CN116970066B - MAGE-A1 specific T cell receptor and uses thereof - Google Patents
MAGE-A1 specific T cell receptor and uses thereof Download PDFInfo
- Publication number
- CN116970066B CN116970066B CN202311208572.4A CN202311208572A CN116970066B CN 116970066 B CN116970066 B CN 116970066B CN 202311208572 A CN202311208572 A CN 202311208572A CN 116970066 B CN116970066 B CN 116970066B
- Authority
- CN
- China
- Prior art keywords
- tcr
- mage
- tumor
- seq
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 108091008874 T cell receptors Proteins 0.000 title claims abstract description 651
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 title claims abstract description 651
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 497
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 174
- 210000004027 cell Anatomy 0.000 claims description 534
- 239000000427 antigen Substances 0.000 claims description 373
- 108091007433 antigens Proteins 0.000 claims description 373
- 102000036639 antigens Human genes 0.000 claims description 373
- 230000027455 binding Effects 0.000 claims description 242
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 142
- 150000007523 nucleic acids Chemical class 0.000 claims description 99
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 98
- 102000039446 nucleic acids Human genes 0.000 claims description 63
- 108020004707 nucleic acids Proteins 0.000 claims description 63
- 108010075704 HLA-A Antigens Proteins 0.000 claims description 37
- 210000002865 immune cell Anatomy 0.000 claims description 24
- 238000011282 treatment Methods 0.000 claims description 21
- 239000008194 pharmaceutical composition Substances 0.000 claims description 17
- 238000004519 manufacturing process Methods 0.000 claims description 9
- 239000003814 drug Substances 0.000 claims description 6
- 206010009944 Colon cancer Diseases 0.000 claims description 5
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 5
- 239000003937 drug carrier Substances 0.000 claims description 5
- 201000005202 lung cancer Diseases 0.000 claims description 5
- 208000020816 lung neoplasm Diseases 0.000 claims description 5
- 210000000822 natural killer cell Anatomy 0.000 claims description 5
- 239000002773 nucleotide Substances 0.000 claims description 5
- 125000003729 nucleotide group Chemical group 0.000 claims description 5
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 4
- 201000007270 liver cancer Diseases 0.000 claims description 4
- 208000014018 liver neoplasm Diseases 0.000 claims description 4
- 108020004705 Codon Proteins 0.000 claims description 3
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 2
- 210000005260 human cell Anatomy 0.000 claims description 2
- 210000002540 macrophage Anatomy 0.000 claims description 2
- 102000011786 HLA-A Antigens Human genes 0.000 claims 1
- 230000000735 allogeneic effect Effects 0.000 claims 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 83
- 238000000034 method Methods 0.000 abstract description 80
- 201000010099 disease Diseases 0.000 abstract description 70
- 201000011510 cancer Diseases 0.000 abstract description 57
- 108020003175 receptors Proteins 0.000 abstract description 3
- 239000012636 effector Substances 0.000 description 246
- 239000000203 mixture Substances 0.000 description 101
- 102000004196 processed proteins & peptides Human genes 0.000 description 70
- 241001529936 Murinae Species 0.000 description 69
- 229920001184 polypeptide Polymers 0.000 description 63
- 108090000623 proteins and genes Proteins 0.000 description 59
- 230000014509 gene expression Effects 0.000 description 57
- 102000004169 proteins and genes Human genes 0.000 description 54
- 235000018102 proteins Nutrition 0.000 description 51
- 108091028043 Nucleic acid sequence Proteins 0.000 description 39
- 108020004414 DNA Proteins 0.000 description 37
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 description 36
- 102100028972 HLA class I histocompatibility antigen, A alpha chain Human genes 0.000 description 36
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 35
- 238000000338 in vitro Methods 0.000 description 31
- 239000003795 chemical substances by application Substances 0.000 description 28
- 238000005457 optimization Methods 0.000 description 27
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 24
- 239000011324 bead Substances 0.000 description 23
- 239000003446 ligand Substances 0.000 description 23
- 238000003556 assay Methods 0.000 description 22
- 238000002560 therapeutic procedure Methods 0.000 description 21
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 19
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 18
- 239000002953 phosphate buffered saline Substances 0.000 description 18
- 230000002147 killing effect Effects 0.000 description 17
- 239000013598 vector Substances 0.000 description 17
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 16
- 238000012512 characterization method Methods 0.000 description 16
- 239000002253 acid Substances 0.000 description 15
- 238000002474 experimental method Methods 0.000 description 15
- 239000000243 solution Substances 0.000 description 15
- 238000006467 substitution reaction Methods 0.000 description 15
- 238000002965 ELISA Methods 0.000 description 14
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 14
- 239000000872 buffer Substances 0.000 description 14
- 230000001225 therapeutic effect Effects 0.000 description 14
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 14
- 208000035475 disorder Diseases 0.000 description 13
- 210000002443 helper t lymphocyte Anatomy 0.000 description 13
- 230000003902 lesion Effects 0.000 description 13
- 210000000581 natural killer T-cell Anatomy 0.000 description 13
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 12
- 230000004044 response Effects 0.000 description 12
