CN117247451B - Single-domain antibody for human interleukin 6 protein and application thereof - Google Patents

Single-domain antibody for human interleukin 6 protein and application thereof Download PDF

Info

Publication number
CN117247451B
CN117247451B CN202311532996.6A CN202311532996A CN117247451B CN 117247451 B CN117247451 B CN 117247451B CN 202311532996 A CN202311532996 A CN 202311532996A CN 117247451 B CN117247451 B CN 117247451B
Authority
CN
China
Prior art keywords
single domain
domain antibody
antibody
host cell
protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
CN202311532996.6A
Other languages
Chinese (zh)
Other versions
CN117247451A (en
Inventor
李开通
王晶
姜志洋
王志宏
胡乃静
肖鹤
李新颖
乔春霞
陈国江
罗龙龙
刘成华
冯健男
沈倍奋
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Academy of Military Medical Sciences AMMS of PLA
Original Assignee
Academy of Military Medical Sciences AMMS of PLA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Academy of Military Medical Sciences AMMS of PLA filed Critical Academy of Military Medical Sciences AMMS of PLA
Priority to CN202311532996.6A priority Critical patent/CN117247451B/en
Publication of CN117247451A publication Critical patent/CN117247451A/en
Application granted granted Critical
Publication of CN117247451B publication Critical patent/CN117247451B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244—Interleukins [IL]
    • C07K16/248—IL-6
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00—Drugs for disorders of the urinary system
    • A61P13/12—Drugs for disorders of the urinary system of the kidneys
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/06—Antipsoriatics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6863—Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
    • G01N33/6869—Interleukin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/52—Assays involving cytokines
    • G01N2333/54—Interleukins [IL]
    • G01N2333/5412—IL-6

Abstract

The invention discloses a single domain antibody aiming at human interleukin 6 protein and application thereof, wherein the single domain antibody can specifically bind human IL-6 protein, has higher affinity and specificity, can effectively block the interaction between human IL-6 protein and human IL-6R, can be used as a candidate medicine for treating various diseases related to IL-6 unbalance, and has important application prospect in the fields of diagnosis and treatment of diseases related to IL-6 unbalance.

