the result of the reaction being investigated
    • G01N21/76—Chemiluminescence; Bioluminescence
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/577—Immunoassay; Biospecific binding assay; Materials therefor involving monoclonal antibodies binding reaction mechanisms characterised by the use of monoclonal antibodies; monoclonal antibodies per se are classified with their corresponding antigens
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/74—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving hormones or other non-cytokine intercellular protein regulatory factors such as growth factors, including receptors to hormones and growth factors
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/575—Hormones
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Abstract

The invention discloses a monoclonal antibody of an anti-prolactin protein and application thereof, wherein the monoclonal antibody is PRL-Clone1, the amino acid sequence of a heavy chain variable region of the PRL-Clone1 is shown as SEQ ID NO.1, and the amino acid sequence of a light chain variable region of the PRL-Clone1 is shown as SEQ ID NO. 2. The preparation method comprises the following steps: and mixing and emulsifying the PRL protein after affinity purification and Freund's adjuvant in an equal volume, collecting blood of a mouse, separating serum, screening the mouse with better immunity, carrying out hybridoma fusion experiments, taking prolactin as an ELISA plate coating antigen, taking supernatant, carrying out ELISA adsorption assay, screening out high-quality positive cell strains, and carrying out two rounds of cell subcloning. Meanwhile, the chemiluminescent diagnostic detection kit of the antibody is also provided, so that the specificity and sensitivity of the diagnostic reagent are improved.