- 231100000433 cytotoxic Toxicity 0.000 description 10
- 230000001472 cytotoxic effect Effects 0.000 description 10
- 239000006228 supernatant Substances 0.000 description 10
- 210000001519 tissue Anatomy 0.000 description 10
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 9
- 206010039491 Sarcoma Diseases 0.000 description 9
- 235000001014 amino acid Nutrition 0.000 description 9
- 239000012091 fetal bovine serum Substances 0.000 description 9
- 239000002609 medium Substances 0.000 description 9
- 239000007787 solid Substances 0.000 description 9
- -1 for example Chemical class 0.000 description 8
- 238000001727 in vivo Methods 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- 210000004698 lymphocyte Anatomy 0.000 description 8
- 230000001988 toxicity Effects 0.000 description 8
- 231100000419 toxicity Toxicity 0.000 description 8
- 238000002723 toxicity assay Methods 0.000 description 8
- 238000012795 verification Methods 0.000 description 8
- 239000013603 viral vector Substances 0.000 description 8
- 206010006187 Breast cancer Diseases 0.000 description 7
- 208000026310 Breast neoplasm Diseases 0.000 description 7
- 101800001494 Protease 2A Proteins 0.000 description 7
- 101800001066 Protein 2A Proteins 0.000 description 7
- 125000003277 amino group Chemical group 0.000 description 7
- 238000001816 cooling Methods 0.000 description 7
- 230000003013 cytotoxicity Effects 0.000 description 7
- 231100000135 cytotoxicity Toxicity 0.000 description 7
- 238000011534 incubation Methods 0.000 description 7
- 239000002777 nucleoside Substances 0.000 description 7
- 125000003835 nucleoside group Chemical group 0.000 description 7
- 239000000523 sample Substances 0.000 description 7
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 7
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 6
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 6
- 102000043129 MHC class I family Human genes 0.000 description 6
- 108091054437 MHC class I family Proteins 0.000 description 6
- DLRVVLDZNNYCBX-UHFFFAOYSA-N Polydextrose Polymers OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(O)O1 DLRVVLDZNNYCBX-UHFFFAOYSA-N 0.000 description 6
- 239000002202 Polyethylene glycol Substances 0.000 description 6
- 239000002246 antineoplastic agent Substances 0.000 description 6
- 210000004369 blood Anatomy 0.000 description 6
- 239000008280 blood Substances 0.000 description 6
- 229940127089 cytotoxic agent Drugs 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 239000003481 heat shock protein 90 inhibitor Substances 0.000 description 6
- 238000003780 insertion Methods 0.000 description 6
- 230000037431 insertion Effects 0.000 description 6
- 208000032839 leukemia Diseases 0.000 description 6
- 229920001223 polyethylene glycol Polymers 0.000 description 6
- 229920000642 polymer Polymers 0.000 description 6
- 230000004083 survival effect Effects 0.000 description 6
- 108090000695 Cytokines Proteins 0.000 description 5
- 102000004127 Cytokines Human genes 0.000 description 5
- 206010061818 Disease progression Diseases 0.000 description 5
- 206010029260 Neuroblastoma Diseases 0.000 description 5
- 229940024606 amino acid Drugs 0.000 description 5
- 150000001413 amino acids Chemical class 0.000 description 5
- 230000004071 biological effect Effects 0.000 description 5
- 210000000601 blood cell Anatomy 0.000 description 5
- 208000006990 cholangiocarcinoma Diseases 0.000 description 5
- 238000002648 combination therapy Methods 0.000 description 5
- 210000004443 dendritic cell Anatomy 0.000 description 5
- 238000001514 detection method Methods 0.000 description 5
- 230000005750 disease progression Effects 0.000 description 5
- 239000013604 expression vector Substances 0.000 description 5
- 238000007710 freezing Methods 0.000 description 5
- 230000008014 freezing Effects 0.000 description 5
- 208000005017 glioblastoma Diseases 0.000 description 5
- 235000011187 glycerol Nutrition 0.000 description 5
- 208000014829 head and neck neoplasm Diseases 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 201000001441 melanoma Diseases 0.000 description 5
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 5
- DNIAPMSPPWPWGF-UHFFFAOYSA-N monopropylene glycol Natural products CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 5
- 238000010647 peptide synthesis reaction Methods 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 238000000926 separation method Methods 0.000 description 5
- 206010041823 squamous cell carcinoma Diseases 0.000 description 5
- 238000003860 storage Methods 0.000 description 5
- 210000004881 tumor cell Anatomy 0.000 description 5
- 238000005406 washing Methods 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- QULDDKSCVCJTPV-UHFFFAOYSA-N BIIB021 Chemical compound COC1=C(C)C=NC(CN2C3=NC(N)=NC(Cl)=C3N=C2)=C1C QULDDKSCVCJTPV-UHFFFAOYSA-N 0.000 description 4
- 206010005003 Bladder cancer Diseases 0.000 description 4
- 201000009030 Carcinoma Diseases 0.000 description 4
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 4
- 206010008342 Cervix carcinoma Diseases 0.000 description 4
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 4
- 206010018338 Glioma Diseases 0.000 description 4
- 102100037850 Interferon gamma Human genes 0.000 description 4
- 108010074328 Interferon-gamma Proteins 0.000 description 4
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 4
- 206010027406 Mesothelioma Diseases 0.000 description 4
- 208000034578 Multiple myelomas Diseases 0.000 description 4
- 208000007452 Plasmacytoma Diseases 0.000 description 4
- 208000005718 Stomach Neoplasms Diseases 0.000 description 4
- 208000024770 Thyroid neoplasm Diseases 0.000 description 4
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 4
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 4
- 208000002495 Uterine Neoplasms Diseases 0.000 description 4