Description

Single-domain antibody for human interleukin 6 protein and application thereof
Technical Field
The invention belongs to the fields of cell immunology and genetic engineering, and particularly relates to a single domain antibody aiming at human interleukin 6 protein and application thereof.
Background
Interleukin-6 (IL-6) is a pleiotropic cytokine involved in many physiological and pathological processes in the body. Abnormal activation and dysfunction of the IL-6 signaling pathway are closely related to various diseases, such as autoimmune diseases, chronic inflammation, malignant tumors, and the like. In addition, the aberrant expression of IL-6 plays an important role in the novel coronavirus infection (COVID-19) Cytokine Storm Syndrome (CSS). Unlike common receptor molecules such as IL-6R or gp130, therapeutic monoclonal antibodies that block IL-6 proteins have higher specificity. Only 1 type of monoclonal antibody drug targeting IL-6 protein is approved by FDA and NMPA in the united states (SYLVANT, injectable cetuximab) and more than 8 therapeutic monoclonal antibodies are in clinical study. Injectable stethoximab is currently only approved for the treatment of Human Immunodeficiency Virus (HIV) negative and human herpesvirus type 8 (HHV-8) negative Multicenter Castleman Disease (MCD) adult patients. In clinical studies, therapeutic monoclonal antibodies targeting IL-6 protein have been shown in part to have unique therapeutic characteristics and beneficial effects (Clazakizumab for advanced antibody mediated rejection, dober K, et al, JASN, 2021, 32 (3): 708-722; ziltivekimab for atherosclerosis in high risk chronic kidney disease patients (CKD), ridker P M, et al, the Lancet, 2021, 397 (10289): 2060-2069).
The development of high affinity antibody drugs targeting IL-6 may be useful in the treatment of various diseases associated with aberrant activation and dysfunction of the IL-6 signaling pathway, such as autoimmune diseases, chronic inflammation, malignant tumors, cytokine Storm Syndrome (CSS), and the like, and thus may have very broad potential therapeutic effects and commercial prospects. In view of this, the present invention provides a novel single domain antibody against human interleukin 6 protein.
Disclosure of Invention
The invention aims at providing a single domain antibody aiming at human interleukin 6 protein and application thereof.
In order to achieve the above purpose, the present invention adopts the following technical scheme:
in a first aspect, the invention provides an anti IL-6 single domain antibody.
Further, the single domain antibody comprises complementarity determining regions CDR1, CDR2, CDR3 in the heavy chain variable region as shown in SEQ ID NO. 4.
Further, the amino acid sequences of the CDR1, the CDR2 and the CDR3 are respectively shown as SEQ ID NO. 1, SEQ ID NO. 2 and SEQ ID NO. 3.
In some embodiments, amino acid sequences having at least 70% or more sequence homology to the amino acid sequences corresponding to CDR1, CDR2, CDR3 of the present invention, including those obtained by one or more amino acid or nucleotide deletion, insertion or substitution mutations of the parent sequence (the sequence corresponding to the single domain antibody provided herein or CDR1, CDR2, CDR3 sequence), are also within the scope of the present invention.
In some embodiments, the amino acid sequences corresponding to CDR1, CDR2 and CDR3 of the present invention are not limited to the amino acid sequences shown in SEQ ID NO. 1, SEQ ID NO. 2 and SEQ ID NO. 3, and any CDR numbering scheme (existing CDR numbering scheme or new CDR numbering scheme generated in the future) is used to define CDR1, CDR2 and CDR3 in the heavy chain variable region shown in SEQ ID NO. 4, so that the amino acid sequences or nucleotide sequences corresponding to CDR1, CDR2 and CDR3 are all within the scope of the present invention.
In some embodiments, the CDR1, CDR2, CDR3 are defined according to any one of IMGT numbering scheme, chothia numbering scheme, kabat numbering scheme, martin (enhanced Chothia) numbering scheme, abM numbering scheme, aho numbering scheme, contact numbering scheme or any combination of multiple (two or more) thereof, and the sequences corresponding to the CDR1, CDR2, CDR3 defined by the above definition are also included in the scope of the present invention.
Wherein, the amino acid sequences corresponding to CDR1, CDR2 and CDR3 are respectively defined as follows according to the IMGT numbering scheme: GSTVTRYYA (SEQ ID NO: 6), ISRYGYRT (SEQ ID NO: 7), AADSYVRVYVKNDSGQRRHRLSFYRRDVRDYDY (SEQ ID NO: 8).
Wherein, the amino acid sequences corresponding to CDR1, CDR2 and CDR3 are respectively defined as follows according to the Chothia numbering scheme: GSTVTRYY (SEQ ID NO: 9), SRYGYR (SEQ ID NO: 10), DSYVRVYVKNDSGQRRHRLSFYRRDVRDYDY (SEQ ID NO: 11).
Wherein, the amino acid sequences corresponding to CDR1, CDR2 and CDR3 are respectively defined as follows according to the Kabat numbering scheme: RYAMG (SEQ ID NO: 12), AISRYGYRTNYADSVKG (SEQ ID NO: 13), DSYVRVYVKNDSGQRRHRLSFYRRDVRDYDY (SEQ ID NO: 14).
In a second aspect of the invention there is provided an isolated polynucleotide.
Further, the polynucleotide encodes a single domain antibody according to the first aspect of the invention.
In a specific embodiment of the invention, the nucleotide sequence of the polynucleotide encoding the single domain antibody according to the first aspect of the invention is shown in SEQ ID NO. 5.
In some embodiments, the nucleic acid molecule is isolated or purified. The sequence of the nucleic acid molecule may be obtained using conventional techniques or using hybridoma techniques. Once the relevant sequences are obtained, recombinant methods can be used to obtain the relevant sequences in large quantities. This is usually done by cloning it into a vector, transferring it into a cell, and isolating the relevant sequence from the propagated host cell by conventional methods. Furthermore, the sequences concerned, in particular fragments of short length, can also be synthesized by artificial synthesis. Generally, fragments of longer sequence are obtained by first synthesizing a plurality of small fragments and then ligating them.
In a third aspect of the invention, there is provided an expression vector.
Further, the expression vector comprises a polynucleotide according to the second aspect of the invention.
In some embodiments, vectors useful in the present invention include plasmids, expression vectors, cloning vectors, viral vectors, and the like. Various vectors known in the art may be used. For example, a commercially available vector is selected, and the nucleotide sequence encoding the single domain antibody of the present invention is operably linked to an expression control sequence to form an expression vector.
Further, the expression vectors contain expression regulatory sequences, such as transcription and translation initiation and termination codons, which are specific to the type of host cell (e.g., bacterial, fungal, plant or animal) into which the vector is to be introduced, as the case may be and considering whether the vector is DNA-based or RNA-based. Recombinant expression vectors may contain restriction sites to facilitate cloning.
Further, the expression vector may comprise one or more marker genes that allow selection of transformed or transfected host cells. Marker genes include biocide resistance (e.g., resistance to antibiotics, heavy metals, etc.); complementation of prototrophy is provided in an auxotrophic host, and the like. Suitable marker genes for use in the expression vectors of the present invention include, for example, a neomycin/G418 resistance gene, a hygromycin resistance gene, an histidinol resistance gene, a tetracycline resistance gene, an ampicillin resistance gene, a kanamycin resistance gene, a puromycin resistance gene, and the like.
In a fourth aspect the invention provides an engineered host cell.