Description

Anti-prolactin monoclonal antibody and application thereof
Technical Field
The invention belongs to the field of antibody preparation and sequence determination, and in particular relates to an anti-prolactin protein monoclonal antibody and application thereof.
Background
Prolactin (PRL) is a protein hormone secreted by the lactation trophoblasts of the anterior pituitary. Prolactin is composed of 199 amino acid residues with 3 disulfide bonds in the molecule and has a molecular weight of about 22Kd. PRL and Growth Hormone (GH) and Placental Lactogen (PL) belong to the PRL/GH/PL family, which are structurally similar, sequence homologous, and have overlapping biological properties. The biological effects of PRL are mainly: promoting the growth and development of mammary gland, participating in stress, metabolism of substances, and regulating immunity and gonad function. The effect of PRL on endocrine is mainly manifested in the effect on gonads. Small doses of PRL have a promoting effect on the synthesis of ovarian estrogens and progestins, while large doses have an inhibiting effect. The PRL has the effects of mainly stimulating the production of luteinizing hormone receptor, and simultaneously promoting the formation of lipoprotein receptor complex with the receptor on the membrane, providing substrate for the production of progesterone and promoting the production of progesterone.
Abnormal elevation of PRL is affected by a number of factors, and pituitary tumors, particularly pituitary prolactinoma, are a common cause thereof. The high concentration of PRL in serum of patients with high prolactin can inhibit secretion of hypothalamic gonadotrophin releasing hormone by negative feedback mode, thereby reducing secretion of adenohypophysis follicle stimulating hormone and luteinizing hormone, and leading patients to anovulation and low estrogen level. Clinical symptoms of female patients with Hyperprolactinemia (HPRL) include galactorrhea, amenorrhea, delayed beginner, changes in menstrual flow or menstrual regularity, and clinical symptoms of male patients include hyposexuality, reduced quality of refinement, erectile dysfunction, osteoporosis, and the like. The abnormal elevation of prolactin in blood seriously affects human health and life quality, and the quantitative detection of the index can evaluate the function of an endocrine system.
Since the core material of the PRL immunodiagnostic reagent with excellent development performance is an anti-PRL monoclonal antibody, the specificity and sensitivity of general manufacturers are not high, so that the development of the PRL immunodiagnostic reagent with excellent development performance is very necessary, and the localization of the diagnostic reagent is expected to be further promoted.
Disclosure of Invention
In order to solve the problems of sensitivity and specificity, the invention provides a monoclonal antibody of the anti-prolactin protein. The antibody has excellent performance and high accuracy. Meanwhile, a chemiluminescent kit based on the PRL antibody is provided.
The invention provides the following technical scheme:
the monoclonal antibody of the anti-prolactin protein is PRL-Clone1,
heavy chain variable region amino acid sequence of PRL-Clone 1:
EVKLEESGGDLVKPGGSLKLSCAASGFGESSYGLSWVRQTPEKRLESVATISDSGSYSYYIDSVKGRFTISRDNAKNNLYLQMSSSRSEDTALYYCVILTGGAYWGQGTLVTVSAIVSS
light chain variable region amino acid sequence of PRL-Clone 1:
MFKVTQSPVVLSASLGERSSLTCRTSQEISGYLSWLLLKPDGTRSRLIYDTSTLDSGVPKGYSGSRSGSDYSLTISSLESEDFAFFYCLQYTTYPLTFGTLTKLELKR
the preparation method of the monoclonal antibody of the anti-prolactin protein comprises the following steps:
expression production of prolactin protein: searching human PRL amino acid sequence on NCBI functional network, adding histidine tag at C end of protein amino acid, optimizing codon in mammal cell expression system by utilizing codon optimizing software, utilizing EcoRI/BamHI restriction enzyme cutting site after gene synthesis, cloning gene into pTT5 expression vector to construct pTT5-PRL expression plasmid, and sequencing to verify gene sequence.
HEK293 cells are transfected after the pTT5-PRL expression plasmid and a transfection reagent PEI are evenly mixed, and meanwhile, an enhancer and an auxiliary material are added into an OPM-293 CD03 Medium cell culture Medium for culture, and after the cell activity rate is less than 70%, cell culture is collected, and cell supernatant is collected after centrifugation.
Affinity purification of prolactin protein: after the cell supernatant was sufficiently resuspended with salt and imidazole and filtered, affinity purification was performed with a preloaded gravity column, eluting and washing by gradient imidazole concentration, protein purity was checked by SDS-PAGE running, protein was dialyzed into phosphate buffer, sterile filtration was performed on a 0.22 μm filter, and protein concentration was determined by BCA.
Mixing and emulsifying the affinity purified lactalbumin and Freund's adjuvant in equal volume, performing immunity measurement to 100 ug/mouse, performing booster immunization after 3 weeks, performing immunity measurement to 50 ug/mouse, collecting mouse blood to separate serum each time after 2 weeks, performing enzyme-linked immunosorbent assay on antibody titer, screening the immunized mice to perform hybridoma fusion experiment, screening and culturing by using a HAT screening culture medium, taking the lactalbumin as an ELISA plate coating antigen, taking supernatant to perform enzyme-linked immunosorbent assay, screening out high-quality positive cell strains, performing two rounds of cell subcloning, cloning monoclonal cell strains, culturing and fermenting cell strains by using serum-free, and collecting culture supernatant.
The application of the monoclonal antibody of the anti-prolactin protein in preparing an immune diagnostic reagent for diagnosing endocrine dyscrasia caused by the elevation of the prolactin.
Monoclonal antibodies were used in PRL chemiluminescent kits. The kit used PRL-Clone1 as the detection antibody.
Compared with the prior art, the invention has the beneficial effects that:
the invention provides an anti-prolactin protein which is used for preparing a monoclonal antibody for diagnosis, the monoclonal antibody of the anti-prolactin protein is PRL-Clone1, can identify immunogens, and has the characteristics of specificity and high affinity, and meanwhile, the invention also provides a chemiluminescent detection kit based on the antibody, thereby improving the specificity and sensitivity of a diagnostic reagent, being capable of rapidly helping doctors to find endocrine dyscrasia of organisms caused by abnormal prolactin, and providing important medical value for follow-up clinical treatment guiding medication.
Drawings
FIG. 1 is a graph showing the correlation between the detection kit of the present invention and the similar products.
Description of the embodiments
The technical solutions of the embodiments of the present invention will be clearly and completely described below in conjunction with the embodiments of the present invention, and it is apparent that the described embodiments are only some embodiments of the present invention, not all embodiments. All other embodiments, which can be made by those skilled in the art based on the embodiments of the invention without making any inventive effort, are intended to be within the scope of the invention.
EXAMPLE 1 construction of prolactin expression vector
Searching human PRL amino acid sequence on NCBI functional network, adding histidine tag at C end of protein amino acid, optimizing codon in mammal cell expression system by utilizing codon optimizing software, utilizing EcoRI/BamHI restriction enzyme cutting site after gene synthesis, cloning gene into pTT5 expression vector to construct pTT5-PRL expression plasmid, and sequencing to verify gene sequence.
Example 2 expression production of prolactin protein