- 210000001185 bone marrow Anatomy 0.000 description 4
- 230000010261 cell growth Effects 0.000 description 4
- 239000006285 cell suspension Substances 0.000 description 4
- 238000005119 centrifugation Methods 0.000 description 4
- 201000010881 cervical cancer Diseases 0.000 description 4
- 239000002577 cryoprotective agent Substances 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 239000003623 enhancer Substances 0.000 description 4
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 4
- 206010017758 gastric cancer Diseases 0.000 description 4
- 238000001802 infusion Methods 0.000 description 4
- 238000002955 isolation Methods 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 239000008188 pellet Substances 0.000 description 4
- 239000012071 phase Substances 0.000 description 4
- 208000028591 pheochromocytoma Diseases 0.000 description 4
- 229920003023 plastic Polymers 0.000 description 4
- 239000004033 plastic Substances 0.000 description 4
- 102000040430 polynucleotide Human genes 0.000 description 4
- 108091033319 polynucleotide Proteins 0.000 description 4
- 239000002157 polynucleotide Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 239000000018 receptor agonist Substances 0.000 description 4
- 229940044601 receptor agonist Drugs 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 201000011549 stomach cancer Diseases 0.000 description 4
- 150000005846 sugar alcohols Chemical class 0.000 description 4
- 201000002510 thyroid cancer Diseases 0.000 description 4
- 201000005112 urinary bladder cancer Diseases 0.000 description 4
- 206010046766 uterine cancer Diseases 0.000 description 4
- 102000000844 Cell Surface Receptors Human genes 0.000 description 3
- 108010001857 Cell Surface Receptors Proteins 0.000 description 3
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 3
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 3
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 3
- 108091006905 Human Serum Albumin Proteins 0.000 description 3
- 102000008100 Human Serum Albumin Human genes 0.000 description 3
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 3
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 3
- 208000008839 Kidney Neoplasms Diseases 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 3
- 206010025323 Lymphomas Diseases 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 102000000440 Melanoma-associated antigen Human genes 0.000 description 3
- 108050008953 Melanoma-associated antigen Proteins 0.000 description 3
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 3
- 206010033128 Ovarian cancer Diseases 0.000 description 3
- 206010061535 Ovarian neoplasm Diseases 0.000 description 3
- 229930012538 Paclitaxel Natural products 0.000 description 3
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 229920001100 Polydextrose Polymers 0.000 description 3
- 206010060862 Prostate cancer Diseases 0.000 description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 3
- 206010038389 Renal cancer Diseases 0.000 description 3
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 3
- 238000010459 TALEN Methods 0.000 description 3
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 description 3
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 3
- 208000009956 adenocarcinoma Diseases 0.000 description 3
- 238000009098 adjuvant therapy Methods 0.000 description 3
- 230000009824 affinity maturation Effects 0.000 description 3
- KUFRQPKVAWMTJO-LMZWQJSESA-N alvespimycin Chemical compound N1C(=O)\C(C)=C\C=C/[C@H](OC)[C@@H](OC(N)=O)\C(C)=C\[C@H](C)[C@@H](O)[C@@H](OC)C[C@H](C)CC2=C(NCCN(C)C)C(=O)C=C1C2=O KUFRQPKVAWMTJO-LMZWQJSESA-N 0.000 description 3
- 230000000259 anti-tumor effect Effects 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 229960002685 biotin Drugs 0.000 description 3
- 239000011616 biotin Substances 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- 229920001577 copolymer Polymers 0.000 description 3
- 238000005138 cryopreservation Methods 0.000 description 3
- 230000006378 damage Effects 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 201000004101 esophageal cancer Diseases 0.000 description 3
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 3
- 229960005420 etoposide Drugs 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 229940126546 immune checkpoint molecule Drugs 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- CDAISMWEOUEBRE-GPIVLXJGSA-N inositol Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O CDAISMWEOUEBRE-GPIVLXJGSA-N 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 201000010982 kidney cancer Diseases 0.000 description 3
- 230000007774 longterm Effects 0.000 description 3
- 230000036210 malignancy Effects 0.000 description 3
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 3
- 235000010355 mannitol Nutrition 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 229910052757 nitrogen Inorganic materials 0.000 description 3
- 229960001592 paclitaxel Drugs 0.000 description 3
- 201000002528 pancreatic cancer Diseases 0.000 description 3
- 208000008443 pancreatic carcinoma Diseases 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 239000001259 polydextrose Substances 0.000 description 3
- 235000013856 polydextrose Nutrition 0.000 description 3
- 229940035035 polydextrose Drugs 0.000 description 3
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 3
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 3
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 230000035755 proliferation Effects 0.000 description 3
- 238000001959 radiotherapy Methods 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- CDAISMWEOUEBRE-UHFFFAOYSA-N scyllo-inosotol Natural products OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 3
- 229960002920 sorbitol Drugs 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 238000010186 staining Methods 0.000 description 3