Further, the engineered host cell comprises the polynucleotide of the second aspect of the invention or the expression vector of the third aspect of the invention.
In some embodiments, the host cell includes a prokaryotic cell and a eukaryotic cell. Examples of commonly used prokaryotic host cells include E.coli, bacillus subtilis, and the like. Host cells for expressing the antibodies include E.coli, yeast cells, insect cells, COS cells, CHO cells, and the like. Preferably, the host cell is a eukaryotic cell, more preferably a mammalian cell, most preferably a HEK-293T cell or a CHO cell.
Further, the engineered host cell is prepared by the following method: introducing the polynucleotide or expression vector described above into a host cell, wherein the method of introducing comprises a physical method, a chemical method, or a biological method. The physical method comprises calcium phosphate precipitation, lipid transfection, particle bombardment, microinjection and electroporation; the chemical method comprises a colloid dispersion system and a lipid-based system; the colloid dispersion system comprises macromolecular complexes, nanocapsules, microspheres and beads; the lipid-based system includes oil-in-water emulsions, micelles, mixed micelles, and liposomes; the biological method comprises a DNA vector, an RNA vector, a lentiviral vector, a poxviral vector, a herpes simplex viral vector, an adenovirus vector and an adeno-associated viral vector.
Further, the methods of introducing the nucleic acid molecules or vectors described above may be introduced into host cells by a variety of suitable means, and are not limited to the methods exemplified in the present invention, such as calcium phosphate transfection, DEAE-dextran mediated transfection, microinjection, electroporation, TALEN methods, ZFN methods, non-viral vector-mediated transfection (e.g., liposomes) or viral vector-mediated transfection (e.g., lentiviral infection, retroviral infection, adenoviral infection), and other physical, chemical or biological means for transferring into cells, such as transposon technology, CRISPR-Cas9, and the like.
In a fifth aspect, the invention provides a detection reagent or detection product for detecting IL-6.
Further, the detection reagent comprises the single domain antibody of the first aspect of the invention, the detection product comprises the detection reagent, and the detection product comprises a kit, a test strip and a chip.
Further, the detection reagent comprises a conjugate, the conjugate or conjugate comprising:
(1) The single domain antibody of the first aspect of the invention;
(2) A diagnostic agent coupled or conjugated to the single domain antibody.
In some embodiments, the diagnostic agent comprises a radionuclide, a contrast agent, a fluorescent agent, a chemiluminescent agent, a bioluminescent agent, a paramagnetic ion, an enzyme, a photoactive diagnostic agent.
Among the paramagnetic ions that can be used in the present invention include chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III) and erbium (III); fluorescent agents useful in the present invention include fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde, fluorescamine; chemiluminescent agents useful in the present invention include luminol, isoluminol, aromatic acridinium esters, imidazoles, acridinium salts, oxalic esters; bioluminescent agents useful in the present invention include luciferin, luciferase, aequorin; enzymes useful in the present invention include horseradish peroxidase, alkaline phosphatase, glucose oxidase, beta-D-galactosidase, urease, catalase, and glucoamylase.
In some embodiments, specific examples of the detection product include a kit. The kit also comprises a solid phase carrier, and the single domain antibody is fixed on the solid phase carrier (such as a porous plate, a cover glass and microbeads) or exists in a free mode.
In a sixth aspect, the invention provides a pharmaceutical composition.
Further, the pharmaceutical composition comprises a single domain antibody according to the first aspect of the invention.
Further, the pharmaceutical composition further comprises a therapeutic agent coupled or conjugated to the single domain antibody.
Further, the pharmaceutical composition also comprises pharmaceutically acceptable carriers and/or auxiliary materials.
In some embodiments, the therapeutic agent comprises a cytotoxin, a drug, a radionuclide. Wherein the cytotoxin, drug or radionuclide can be used to treat and/or assist in the treatment of diseases or symptoms associated with IL-6 imbalance.
In some embodiments, the pharmaceutically acceptable carrier and/or adjuvant is described in detail in Remington's Pharmaceutical Sciences (19 th ed., 1995), and when a pharmaceutical composition is used, it is intended that a safe and effective amount of the pharmaceutical composition of the present invention is administered to a human. The dosage and mode of administration of the pharmaceutical composition is not particularly limited, and the skilled practitioner will generally be able to readily determine the prescription and dosage of the prescription for the desired treatment and/or prophylaxis, for example, by injection or other means of treatment.
A seventh aspect of the invention provides any of the following methods, the method comprising:
(1) A method of making a single domain antibody of the first aspect of the invention, the method comprising the steps of: culturing the engineered host cell according to the fourth aspect of the invention, and separating and purifying the product of the host cell culture to obtain the single domain antibody according to the first aspect of the invention;
(2) A method of making an engineered host cell according to the fourth aspect of the invention, the method comprising the steps of: introducing a polynucleotide according to the second aspect of the invention or an expression vector according to the third aspect of the invention into a host cell to obtain an engineered host cell according to the fourth aspect of the invention;
(3) A method of inhibiting IL-6 binding to IL-6R in vitro, comprising the steps of: introducing the single domain antibody of the first aspect of the invention into a cell of an organism, and inhibiting the binding of IL-6 to IL-6R by expressing the single domain antibody of the first aspect of the invention;
(4) A method for non-diagnostic and non-therapeutic destination detection of IL-6 protein, the method comprising the steps of: contacting a sample to be tested with the single-domain antibody according to the first aspect of the invention, the detection reagent according to the fifth aspect of the invention or the detection product, and detecting the formation of an immune complex of IL-6 protein and the single-domain antibody.
In some embodiments, the invention is not particularly limited to samples to be tested derived from clinical samples of subjects in need thereof, including but not limited to: cells, tissues, body fluids, for example: skin; mucous membrane; blood; blood derivatives such as serum; extracting bile; tissue biopsied or surgically removed, including, for example, tissue that is unfixed, frozen, fixed in formalin and/or embedded in paraffin; tear fluid; milk; dander; a surface cleaning liquid; urine; sputum; cerebrospinal fluid; prostatic fluid; pus is formed; bone marrow aspirate; middle ear exudates; bronchoalveolar lavage; sputum or saliva.
An eighth aspect of the invention provides any one of the following applications, the applications comprising:
(1) Use of a single domain antibody according to the first aspect of the invention, a polynucleotide according to the second aspect of the invention, an expression vector according to the third aspect of the invention and/or an engineered host cell according to the fourth aspect of the invention for the preparation of a detection reagent for the detection of IL-6;