The day before transfection, cells were at 0.8X10 6 Inoculating/ml into cell culture flask, culturing with OPM-293 CD03 Medium culture solution, placing at 37deg.C, and 5% CO 2 In an incubator, transfection is carried out until the cell fusion degree reaches 80% -90% and the activity is more than 95%, and after the pTT5-PRL expression vector and polyetherimide are evenly mixed, the mixture is incubated for 15-Slowly adding into HEK293 cells for 30min, adding enhancer and adjuvants, and adding 5% CO at 37deg.C 2 Culturing is continued in the incubator. When the cell activity rate is<After 70%, cell cultures were collected, centrifuged at 8000 g for 10 min, the supernatant was collected, and centrifuged at 12000 g at 4℃for 30min to collect the cell supernatant.
EXAMPLE 3 affinity purification of prolactin protein
Adding NaCl and imidazole into cell supernatant, adjusting working concentration to 300mM and 5 mM respectively, filtering with 0.22 μm filter membrane, performing affinity purification on Ni TED-6FF beads by pre-loading gravity column, eluting with 20mM PB,300mM NaCl,10% glycerol, 50mM imidazole, pH8.0 solution, 20mM PB,300mM NaCl,10% glycerol, 250mM imidazole, pH8.0 solution, detecting protein purity by SDS-PAGE running gel, dialyzing the protein to 20mM PB,300mM NaCl,10% glycerol, pH8.0 buffer, and performing sterile filtration on 0.22 μm filter, and then measuring protein concentration by BCA.
EXAMPLE 4 preparation of monoclonal antibodies
Mixing PRL protein and Freund's adjuvant in equal volume, emulsifying, metering to 100 ug/mouse, injecting subcutaneously, boosting after 3 weeks, metering to 50 ug/mouse, collecting blood and serum of mouse each time after 2 weeks, measuring antibody titer by ELISA, screening immunized mouse, performing hybridoma fusion experiment, screening and culturing by about 10 days HAT screening culture medium, using PRL as ELISA plate coated antigen, taking supernatant, performing ELISA, screening out high-quality positive cell strain, performing two rounds of cell subcloning, cloning monoclonal cell strain, culturing and fermenting cell strain without serum, collecting culture supernatant, performing antibody purification, and performing diagnostic performance analysis on the purified antibody.
TABLE 1 first subclone affinity assay table
Experimental parameters (IN): GAM-HRP 1/3W TMB 22min
Experimental parameters (CAP): biotin 1/24W, SA-HRP 1/3W, TMB 17min
Experimental results: selecting a cell strain with high affinity and good cell fluctuation for secondary subcloning.
TABLE 2 second subclone affinity assay table
6 monoclonal cells are obtained, and 1E12F1,1E9A1,2H12E7 three cells are selected for production: 3×t175.
EXAMPLE 5 monoclonal antibody Performance analysis
The kit is prepared based on the principle of a double antibody sandwich method and an acridine ester luminescence method.
1. Carboxyl magnetic bead coated antibody
Fully and uniformly mixing purchased carboxyl magnetic beads, taking out a corresponding amount of magnetic beads, placing the magnetic beads into a centrifuge tube, removing supernatant by using a magnetic rack, cleaning, adding coating activating solution, uniformly mixing, adding EDC dissolved by the coating activating solution, fully and uniformly mixing, and performing reverse activation for 0.5-1h at room temperature;
ultrasonic dispersing magnetic beads, cleaning for three times by using coating activating solution, adding the coating antibody of the invention, fully mixing uniformly, and then reversing the reaction at room temperature for 1-2h;
dispersing magnetic beads by ultrasonic, adding a sealing agent, fully and uniformly mixing, and sealing for 1-2h at room temperature in a reverse way;
and (3) ultrasonically dispersing the magnetic beads, removing the supernatant by using a magnetic frame, cleaning for three times, and adding a magnetic bead preservation solution to dilute the magnetic beads to the concentration of 0.23mg/mL for later use.
The formula of the magnetic bead preservation solution is 50mM Tris, 0.2% Tween-20, 0.85% NaCl, 2% BSA and 0.2% Proclin-300.
2. Acridinium ester labeled antibody
NHS esterified acridinium ester (NSP-DMAE-NHS) was used in a molecular molar ratio of 10 to the detection antibody of the present invention: 1 in 1 XPBS, and mixing and labeling for 1-2h;
transferring the marking liquid into a 14kD dialysis bag after the reaction is finished, performing rotary dialysis in 1 XPBS, and changing the liquid for 6 times, wherein each time is 1-2 hours;
and (3) taking out the marking liquid after dialysis overnight, testing the protein content in the marking liquid by using a spectrophotometer, calculating and adding a protective liquid, fully and uniformly mixing, and then placing the mixture at 20-22 ℃ for preservation, and diluting the protein concentration to 0.5ug/mL for later use by using the marking preservation liquid during on-machine testing.
The formulation of the label stock solution was 0.1M MES, 0.2% Tween-20, 0.85% NaCl, 2% BSA, and 0.2% Proclin-300.
3. Preparing calibration product and quality control product
PRL antigens were diluted to 0, 0.2, 1,2, 10, 20, 100, 200, 1000 ng/mL, respectively, using antigen dilutions, and dispensed into calibrator tubes.
And (3) diluting the PRL antigen by using an antigen diluent to 20 and 100 ng/mL respectively, and subpackaging into quality control product tubes.
The antigen diluent formulation was 1 XPBS (phosphate buffered saline) and 1% BSA (bovine serum albumin).
The detection kit is compared with the similar products:
the correlation between the PRL chemiluminescent detection kit in the examples and the Beckmann company product is compared on 120 clinical specimens, and the data are shown in figure 1. Correlation coefficient R 2 0.991. The kit provided by the invention can accurately detect the PRL content, provides a basis for clinical diagnosis, and can fully meet the clinical in-vitro diagnosis detection requirement.
Detection kit sensitivity and precision investigation:
the blank and detection limits of the kit of the invention were studied according to the clinical and laboratory standards institute sensitivity verification analysis guideline file CLSI: EP17-A2, and the results showed that the blank and detection limits were 0.1 ng/mL and 0.2 ng/mL, respectively.
According to the precision verification analysis guideline file CLSI of the clinical and laboratory standards institute, EP5-A3 carries out precision research on the kit, 3 batches of reagents and calibrators are used for detecting 2 levels of quality control products, each time of detection is carried out twice a day in the morning and afternoon, continuous investigation is carried out for 5 days, and the result shows that the total indoor precision of each batch is less than 5%.
And (3) analyzing the anti-interference capability of the detection kit:
different concentrations of interferents were added to two serum samples at PRL concentrations of approximately 20 ng/mL and 100 ng/mL, respectively, and the maximum concentration levels (no more than the clinically visible maximum concentration) of the different interferents were studied with the non-added group as a control, and with the relative deviation of both the added group and the control group of less than 5% as interference acceptable criteria.
Table 3 assay data for anti-tamper capability of test kits
The results show that the concentration in Table 3 does not significantly interfere with the detection results.
Finally, it should be noted that: the foregoing description is only a preferred embodiment of the present invention, and the present invention is not limited thereto, but it is to be understood that modifications and equivalents of some of the technical features described in the foregoing embodiments may be made by those skilled in the art, although the present invention has been described in detail with reference to the foregoing embodiments. Any modification, equivalent replacement, improvement, etc. made within the spirit and principle of the present invention should be included in the protection scope of the present invention.