- 238000001356 surgical procedure Methods 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 238000010257 thawing Methods 0.000 description 3
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 3
- 229960000303 topotecan Drugs 0.000 description 3
- 231100000331 toxic Toxicity 0.000 description 3
- 230000002588 toxic effect Effects 0.000 description 3
- 238000002054 transplantation Methods 0.000 description 3
- 229960003048 vinblastine Drugs 0.000 description 3
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 3
- CVBWTNHDKVVFMI-LBPRGKRZSA-N (2s)-1-[4-[2-[6-amino-8-[(6-bromo-1,3-benzodioxol-5-yl)sulfanyl]purin-9-yl]ethyl]piperidin-1-yl]-2-hydroxypropan-1-one Chemical compound C1CN(C(=O)[C@@H](O)C)CCC1CCN1C2=NC=NC(N)=C2N=C1SC(C(=C1)Br)=CC2=C1OCO2 CVBWTNHDKVVFMI-LBPRGKRZSA-N 0.000 description 2
- SWDZPNJZKUGIIH-QQTULTPQSA-N (5z)-n-ethyl-5-(4-hydroxy-6-oxo-3-propan-2-ylcyclohexa-2,4-dien-1-ylidene)-4-[4-(morpholin-4-ylmethyl)phenyl]-2h-1,2-oxazole-3-carboxamide Chemical compound O1NC(C(=O)NCC)=C(C=2C=CC(CN3CCOCC3)=CC=2)\C1=C1/C=C(C(C)C)C(O)=CC1=O SWDZPNJZKUGIIH-QQTULTPQSA-N 0.000 description 2
- WSMQUUGTQYPVPD-OAHLLOKOSA-N (7r)-2-amino-7-[4-fluoro-2-(6-methoxypyridin-2-yl)phenyl]-4-methyl-7,8-dihydro-6h-pyrido[4,3-d]pyrimidin-5-one Chemical compound COC1=CC=CC(C=2C(=CC=C(F)C=2)[C@@H]2NC(=O)C3=C(C)N=C(N)N=C3C2)=N1 WSMQUUGTQYPVPD-OAHLLOKOSA-N 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- KMZHZAAOEWVPSE-UHFFFAOYSA-N 2,3-dihydroxypropyl acetate Chemical compound CC(=O)OCC(O)CO KMZHZAAOEWVPSE-UHFFFAOYSA-N 0.000 description 2
- RVJIQAYFTOPTKK-UHFFFAOYSA-N 2-[[6-(dimethylamino)-1,3-benzodioxol-5-yl]sulfanyl]-1-[2-(2,2-dimethylpropylamino)ethyl]imidazo[4,5-c]pyridin-4-amine Chemical compound N1=CC=C2N(CCNCC(C)(C)C)C(SC3=CC=4OCOC=4C=C3N(C)C)=NC2=C1N RVJIQAYFTOPTKK-UHFFFAOYSA-N 0.000 description 2
- 208000006468 Adrenal Cortex Neoplasms Diseases 0.000 description 2
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 108091033409 CRISPR Proteins 0.000 description 2
- 238000010354 CRISPR gene editing Methods 0.000 description 2
- 238000010453 CRISPR/Cas method Methods 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 241000687983 Cerobasis alpha Species 0.000 description 2
- 241000702141 Corynephage beta Species 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- UNXHWFMMPAWVPI-UHFFFAOYSA-N Erythritol Natural products OCC(O)C(O)CO UNXHWFMMPAWVPI-UHFFFAOYSA-N 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- 201000008808 Fibrosarcoma Diseases 0.000 description 2
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 2
- RVAQIUULWULRNW-UHFFFAOYSA-N Ganetespib Chemical compound C1=C(O)C(C(C)C)=CC(C=2N(C(O)=NN=2)C=2C=C3C=CN(C)C3=CC=2)=C1O RVAQIUULWULRNW-UHFFFAOYSA-N 0.000 description 2
- 208000032612 Glial tumor Diseases 0.000 description 2
- 108010058597 HLA-DR Antigens Proteins 0.000 description 2
- 102000006354 HLA-DR Antigens Human genes 0.000 description 2
- 101000599940 Homo sapiens Interferon gamma Proteins 0.000 description 2
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 2
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 2
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 2
- 108010002350 Interleukin-2 Proteins 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 241000713666 Lentivirus Species 0.000 description 2
- NNJVILVZKWQKPM-UHFFFAOYSA-N Lidocaine Chemical compound CCN(CC)CC(=O)NC1=C(C)C=CC=C1C NNJVILVZKWQKPM-UHFFFAOYSA-N 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 2
- BDUHCSBCVGXTJM-IZLXSDGUSA-N Nutlin-3 Chemical compound CC(C)OC1=CC(OC)=CC=C1C1=N[C@H](C=2C=CC(Cl)=CC=2)[C@H](C=2C=CC(Cl)=CC=2)N1C(=O)N1CC(=O)NCC1 BDUHCSBCVGXTJM-IZLXSDGUSA-N 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 239000004372 Polyvinyl alcohol Substances 0.000 description 2
- NBBJYMSMWIIQGU-UHFFFAOYSA-N Propionic aldehyde Chemical compound CCC=O NBBJYMSMWIIQGU-UHFFFAOYSA-N 0.000 description 2
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 2
- 108091027967 Small hairpin RNA Proteins 0.000 description 2
- 108020004459 Small interfering RNA Proteins 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- DRHKJLXJIQTDTD-OAHLLOKOSA-N Tamsulosine Chemical compound CCOC1=CC=CC=C1OCCN[C@H](C)CC1=CC=C(OC)C(S(N)(=O)=O)=C1 DRHKJLXJIQTDTD-OAHLLOKOSA-N 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 2
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 2
- PURWEMRGCTWJGM-JCGAPIOVSA-N [(3r,5s,6r,7s,8e,10s,11s,12z,14e)-6,20,22-trihydroxy-5,11-dimethoxy-3,7,9,15-tetramethyl-16-oxo-21-(prop-2-enylamino)-17-azabicyclo[16.3.1]docosa-1(21),8,12,14,18-pentaen-10-yl] carbamate;hydrochloride Chemical compound Cl.N1C(=O)\C(C)=C\C=C/[C@H](OC)[C@@H](OC(N)=O)\C(C)=C\[C@H](C)[C@@H](O)[C@@H](OC)C[C@H](C)CC2=C(NCC=C)C(O)C=C1C2O PURWEMRGCTWJGM-JCGAPIOVSA-N 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 230000001780 adrenocortical effect Effects 0.000 description 2
- 229960003767 alanine Drugs 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 238000012867 alanine scanning Methods 0.000 description 2
- 210000000612 antigen-presenting cell Anatomy 0.000 description 2
- 239000008135 aqueous vehicle Substances 0.000 description 2
- MQTOSJVFKKJCRP-BICOPXKESA-N azithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)N(C)C[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 MQTOSJVFKKJCRP-BICOPXKESA-N 0.000 description 2
- 229960004099 azithromycin Drugs 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 239000008228 bacteriostatic water for injection Substances 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 201000000053 blastoma Diseases 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 239000007975 buffered saline Substances 0.000 description 2
- YCIMNLLNPGFGHC-UHFFFAOYSA-N catechol Chemical compound OC1=CC=CC=C1O YCIMNLLNPGFGHC-UHFFFAOYSA-N 0.000 description 2