(2) Use of a single domain antibody according to the first aspect of the invention, a polynucleotide according to the second aspect of the invention, an expression vector according to the third aspect of the invention and/or an engineered host cell according to the fourth aspect of the invention in the preparation of a detection product for the detection of IL-6;
(3) Use of a single domain antibody according to the first aspect of the invention, a polynucleotide according to the second aspect of the invention, an expression vector according to the third aspect of the invention, an engineered host cell according to the fourth aspect of the invention and/or a detection reagent or detection product according to the fifth aspect of the invention for the preparation of a product for the diagnosis and/or for the assisted diagnosis of a disease associated with IL-6 imbalance;
(4) Use of a single domain antibody according to the first aspect of the invention, a polynucleotide according to the second aspect of the invention, an expression vector according to the third aspect of the invention, an engineered host cell according to the fourth aspect of the invention and/or a detection reagent or detection product according to the fifth aspect of the invention for detection of IL-6 protein in non-diagnostic and non-therapeutic destinations;
(5) Use of a single domain antibody according to the first aspect of the invention, a polynucleotide according to the second aspect of the invention, an expression vector according to the third aspect of the invention and/or an engineered host cell according to the fourth aspect of the invention for the preparation of a pharmaceutical composition for the treatment and/or prevention of a disease associated with IL-6 imbalance;
(6) Use of a single domain antibody according to the first aspect of the invention, a polynucleotide according to the second aspect of the invention, an expression vector according to the third aspect of the invention, an engineered host cell according to the fourth aspect of the invention and/or a pharmaceutical composition according to the sixth aspect of the invention for the preparation of a biological agent for the treatment and/or prevention of a disease associated with IL-6 imbalance.
Furthermore, the present invention provides a method for diagnosing and/or aiding in the diagnosis of a disease associated with IL-6 imbalance, said method comprising the steps of: the single domain antibody according to the first aspect of the invention, the polynucleotide according to the second aspect of the invention, the expression vector according to the third aspect of the invention, the engineered host cell according to the fourth aspect of the invention and/or the detection reagent or detection product according to the fifth aspect of the invention are used for detecting a test sample derived from a subject, and detecting the presence of IL-6 protein in the test sample by an antigen-antibody reaction to diagnose and/or aid in diagnosing whether the subject has a disease associated with IL-6 imbalance and/or a risk of having a disease associated with IL-6 imbalance.
Furthermore, the present invention provides a method for treating and/or preventing a disease associated with IL-6 imbalance, the method comprising the steps of: administering to a subject in need thereof a therapeutically and/or prophylactically effective amount of a single domain antibody according to the first aspect of the invention and/or a pharmaceutical composition according to the sixth aspect of the invention.
In the present invention, the diseases associated with IL-6 imbalance include, but are not limited to: autoimmune diseases (e.g., systemic lupus erythematosus, multiple sclerosis, kalman's disease, igM gamma-globulinepathy, cardiac myxoma, asthma, autoimmune insulin-dependent diabetes mellitus), chronic inflammation (e.g., rheumatoid arthritis, systemic onset juvenile idiopathic arthritis, gao Bingqiu proteomia, crohn's disease, ulcerative colitis), malignant tumors (e.g., multiple myeloma, renal cell carcinoma, plasma cell leukemia, lymphoma, B-lymphoproliferative disorders, prostate cancer), cytokine Storm Syndrome (CSS), sepsis, osteoporosis, cachexia, psoriasis, mesangial proliferative glomerulonephritis, kaposi's sarcoma, AIDS-related lymphomas, and the like, and various conditions or diseases caused by IL-6 imbalance are within the scope of the present invention.
In the present invention, a therapeutically and/or prophylactically effective amount refers to an amount of a single domain antibody, pharmaceutical composition and/or biological agent described herein that is effective to inhibit, prevent, retard or treat symptoms of a particular disease, disorder or side-effect. Such diseases, disorders and side effects include, but are not limited to, those pathological conditions associated with IL-6 imbalance, wherein treatment or prevention includes inhibiting the activity of a cell, tissue or receptor, for example, by contacting it with a single domain antibody, pharmaceutical composition and/or biological agent of the invention. The therapeutically effective amount may vary depending on the route and dosage form of administration, the age and weight of the subject and/or the disease or condition being treated.
In the present invention, the subject includes humans and non-human animals. Non-human animals include all vertebrates (mammals and non-mammals) such as non-human primates (e.g., cynomolgus monkeys), sheep, dogs, cows, chickens, amphibians, and reptiles. In a preferred embodiment, the subject is a human.
Compared with the prior art, the invention has the following advantages and beneficial effects:
the invention provides a brand-new single domain antibody 3A5 aiming at human interleukin 6 (hIL-6) protein, and experiments prove that the single domain antibody 3A5 can specifically bind hIL-6, has higher affinity and specificity, can effectively block the interaction between hIL-6 and hIL-6R, can be used as a candidate medicament for treating various diseases related to IL-6 imbalance, and has important application prospect in the fields of diagnosis and treatment of diseases related to IL-6 imbalance.
Drawings
FIG. 1 is an SDS-PAGE electrophoresis of antibody 3A5 (reduction), wherein, from left to right, lane 1: protein molecular weight Marker; lane 2: a fermentation broth; lane 3: loading and flowing through liquid; lane 4: 3A5 after purification;
FIG. 2 is a graph showing the results of ELISA detection of antibody 3A5, siltuximab (stetuximab) affinity;
FIG. 3 is a graph showing the results of antibody 3A5 inhibiting the binding of human IL-6 to human IL-6R;
FIG. 4 is a graph showing the results of the specificity of binding of antibody 3A5 to IL-6.
Detailed Description
The inventor of the invention has studied extensively and intensively, the whole human single domain antibody library (VHH antibody library) constructed by means of computer aided molecular design, a single domain antibody 3A5 aiming at human interleukin 6 (hIL-6) protein is found for the first time by screening by utilizing phage display technology, the single domain antibody 3A5 is found to be capable of specifically binding hIL-6 and has higher affinity and specificity through experimental verification, in addition, the binding of hIL-6 and hIL-6R can be effectively inhibited, and the variable region of the single domain antibody 3A5 is provided with 3 complementarity determining regions CDR1, CDR2 and CDR3, wherein the amino acid sequence of CDR1 is shown as SEQ ID NO:1, the amino acid sequence of CDR2 is shown as SEQ ID NO:2, and the amino acid sequence of CDR3 is shown as SEQ ID NO: 3. In order to facilitate an understanding of the present invention, the following terms referred to in the present invention are explained herein:
as used herein, the terms "single domain antibody" and "VHH" have the same meaning and are used interchangeably to refer to an artificially designed antibody molecule, also known as single-domain antibodies (sdAbs), VHH antibodies or camelid antibodies, which are heavy chain antibodies (HCAbs) found in alpaca, alpaca and the like camelids and in cartilaginous fish such as sharks, rays and the like, which naturally lack a light chain. In 1993 belgium scientists found a heavy chain antibody with a native light chain deletion in the serum of camels, with a molecular weight of about 95 kDa, comprising two constant regions (CH 2 and CH 3), one hinge region and one heavy chain variable region (variable heavy chain domain, VHH), followed by cloning to obtain a single domain antibody comprising only one heavy chain variable region, i.e. a VHH antibody. The crystal structure of VHH antibodies is 4 nm ×2.5 nm ×3 nm oval, with a molecular weight of only 1/10 of that of conventional antibodies, about 12-14 kDa, being the smallest complete antigen binding fragment, and therefore also known as nanobodies.
Single-domain antibodies (VHH) have the same domains as the common antibody VH, namely 4 conserved framework regions (FR 1/2/3/4) and 3 complementarity determining regions (CDR 1/2/3). There are four highly conserved hydrophobic amino acid residues (V42, G49, L50 and W52) within FR2 in VH of common antibodies, whereas in VHH antibodies these four amino acids are replaced with hydrophilic amino acid residues (F42 or Y42, E49, R50 and G52), thus increasing the water solubility of single domain antibodies. In addition, CDR3 of a single domain antibody is longer than CDR3 of a general antibody, and a convex structure can be formed, thereby enhancing the ability to recognize a hidden epitope.
As used herein, the term "humanized antibody" refers to an antibody obtained by fusing the heavy chain variable region of a target antibody (e.g., an animal antibody) with the constant region of a human antibody, or an antibody obtained by grafting the complementarity determining regions (CDR 1-3 sequences) of a target antibody into the variable region of a human antibody, or an antibody obtained by subjecting a target antibody to amino acid mutation according to the characteristics of the framework region (FR 1-4) of a human antibody. Humanized antibodies can be synthesized or site-directed mutagenesis. Humanized antibodies can be prepared in the art using conventional methods well known to those skilled in the art.
In the present invention, a single domain antibody against hIL-6 protein can also be obtained based on a sequence having high sequence homology with CDR1-3 of the single domain antibody 3A5 disclosed in the present invention. In some embodiments, sequences having "at least 70% homology", "at least 75% homology", "at least 80% homology", "at least 85% homology", "at least 86% homology", "at least 87% homology", "at least 88% homology", "at least 89% homology", "at least 90% homology", "at least 91% homology", "at least 92% homology", "at least 93% homology", "at least 94% homology", "at least 95% homology", "at least 96% homology", "at least 97% homology", "at least 98% homology" or "at least 99% homology" to the sequence of CDR1-3 corresponding to SEQ ID NO. 1-3, or the sequence of single domain antibody 3A5 corresponding to SEQ ID NO. 4 may be used for the purposes of the present invention, and the corresponding single domain antibodies are also included in the scope of the present invention.
In some embodiments, the invention may also be achieved by replacing only one or a few amino acid substitutions, e.g., comprising 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 conservative amino acid substitutions, as compared to the sequence of CDR1-3 corresponding to SEQ ID NO:1-3, the sequence of single domain antibody 3A5 corresponding to SEQ ID NO: 4. In fact, in determining the degree of sequence homology between two amino acid sequences or in determining the CDR1, CDR2 and CDR3 combinations in a single domain antibody, one skilled in the art can consider so-called "conservative" amino acid substitutions, which in the case of substitution will preferably be conservative amino acid substitutions, which can generally be described as amino acid substitutions of an amino acid residue with another amino acid residue having a similar chemical structure, and which have little or no effect on the function, activity or other biological properties of the polypeptide. Such conservative amino acid substitutions are common in the art, e.g., conservative amino acid substitutions are those in which one or a few amino acids in the following groups (a) - (d) are substituted for another or a few amino acids in the same group: (a) a polar negatively charged residue and an uncharged amide thereof: asp, asn, glu, gln; (b) a polar positively charged residue: his, arg, lys; (c) aromatic residues: phe, trp, tyr; (d) aliphatic nonpolar or low polar residues: ala, ser, thr, gly, pro, met, leu, ile, val, cys. Particularly preferred conservative amino acid substitutions are as follows: asp is substituted with Glu; asn is substituted with Gln or His; glu is substituted with Asp; gln is substituted with Asn; his is substituted with Asn or Gln; arg is replaced by Lys; lys is substituted by Arg, gln; phe is replaced by Met, leu, tyr; trp is substituted with Tyr; tyr is substituted with Phe, trp; substitution of Ala with Gly or Ser; ser is substituted by Thr; thr is replaced by Ser; substitution of Gly with Ala or Pro; met is substituted with Leu, tyr or Ile; leu is substituted with Ile or Val; lie is substituted with Leu or Val; val is substituted with Ile or Leu; cys is replaced by Ser.
As used herein, the term "homology" refers to sequence similarity to an amino acid sequence or nucleotide sequence that needs to be aligned. "homology" includes amino acid sequences having 70% or more, or 75% or more, or 85% or more, or 90% or more, or 95% or more homology with the amino acid sequences provided herein. Homology can be assessed visually or by computer software. Using computer software, the identity between two or more sequences can be expressed in percent (%), which can be used to evaluate homology between related sequences. The 70% or more homology may be 70%, 75%, 80%, 85%, 90% or 95% or more homology.
As used herein, the term "kit" refers to a kit comprising the single domain antibody 3A5 of the invention. In some embodiments, the kit further comprises a container, instructions for use, buffers, and the like. In a preferred embodiment, the kit is a detection kit for detecting IL-6, which comprises a single domain antibody 3A5 specifically targeting the human IL-6 protein, a lysis medium for lysing a test sample derived from a subject, and reagents and buffers (e.g., various buffers, detection markers, detection substrates) required for detection, and may also be an in vitro diagnostic device.
As used herein, the term "isolated polynucleotide" refers to a polynucleotide that is naturally occurring in non-nature, including polynucleotides isolated from nature (including in vivo) by biological techniques, as well as synthetic polynucleotides. The isolated polynucleotide may be genomic DNA, cDNA, mRNA or other RNA synthesized, or a combination thereof. The present invention provides nucleotide sequences for encoding anti-human IL-6 single domain antibodies, it being noted that one skilled in the art can design nucleotide sequences which are not exactly identical to the nucleotide sequences provided above, but which all encode the same amino acid sequence, based on codon degeneracy, according to the amino acid sequences and the nucleotide sequences of the single domain antibodies provided by the present invention. Such modified nucleotide sequences are also included within the scope of the present invention.
The term "vector" as used herein when referring to a polynucleotide refers to any molecule (e.g., nucleic acid, plasmid, virus, etc.) used to transfer nucleotide coding information into a host cell. The term "expression vector" refers to a vector suitable for expressing a gene of interest (nucleotide sequence to be expressed) in a host cell, and generally includes portions of the gene of interest, promoters, terminators, marker genes, and the like.