Claims (5)

1. A monoclonal antibody against prolactin, characterized in that: the monoclonal antibody is PRL-Clone1,
the amino acid sequence of the heavy chain variable region of the PRL-Clone1 is shown as SEQ ID NO.1, and the amino acid sequence of the light chain variable region of the PRL-Clone1 is shown as SEQ ID NO. 2.
2. Use of the anti-prolactin monoclonal antibody according to claim 1 for the preparation of an immunodiagnostic reagent for diagnosing elevated prolactin-induced endocrine dyscrasia.
3. Use of a monoclonal antibody against prolactin according to claim 2 for the preparation of an immunodiagnostic reagent for diagnosing endocrine dyscrasia caused by elevated prolactin, characterized in that: monoclonal antibodies were used in PRL chemiluminescent kits.
4. PRL chemiluminescence kit, characterized in that: a PRL-Clone1 according to claim 1.
5. The PRL chemiluminescent kit of claim 4 wherein: the kit used PRL-Clone1 as the detection antibody.
CN202311579376.8A 2023-11-24 2023-11-24 Anti-prolactin monoclonal antibody and application thereof Active CN117285625B (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN202311579376.8A CN117285625B (en) 2023-11-24 2023-11-24 Anti-prolactin monoclonal antibody and application thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN202311579376.8A CN117285625B (en) 2023-11-24 2023-11-24 Anti-prolactin monoclonal antibody and application thereof

Publications (2)

Publication Number Publication Date
CN117285625A CN117285625A (en) 2023-12-26
CN117285625B true CN117285625B (en) 2024-01-23

Family

ID=89244748

Family Applications (1)

Application Number Title Priority Date Filing Date
CN202311579376.8A Active CN117285625B (en) 2023-11-24 2023-11-24 Anti-prolactin monoclonal antibody and application thereof

Country Status (1)