- 230000020411 cell activation Effects 0.000 description 2
- NVGFSTMGRRADRG-IOJSEOPQSA-N chembl553939 Chemical compound CS(O)(=O)=O.O=C1CC(C)(C)CC2=C1C(C(F)(F)F)=NN2C(C=1)=CC=C(C(N)=O)C=1N[C@H]1CC[C@H](OC(=O)CN)CC1 NVGFSTMGRRADRG-IOJSEOPQSA-N 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 229960004316 cisplatin Drugs 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000002591 computed tomography Methods 0.000 description 2
- 231100000599 cytotoxic agent Toxicity 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 230000008034 disappearance Effects 0.000 description 2
- 201000008184 embryoma Diseases 0.000 description 2
- UNXHWFMMPAWVPI-ZXZARUISSA-N erythritol Chemical compound OC[C@H](O)[C@H](O)CO UNXHWFMMPAWVPI-ZXZARUISSA-N 0.000 description 2
- 210000003743 erythrocyte Anatomy 0.000 description 2
- 229960002949 fluorouracil Drugs 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 238000003209 gene knockout Methods 0.000 description 2
- 238000012239 gene modification Methods 0.000 description 2
- 230000009368 gene silencing by RNA Effects 0.000 description 2
- 230000005017 genetic modification Effects 0.000 description 2
- 235000013617 genetically modified food Nutrition 0.000 description 2
- 238000010362 genome editing Methods 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 230000003394 haemopoietic effect Effects 0.000 description 2
- 201000010536 head and neck cancer Diseases 0.000 description 2
- 230000002489 hematologic effect Effects 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 229960002885 histidine Drugs 0.000 description 2
- 235000014304 histidine Nutrition 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 2
- 229960003444 immunosuppressant agent Drugs 0.000 description 2
- 239000003018 immunosuppressive agent Substances 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 229960000367 inositol Drugs 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 229960004194 lidocaine Drugs 0.000 description 2
- 230000033001 locomotion Effects 0.000 description 2
- 229950005069 luminespib Drugs 0.000 description 2
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 2
- 230000003211 malignant effect Effects 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 229960001855 mannitol Drugs 0.000 description 2
- 230000035800 maturation Effects 0.000 description 2
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 2
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 2
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 2
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 2
- 108091070501 miRNA Proteins 0.000 description 2
- 239000002679 microRNA Substances 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 210000001616 monocyte Anatomy 0.000 description 2
- PJUIMOJAAPLTRJ-UHFFFAOYSA-N monothioglycerol Chemical compound OCC(O)CS PJUIMOJAAPLTRJ-UHFFFAOYSA-N 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 230000009437 off-target effect Effects 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- AQIXEPGDORPWBJ-UHFFFAOYSA-N pentan-3-ol Chemical compound CCC(O)CC AQIXEPGDORPWBJ-UHFFFAOYSA-N 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 239000002504 physiological saline solution Substances 0.000 description 2
- 229920002451 polyvinyl alcohol Polymers 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 2
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 210000003289 regulatory T cell Anatomy 0.000 description 2
- GHMLBKRAJCXXBS-UHFFFAOYSA-N resorcinol Chemical compound OC1=CC=CC(O)=C1 GHMLBKRAJCXXBS-UHFFFAOYSA-N 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- HEBKCHPVOIAQTA-ZXFHETKHSA-N ribitol Chemical compound OC[C@H](O)[C@H](O)[C@H](O)CO HEBKCHPVOIAQTA-ZXFHETKHSA-N 0.000 description 2
- 238000010187 selection method Methods 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000002924 silencing RNA Substances 0.000 description 2
- 239000004055 small Interfering RNA Substances 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 235000010356 sorbitol Nutrition 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 229960002613 tamsulosin Drugs 0.000 description 2
- 206010044412 transitional cell carcinoma Diseases 0.000 description 2
- 230000004614 tumor growth Effects 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 241001529453 unidentified herpesvirus Species 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 229920003169 water-soluble polymer Polymers 0.000 description 2
- 239000000811 xylitol Substances 0.000 description 2
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 2
- 235000010447 xylitol Nutrition 0.000 description 2
- 229960002675 xylitol Drugs 0.000 description 2
- SUPVGFZUWFMATN-UHFFFAOYSA-N zelavespib Chemical compound N1=CN=C2N(CCCNC(C)C)C(SC=3C(=CC=4OCOC=4C=3)I)=NC2=C1N SUPVGFZUWFMATN-UHFFFAOYSA-N 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- MWTUOSWPJOUADP-XDJHFCHBSA-N (5z)-5-(4-hydroxy-6-oxo-3-propan-2-ylcyclohexa-2,4-dien-1-ylidene)-4-(1-methylindol-5-yl)-1,2,4-triazolidin-3-one Chemical compound O=C1C=C(O)C(C(C)C)=C\C1=C\1N(C=2C=C3C=CN(C)C3=CC=2)C(=O)NN/1 MWTUOSWPJOUADP-XDJHFCHBSA-N 0.000 description 1
- WNXJIVFYUVYPPR-UHFFFAOYSA-N 1,3-dioxolane Chemical compound C1COCO1 WNXJIVFYUVYPPR-UHFFFAOYSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- HTCSFFGLRQDZDE-UHFFFAOYSA-N 2-azaniumyl-2-phenylpropanoate Chemical compound OC(=O)C(N)(C)C1=CC=CC=C1 HTCSFFGLRQDZDE-UHFFFAOYSA-N 0.000 description 1
- 239000001763 2-hydroxyethyl(trimethyl)azanium Substances 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- DLFVBJFMPXGRIB-UHFFFAOYSA-N Acetamide Chemical compound CC(N)=O DLFVBJFMPXGRIB-UHFFFAOYSA-N 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 206010001233 Adenoma benign Diseases 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 206010003571 Astrocytoma Diseases 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- GUBGYTABKSRVRQ-DCSYEGIMSA-N Beta-Lactose Chemical compound OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-DCSYEGIMSA-N 0.000 description 1