As used herein, the term "host cell" refers to a cell that has been or is capable of being transformed with a nucleic acid sequence and thereby expressing a selected gene of interest. The term includes progeny of a parent cell, whether or not the progeny is identical in morphology or genetic composition to the original parent cell, as long as the progeny has the selected gene of interest present. Common host cells include, but are not limited to, bacteria, yeast, mammalian cells, and the like.
The invention is further illustrated below in conjunction with specific examples, which are provided solely to illustrate the invention and are not to be construed as limiting the invention. One of ordinary skill in the art can appreciate that: many changes, modifications, substitutions and variations may be made to the embodiments without departing from the spirit and principles of the invention, the scope of which is defined by the claims and their equivalents. The experimental procedure, in which no specific conditions are noted in the examples below, is generally carried out according to conventional conditions or according to the conditions recommended by the manufacturer.
Example 1 screening for Single Domain antibodies (VHH) against human interleukin 6 (hIL-6)
1. Experimental method
1.1 Construction of phage antibody library
The candidate antibodies were screened using phage display technology by means of a fully human single domain library (VHH library) constructed by computer aided molecular design.
(1) The displayed phage library adheres to human interleukin 6 protein;
(2) Repeatedly washing to remove nonspecific binding, eluting and collecting phage displaying binding human interleukin 6;
(3) E.coli was again infected and the monoclonal displayed on the phage surface and ELISA screening was performed to identify positive clones of human interleukin 6.
1.2 Determination and analysis of antibody Gene sequences
Positive clones were sent to Suzhou Jin Weizhi Biotechnology Co.Ltd for antibody gene sequencing and the sequencing results were retrieved and analyzed using DNAMAN and databases.
2. Experimental results
The humanized VHH antibody 3A5,3A5 which can specifically recognize human interleukin 6 is screened by the experimental method, the amino acid sequence is shown in the table 1, and the nucleotide sequence is shown as follows.
3A5 nucleotide sequence: CAAGTGCAGTTAGTGGAAAGCGGCGGTGGCTTAGTGCAAGCGGGCGGTAGCCTGCGCCTGAGCTGCGCGGCGAGCGGCAGCACCGTGACGCGCTACTATGCGATGGGCTGGTTCCGCCAAGCGCCGGGCAAAGAACGCGAATGGGTGGCGGCGATTAGCCGCTACGGCTACCGCACCAATTATGCGGATAGCGTGAAAGGCCGCTTTACCATTAGCCGCGATAATGCGAAAAACACCGTGTATCTGCAGATGAACAGCCTGAAACCGGAAGATACCGCGGTGTATTATTGCGCGGCGGATAGCTACGTGCGCGTGTATGTGAAAAATGATAGCGGCCAGCGCCGCCATCGCCTGAGCTTCTACCGCCGCGATGTGCGCGATTATGATTATTGGGGCCAAGGCACCCAAGTGACCGTGAGCAGC (SEQ ID NO: 5).
TABLE 1 amino acid sequence of humanized VHH antibody 3A5
EXAMPLE 2 preparation of VHH antibody 3A5 against IL-6 protein
1. Experimental method
(1) Amplifying the antibody 3A5 sequence by using a PCR method, and cloning the fragment into an expression vector by using a molecular cloning method (the expression vector comprises a human IgG1 Fc region sequence, and a G4SG4SG4SG4S flexible Linker is added between the C end of the 3A5 sequence and the human IgG1 Fc fragment);
(2) The expression vector is transfected into mammalian cells for expression. Collecting the expression supernatant, and purifying by using Protein A FF Protein column of GE company;
(3) Eluting with citric acid buffer solution with pH of 3.0, collecting the effluent, immediately neutralizing with 1 mol/L of TRIS-HCL buffer solution with pH of 8.5, dialyzing with PBS with pH of 7.2 and 0.01 mol/L for 72 h, and filtering with 0.22 μm filter membrane for sterilization;
(4) The expression and purification of the antibodies were detected by SDS-PAGE, and the concentration of the purified antibodies was detected by BCA method and stored at 4 ℃.
2. Experimental results
The SDS-PAGE result of antibody 3A5 is shown in FIG. 1, wherein lanes from left to right are as follows, lane 1: protein molecular weight Marker; lane 2: a fermentation broth; lane 3: loading and flowing through liquid; lane 4: after purification of 3A5, the above results indicate that the example successfully produced VHH antibody 3A5 against IL-6 protein.
EXAMPLE 3 ELISA detection of binding of antibody 3A5 to human IL-6
1. Experimental method
IL-6 was diluted to 0.5. Mu.g/mL, 100. Mu.L/well using carbonate buffer (Sigma Cat#C3041), coated at room temperature for 2 h at 500 rpm, plated 3 times, and incubated at room temperature for 1 h using SuperBlock (Thermo Fisher Scientific Inc., cat. # 37515) at 150. Mu.L/well, 750 rpm. After the elisa plate was dried, serial dilutions of 3A5 were added at concentrations ranging from 0.08 ng/mL to 7500 ng/mL,750 rpm, and incubated at room temperature for 1 h. After 6 washes, a 1:60000 dilution of Goat Anti-Human IgG HRP (SouthernBiotech Cat.# 2049-5) was added, and the reaction was stopped with dilute sulfuric acid after 6 washes with incubation at 750 rpm at room temperature for 1 h. OD450/630 nm dual wavelength detects the OD value. EC50 values were fit and calculated using SoftMax Pro software.
2. Experimental results
The results are shown in FIG. 2 and Table 2, and show that 3A5 has high affinity for binding to human IL-6 protein and affinity comparable to the commercially available anti-IL-6 antibody, siltuximab.
TABLE 2 affinity results for antibodies 3A5, siltuximab
Example 4 antibody 3A5 inhibits binding of human IL-6 to human IL-6R
1. Experimental method
IL-6 was diluted to 1. Mu.g/mL, 100. Mu.L/well using carbonate buffer (Sigma Cat#C3041), coated at room temperature for 2 h at 500 rpm, and incubated at room temperature for 1 h using SuperBlock (Thermo Fisher Scientific Inc., cat. # 37515) at 150. Mu.L/well, 500 rpm after 3 plate washes. After drying the ELISA plates, serial dilutions of 3A5 were added at concentrations ranging from 20.5 ng/mL to 5000 ng/mL, IL-6R-His 250 ng/mL,500 rpm, and incubated at room temperature for 1 h. After 6 washes, 1:20000 diluted Rabbit Anti-His IgG HRP (SinoBiological Cat.# 105327-MM 02T-H), 500 rpm, 1H incubated at room temperature, after 6 washes TMB color development was added and the reaction was stopped with dilute sulfuric acid. OD450/630 nm dual wavelength detects the OD value.
2. Experimental results
The results are shown in FIG. 3, which shows that antibody 3A5 can obviously inhibit the interaction of IL-6 and its receptor IL-6R, and can be used for blocking various inflammatory signals caused by the increase of IL-6 molecules in vivo, so that the antibody can be applied to the treatment of various diseases related to IL-6 imbalance, such as autoimmune diseases, chronic inflammation, malignant tumor, cytokine Storm Syndrome (CSS) and the like.
Example 5 specificity of antibody 3A5
1. Experimental method
IL-6, VEGF, TNFα, GP130, PD-L1 were diluted to 2. Mu.g/mL, 100. Mu.L/well using carbonate buffer (Sigma Cat#C3041), coated 1 h at 500 rpm at room temperature, and after 3 plate washes, incubated 1 h at room temperature using PBST 150. Mu.L/well with 5% nonfat milk powder, 500 rpm. After the ELISA plates were dried, 500 ng/mL of 3A5 was added, the plates were washed 6 times, 20 ng/mL of the second ELISA antibody was added, incubated at 500 rpm, 1 h at room temperature, and after 6 times washing, TMB color development was added and the reaction was stopped with dilute sulfuric acid. OD450/630 nm dual wavelength detects the OD value.
2. Experimental results
The results are shown in FIG. 4, and the results show that the antibody 3A5 specifically binds IL-6 and has no obvious cross reaction with other tested proteins, thus indicating that the antibody 3A5 has good specificity.