Country Link
CN (1) CN117285625B (en)

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102250244A (en) * 2011-07-07 2011-11-23 南京医科大学 Human prolactin receptor antibody and application thereof
CN102426250A (en) * 2011-08-31 2012-04-25 内蒙古科慧生物科技有限责任公司 Prolactin (PRL) quantitative determination kit and detection method thereof
AU2013202084A1 (en) * 2006-08-18 2013-04-18 Novartis Ag PRLR-specific antibody and uses thereof
CN112175925A (en) * 2020-10-12 2021-01-05 南京佰抗生物科技有限公司 PIVKA-II epitope peptide, anti-PIVKA-II monoclonal antibody and application thereof

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2332995A1 (en) * 2009-12-10 2011-06-15 Bayer Schering Pharma Aktiengesellschaft Neutralizing prolactin receptor antibodies and their therapeutic use

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2013202084A1 (en) * 2006-08-18 2013-04-18 Novartis Ag PRLR-specific antibody and uses thereof
CN102250244A (en) * 2011-07-07 2011-11-23 南京医科大学 Human prolactin receptor antibody and application thereof
CN102426250A (en) * 2011-08-31 2012-04-25 内蒙古科慧生物科技有限责任公司 Prolactin (PRL) quantitative determination kit and detection method thereof
CN112175925A (en) * 2020-10-12 2021-01-05 南京佰抗生物科技有限公司 PIVKA-II epitope peptide, anti-PIVKA-II monoclonal antibody and application thereof

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
Development of a new anti-prolactin receptor (PRLR) antibody, F56, which can serve as a PRLR antagonist;Huanzhong cui 等;《International Journal of Biological Macromolecules》;第95卷;第1223-1227页 *
人泌乳素单克隆抗体制备及其临床应用研究;佟志刚等;《标记免疫分析与临床》(第2期);第97页 *

Also Published As

Publication number Publication date
CN117285625A (en) 2023-12-26

Similar Documents

Publication Publication Date Title
CN109975536B (en) Anti-mullerian hormone latex enhanced turbidimetry detection kit and preparation and use methods thereof
CN109580959B (en) ELISA kit for detecting heparin-binding epidermal growth factor
CN107523552B (en) Hybridoma cell strain secreting anti-AMH monoclonal antibody, anti-AMH monoclonal antibody and application
CN111273042A (en) Anti mullerian tube hormone detect reagent box
CN116874597B (en) Monoclonal antibody of mouse anti-human vascular endothelial growth factor and application
CN110763839A (en) TIMP-I latex enhanced turbidimetry detection kit and preparation and use methods thereof
CN117003878B (en) Monoclonal antibody for resisting sFLT-1 protein and application thereof
CN109721651B (en) Retinol binding protein detection kit and clinical application thereof
CN113801226A (en) Anti-human PlGF (platelet-derived growth factor) mouse-derived monoclonal antibody and application thereof
CN116874596B (en) Monoclonal antibody of anti S100 beta protein, preparation method and application thereof
CN117285625B (en) Anti-prolactin monoclonal antibody and application thereof
CN106093431B (en) Human calcitonin original collaurum quantitative test card
CN116284338A (en) Preparation method of recombinant human apolipoprotein ApoE and polyclonal antibody thereof
CN117003869B (en) anti-IL-10 protein monoclonal antibody composition and application
CN106967689B (en) sH2a monoclonal antibody hybridoma cell, monoclonal antibody and application thereof
CN112358546B (en) Hybridoma cell strain 9C1, PLGF-1 monoclonal antibody and application thereof
CN117285635B (en) Monoclonal antibody composition for resisting heparin binding protein and application thereof
CN113817686B (en) Hybridoma cell strain, monoclonal antibody secreted by hybridoma cell strain and application of hybridoma cell strain
CN113956360A (en) CHI3L1 monoclonal antibody and preparation method and application thereof
CN109725159B (en) Human beta2Quantitative detection test paper card of microglobulin and clinical application
CN113150157A (en) Antibody pair for detecting VEGF content in serum and application thereof
CN114213534B (en) Anti-human PlGF (platelet-derived growth factor) murine monoclonal antibody and application thereof
CN111273028A (en) rhTSG-6 direct competition ELISA quantitative detection kit and use method and application thereof
CN117143242B (en) Monoclonal antibody composition for resisting Galectin-3 protein and application thereof
CN113912719B (en) Monoclonal antibody for detecting mouse interleukin 6 and preparation method and application thereof

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
GR01 Patent grant
GR01 Patent grant