- 241000212384 Bifora Species 0.000 description 1
- 206010004593 Bile duct cancer Diseases 0.000 description 1
- 229920002799 BoPET Polymers 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006143 Brain stem glioma Diseases 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 206010008263 Cervical dysplasia Diseases 0.000 description 1
- 235000019743 Choline chloride Nutrition 0.000 description 1
- 208000005243 Chondrosarcoma Diseases 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 1
- HEBKCHPVOIAQTA-QWWZWVQMSA-N D-arabinitol Chemical compound OC[C@@H](O)C(O)[C@H](O)CO HEBKCHPVOIAQTA-QWWZWVQMSA-N 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 241000450599 DNA viruses Species 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 206010014967 Ependymoma Diseases 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 239000004386 Erythritol Substances 0.000 description 1
- 208000031637 Erythroblastic Acute Leukemia Diseases 0.000 description 1
- 208000036566 Erythroleukaemia Diseases 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 206010073306 Exposure to radiation Diseases 0.000 description 1
- 208000007659 Fibroadenoma Diseases 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- 239000004606 Fillers/Extenders Substances 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100028971 HLA class I histocompatibility antigen, C alpha chain Human genes 0.000 description 1
- 102100040505 HLA class II histocompatibility antigen, DR alpha chain Human genes 0.000 description 1
- 108010052199 HLA-C Antigens Proteins 0.000 description 1
- 108010067802 HLA-DR alpha-Chains Proteins 0.000 description 1
- SQUHHTBVTRBESD-UHFFFAOYSA-N Hexa-Ac-myo-Inositol Natural products CC(=O)OC1C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C1OC(C)=O SQUHHTBVTRBESD-UHFFFAOYSA-N 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101000582254 Homo sapiens Nuclear receptor corepressor 2 Proteins 0.000 description 1
- 229920001612 Hydroxyethyl starch Polymers 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 102100022338 Integrin alpha-M Human genes 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- 125000000998 L-alanino group Chemical group [H]N([*])[C@](C([H])([H])[H])([H])C(=O)O[H] 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- 239000004395 L-leucine Substances 0.000 description 1
- 235000019454 L-leucine Nutrition 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 206010024305 Leukaemia monocytic Diseases 0.000 description 1
- 201000004462 Leydig Cell Tumor Diseases 0.000 description 1
- 206010024612 Lipoma Diseases 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- 208000009018 Medullary thyroid cancer Diseases 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 206010059282 Metastases to central nervous system Diseases 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 101150076359 Mhc gene Proteins 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 101100425749 Mus musculus Tnfrsf18 gene Proteins 0.000 description 1
- 208000021642 Muscular disease Diseases 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- 239000005041 Mylar™ Substances 0.000 description 1
- 201000009623 Myopathy Diseases 0.000 description 1
- 201000002481 Myositis Diseases 0.000 description 1
- 206010029350 Neurotoxicity Diseases 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 201000010133 Oligodendroglioma Diseases 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 206010031096 Oropharyngeal cancer Diseases 0.000 description 1
- 206010057444 Oropharyngeal neoplasm Diseases 0.000 description 1
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 1
- 206010033701 Papillary thyroid cancer Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 208000007641 Pinealoma Diseases 0.000 description 1
- 208000002151 Pleural effusion Diseases 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 102000004245 Proteasome Endopeptidase Complex Human genes 0.000 description 1
- 108090000708 Proteasome Endopeptidase Complex Proteins 0.000 description 1
- 102000003923 Protein Kinase C Human genes 0.000 description 1
- 108090000315 Protein Kinase C Proteins 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- MUPFEKGTMRGPLJ-RMMQSMQOSA-N Raffinose Natural products O(C[C@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O[C@@]2(CO)[C@H](O)[C@@H](O)[C@@H](CO)O2)O1)[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 MUPFEKGTMRGPLJ-RMMQSMQOSA-N 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- JVWLUVNSQYXYBE-UHFFFAOYSA-N Ribitol Natural products OCC(C)C(O)C(O)CO JVWLUVNSQYXYBE-UHFFFAOYSA-N 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 201000010208 Seminoma Diseases 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- UQZIYBXSHAGNOE-USOSMYMVSA-N Stachyose Natural products O(C[C@H]1[C@@H](O)[C@H](O)[C@H](O)[C@@H](O[C@@]2(CO)[C@H](O)[C@@H](O)[C@@H](CO)O2)O1)[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@H](CO[C@@H]2[C@@H](O)[C@@H](O)[C@@H](O)[C@H](CO)O2)O1 UQZIYBXSHAGNOE-USOSMYMVSA-N 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 210000000662 T-lymphocyte subset Anatomy 0.000 description 1
- 206010043276 Teratoma Diseases 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- MUPFEKGTMRGPLJ-UHFFFAOYSA-N UNPD196149 Natural products OC1C(O)C(CO)OC1(CO)OC1C(O)C(O)C(O)C(COC2C(C(O)C(O)C(CO)O2)O)O1 MUPFEKGTMRGPLJ-UHFFFAOYSA-N 0.000 description 1
- 208000023915 Ureteral Neoplasms Diseases 0.000 description 1
- 206010046392 Ureteric cancer Diseases 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- 210000001766 X chromosome Anatomy 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- 208000004064 acoustic neuroma Diseases 0.000 description 1