Claims (14)

1. The single domain antibody for resisting IL-6 is characterized in that the amino acid sequences of complementarity determining regions CDR1, CDR2 and CDR3 in the single domain antibody are shown as SEQ ID NO. 1, SEQ ID NO. 2 and SEQ ID NO. 3 respectively.
2. An isolated polynucleotide encoding the single domain antibody of claim 1.
3. An expression vector comprising the polynucleotide of claim 2.
4. An engineered host cell comprising the polynucleotide of claim 2 or the expression vector of claim 3.
5. A detection reagent for detecting IL-6, wherein the detection reagent comprises the single domain antibody of claim 1.
6. The detection reagent of claim 5, wherein the detection reagent comprises a conjugate comprising:
(1) The single domain antibody of claim 1;
(2) A diagnostic agent coupled to the single domain antibody.
7. An assay product for detecting IL-6, comprising the detection reagent of claim 5 or 6.
8. The test product of claim 7, wherein the test product comprises a kit, a test strip, a chip.
9. A pharmaceutical composition comprising the single domain antibody of claim 1.
10. A method of making the single domain antibody of claim 1, comprising the steps of: culturing the engineered host cell of claim 4, and isolating and purifying the single domain antibody of claim 1 from the host cell culture product.
11. A method of making the engineered host cell of claim 4, comprising the steps of: introducing the polynucleotide of claim 2 or the expression vector of claim 3 into a host cell to obtain the engineered host cell of claim 4.
12. A method of inhibiting IL-6 binding to IL-6R in vitro, comprising the steps of: introducing the single domain antibody of claim 1 into a cell of an organism, inhibiting IL-6 binding to IL-6R by expressing the single domain antibody of claim 1.
13. A method for non-diagnostic and non-therapeutic detection of IL-6 protein, comprising the steps of: contacting a test sample with the single domain antibody of claim 1, the detection reagent of claim 5 or 6, or the detection product of claim 7 or 8, and detecting the formation of an immune complex of the IL-6 protein and the single domain antibody.
14. Use of the single domain antibody of claim 1, the polynucleotide of claim 2, the expression vector of claim 3 and/or the engineered host cell of claim 4 in the preparation of a detection reagent for detecting IL-6.
CN202311532996.6A 2023-11-17 2023-11-17 Single-domain antibody for human interleukin 6 protein and application thereof Active CN117247451B (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN202311532996.6A CN117247451B (en) 2023-11-17 2023-11-17 Single-domain antibody for human interleukin 6 protein and application thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN202311532996.6A CN117247451B (en) 2023-11-17 2023-11-17 Single-domain antibody for human interleukin 6 protein and application thereof