- 208000017733 acquired polycythemia vera Diseases 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 208000021841 acute erythroid leukemia Diseases 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 208000002718 adenomatoid tumor Diseases 0.000 description 1
- 238000011467 adoptive cell therapy Methods 0.000 description 1
- 201000002454 adrenal cortex cancer Diseases 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 229950007861 alvespimycin Drugs 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 201000007696 anal canal cancer Diseases 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000006023 anti-tumor response Effects 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 238000010913 antigen-directed enzyme pro-drug therapy Methods 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 229940034982 antineoplastic agent Drugs 0.000 description 1
- 238000002617 apheresis Methods 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 229960003121 arginine Drugs 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- 230000003542 behavioural effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 229960001716 benzalkonium Drugs 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 208000026900 bile duct neoplasm Diseases 0.000 description 1
- 238000013357 binding ELISA Methods 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 210000001772 blood platelet Anatomy 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 201000003149 breast fibroadenoma Diseases 0.000 description 1
- KQNZDYYTLMIZCT-KQPMLPITSA-N brefeldin A Chemical compound O[C@@H]1\C=C\C(=O)O[C@@H](C)CCC\C=C\[C@@H]2C[C@H](O)C[C@H]21 KQNZDYYTLMIZCT-KQPMLPITSA-N 0.000 description 1
- JUMGSHROWPPKFX-UHFFFAOYSA-N brefeldin-A Natural products CC1CCCC=CC2(C)CC(O)CC2(C)C(O)C=CC(=O)O1 JUMGSHROWPPKFX-UHFFFAOYSA-N 0.000 description 1
- 208000003362 bronchogenic carcinoma Diseases 0.000 description 1
- 229960005520 bryostatin Drugs 0.000 description 1
- MJQUEDHRCUIRLF-TVIXENOKSA-N bryostatin 1 Chemical compound C([C@@H]1CC(/[C@@H]([C@@](C(C)(C)/C=C/2)(O)O1)OC(=O)/C=C/C=C/CCC)=C\C(=O)OC)[C@H]([C@@H](C)O)OC(=O)C[C@H](O)C[C@@H](O1)C[C@H](OC(C)=O)C(C)(C)[C@]1(O)C[C@@H]1C\C(=C\C(=O)OC)C[C@H]\2O1 MJQUEDHRCUIRLF-TVIXENOKSA-N 0.000 description 1
- MUIWQCKLQMOUAT-AKUNNTHJSA-N bryostatin 20 Natural products COC(=O)C=C1C[C@@]2(C)C[C@]3(O)O[C@](C)(C[C@@H](O)CC(=O)O[C@](C)(C[C@@]4(C)O[C@](O)(CC5=CC(=O)O[C@]45C)C(C)(C)C=C[C@@](C)(C1)O2)[C@@H](C)O)C[C@H](OC(=O)C(C)(C)C)C3(C)C MUIWQCKLQMOUAT-AKUNNTHJSA-N 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- ZTQSAGDEMFDKMZ-UHFFFAOYSA-N butyric aldehyde Natural products CCCC=O ZTQSAGDEMFDKMZ-UHFFFAOYSA-N 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000003710 calcium ionophore Substances 0.000 description 1
- 230000004611 cancer cell death Effects 0.000 description 1
- 238000002619 cancer immunotherapy Methods 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 239000002041 carbon nanotube Substances 0.000 description 1
- 229910021393 carbon nanotube Inorganic materials 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 231100000153 central nervous system (CNS) toxicity Toxicity 0.000 description 1
- 208000025997 central nervous system neoplasm Diseases 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 208000011654 childhood malignant neoplasm Diseases 0.000 description 1
- 208000012191 childhood neoplasm Diseases 0.000 description 1
- SGMZJAMFUVOLNK-UHFFFAOYSA-M choline chloride Chemical compound [Cl-].C[N+](C)(C)CCO SGMZJAMFUVOLNK-UHFFFAOYSA-M 0.000 description 1
- 229960003178 choline chloride Drugs 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000024207 chronic leukemia Diseases 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 229940001468 citrate Drugs 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000005345 coagulation Methods 0.000 description 1
- 230000015271 coagulation Effects 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 230000000139 costimulatory effect Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- HPXRVTGHNJAIIH-UHFFFAOYSA-N cyclohexanol Chemical compound OC1CCCCC1 HPXRVTGHNJAIIH-UHFFFAOYSA-N 0.000 description 1
- 208000031513 cyst Diseases 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 239000002619 cytotoxin Substances 0.000 description 1
- 238000009110 definitive therapy Methods 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 230000017858 demethylation Effects 0.000 description 1
- 238000010520 demethylation reaction Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 230000001066 destructive effect Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 210000003162 effector t lymphocyte Anatomy 0.000 description 1
- 210000002308 embryonic cell Anatomy 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 229940009714 erythritol Drugs 0.000 description 1
- 235000019414 erythritol Nutrition 0.000 description 1
- CJAONIOAQZUHPN-KKLWWLSJSA-N ethyl 12-[[2-[(2r,3r)-3-[2-[(12-ethoxy-12-oxododecyl)-methylamino]-2-oxoethoxy]butan-2-yl]oxyacetyl]-methylamino]dodecanoate Chemical group CCOC(=O)CCCCCCCCCCCN(C)C(=O)CO[C@H](C)[C@@H](C)OCC(=O)N(C)CCCCCCCCCCCC(=O)OCC CJAONIOAQZUHPN-KKLWWLSJSA-N 0.000 description 1
- 230000005713 exacerbation Effects 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 206010016629 fibroma Diseases 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000009093 first-line therapy Methods 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- FBPFZTCFMRRESA-GUCUJZIJSA-N galactitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-GUCUJZIJSA-N 0.000 description 1
- 229950004161 ganetespib Drugs 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229940014259 gelatin Drugs 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 235000004554 glutamine Nutrition 0.000 description 1