Publications (2)

Publication Number Publication Date
CN117247451A CN117247451A (en) 2023-12-19
CN117247451B true CN117247451B (en) 2024-02-09

Family

ID=89129857

Family Applications (1)

Application Number Title Priority Date Filing Date
CN202311532996.6A Active CN117247451B (en) 2023-11-17 2023-11-17 Single-domain antibody for human interleukin 6 protein and application thereof

Country Status (1)

Country Link
CN (1) CN117247451B (en)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1164194A (en) * 1994-10-21 1997-11-05 岸本忠三 Remedy for diseases caused by IL-6 production
CN1694894A (en) * 2001-11-14 2005-11-09 森托科尔公司 Anti-IL-6 antibodies, compositions, methods and uses
CN101440130A (en) * 2008-11-21 2009-05-27 中国人民解放军第四军医大学 Variable regions of heavy chain and light chain of antihuman IL-13R alpha 2 monoclonal antibody
AU2016250478A1 (en) * 2009-11-24 2016-11-17 Alder Biopharmaceuticals, Inc. Antibodies to IL-6 and use thereof
CN115851610A (en) * 2022-10-18 2023-03-28 重庆探生科技有限公司 Hybridoma cell strain for generating anti-human interleukin-6 monoclonal antibody, preparation method and application

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1164194A (en) * 1994-10-21 1997-11-05 岸本忠三 Remedy for diseases caused by IL-6 production
CN1694894A (en) * 2001-11-14 2005-11-09 森托科尔公司 Anti-IL-6 antibodies, compositions, methods and uses
CN101440130A (en) * 2008-11-21 2009-05-27 中国人民解放军第四军医大学 Variable regions of heavy chain and light chain of antihuman IL-13R alpha 2 monoclonal antibody
AU2016250478A1 (en) * 2009-11-24 2016-11-17 Alder Biopharmaceuticals, Inc. Antibodies to IL-6 and use thereof
CN115851610A (en) * 2022-10-18 2023-03-28 重庆探生科技有限公司 Hybridoma cell strain for generating anti-human interleukin-6 monoclonal antibody, preparation method and application

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
Comparing nanobody and aptamer-based capacitive sensing for detection of interleukin-6 (IL-6) at physiologically relevant levels;Sánchez-Salcedo R等;Anal Bioanal Chem;第1-11页 *
单域抗体的特性及其临床开发进展;陈哲浩等;中国新药杂志;第28卷(第21期);第2581-2587页 *
靶向人白介素-6蛋白的治疗性单克隆抗体研究进展;李开通等;中国生物工程杂志;第42卷(第04期);第58-67页 *

Also Published As

Publication number Publication date
CN117247451A (en) 2023-12-19

Similar Documents

Publication Publication Date Title
RU2765306C2 (en) Antibody against b7-h3, its antigen-binding fragment and their medical use
RU2509777C2 (en) Anti-mif antibodies
US11390688B2 (en) Anti-PCSK9 monoclonal antibody
JP2007537132A (en) Antibody to interleukin-22 and use thereof
CN112979802B (en) Anti-human IL-33 monoclonal antibody and application thereof
CN111378037B (en) anti-hIL-33 humanized monoclonal antibody and application thereof
WO2020108530A1 (en) Anti-il-23p19 antibody and uses thereof
CN117247451B (en) Single-domain antibody for human interleukin 6 protein and application thereof
US8354108B2 (en) Fully human antibody to human TNFα, molecular evolution and use thereof
WO2022143611A1 (en) Bcma-targeting single-domain antibody
CN110066334B (en) anti-Galectin-3 fully-humanized single-domain antibody and application thereof
KR101482237B1 (en) A pharmaceutical composition for preventing and treating autoimmune disease comprising minicircle vector expressing bispecific protein comprising anti-IL-6R and TNFR2
CN117304315B (en) anti-IL-6 nanobody and application thereof in IL-6 related diseases
KR101510831B1 (en) A stem cell medicine comprising minicircle vector expressing bispecific protein comprising anti IL-6R and TNFR2
CN117402251B (en) Antibody for resisting small G protein RBJ and application thereof
CN116751289B (en) anti-West Nile virus neutralizing antibody for reducing ADE effect and application thereof
CN114380913B (en) Fully human anti-PD-L1 antibody and application thereof
CN113735975B (en) anti-IL-11R antibody and application thereof
CN114380917B (en) Bispecific single domain antibodies against IL-17A and TNF α and uses thereof
CN114605539B (en) Humanized anti-IL-4 Rα single domain antibodies and uses thereof
WO2021238854A1 (en) Monoclonal antibody against sars-cov-2 spike protein, preparation method therefor, and application thereof
US9321837B2 (en) Method for the treatment of glomerulonephritis by administering an IL-6 antibody
CN117924509A (en) Targeting integrin alpha4β7Bispecific antibodies to TNF-alpha and uses thereof
CN115043940A (en) Anti-human serum albumin antibody and application thereof
CN115850452A (en) Monoclonal antibody for resisting African swine fever virus, derivative product and application thereof

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
GR01 Patent grant
GR01 Patent grant