- 229960002743 glutamine Drugs 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 229960002449 glycine Drugs 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 239000003966 growth inhibitor Substances 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- 208000025750 heavy chain disease Diseases 0.000 description 1
- 201000002222 hemangioblastoma Diseases 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 229920001519 homopolymer Polymers 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 229940050526 hydroxyethylstarch Drugs 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 238000003365 immunocytochemistry Methods 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000001861 immunosuppressant effect Effects 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 239000005414 inactive ingredient Substances 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 230000008611 intercellular interaction Effects 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 230000002601 intratumoral effect Effects 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 238000011031 large-scale manufacturing process Methods 0.000 description 1
- 229960003136 leucine Drugs 0.000 description 1
- 210000002332 leydig cell Anatomy 0.000 description 1
- AGBQKNBQESQNJD-UHFFFAOYSA-M lipoate Chemical compound [O-]C(=O)CCCCC1CCSS1 AGBQKNBQESQNJD-UHFFFAOYSA-M 0.000 description 1
- 235000019136 lipoic acid Nutrition 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 238000001294 liquid chromatography-tandem mass spectrometry Methods 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 239000003589 local anesthetic agent Substances 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 229960003646 lysine Drugs 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 238000002595 magnetic resonance imaging Methods 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 210000003794 male germ cell Anatomy 0.000 description 1
- 208000025854 malignant tumor of adrenal cortex Diseases 0.000 description 1
- 208000026037 malignant tumor of neck Diseases 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 210000003071 memory t lymphocyte Anatomy 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- 238000010208 microarray analysis Methods 0.000 description 1
- 201000004058 mixed glioma Diseases 0.000 description 1
- 201000006894 monocytic leukemia Diseases 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- 238000009099 neoadjuvant therapy Methods 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 201000006958 oropharynx cancer Diseases 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 238000004091 panning Methods 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 229920000191 poly(N-vinyl pyrrolidone) Polymers 0.000 description 1
- 229920001308 poly(aminoacid) Polymers 0.000 description 1
- 108010054442 polyalanine Proteins 0.000 description 1
- 208000037244 polycythemia vera Diseases 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 238000010837 poor prognosis Methods 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 1
- 230000000861 pro-apoptotic effect Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- KWGRBVOPPLSCSI-WCBMZHEXSA-N pseudoephedrine Chemical compound CN[C@@H](C)[C@@H](O)C1=CC=CC=C1 KWGRBVOPPLSCSI-WCBMZHEXSA-N 0.000 description 1
- 239000008213 purified water Substances 0.000 description 1
- 125000001453 quaternary ammonium group Chemical group 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- MUPFEKGTMRGPLJ-ZQSKZDJDSA-N raffinose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO[C@@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)O)O1 MUPFEKGTMRGPLJ-ZQSKZDJDSA-N 0.000 description 1
- 229920005604 random copolymer Polymers 0.000 description 1
- 229930185191 ravidin Natural products 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 201000008407 sebaceous adenocarcinoma Diseases 0.000 description 1
- 230000011218 segmentation Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000004904 shortening Methods 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 238000004088 simulation Methods 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- GNBVPFITFYNRCN-UHFFFAOYSA-M sodium thioglycolate Chemical compound [Na+].[O-]C(=O)CS GNBVPFITFYNRCN-UHFFFAOYSA-M 0.000 description 1
- 229940046307 sodium thioglycolate Drugs 0.000 description 1
- AKHNMLFCWUSKQB-UHFFFAOYSA-L sodium thiosulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=S AKHNMLFCWUSKQB-UHFFFAOYSA-L 0.000 description 1
- 235000019345 sodium thiosulphate Nutrition 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- UQZIYBXSHAGNOE-XNSRJBNMSA-N stachyose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO[C@@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO[C@@H]3[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O3)O)O2)O)O1 UQZIYBXSHAGNOE-XNSRJBNMSA-N 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- SFVFIFLLYFPGHH-UHFFFAOYSA-M stearalkonium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CC1=CC=CC=C1 SFVFIFLLYFPGHH-UHFFFAOYSA-M 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 238000011146 sterile filtration Methods 0.000 description 1
- 239000012089 stop solution Substances 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000008362 succinate buffer Substances 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 201000010965 sweat gland carcinoma Diseases 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 229950007866 tanespimycin Drugs 0.000 description 1
- AYUNIORJHRXIBJ-TXHRRWQRSA-N tanespimycin Chemical compound N1C(=O)\C(C)=C\C=C/[C@H](OC)[C@@H](OC(N)=O)\C(C)=C\[C@H](C)[C@@H](O)[C@@H](OC)C[C@H](C)CC2=C(NCC=C)C(=O)C=C1C2=O AYUNIORJHRXIBJ-TXHRRWQRSA-N 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- 208000001608 teratocarcinoma Diseases 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 229960002663 thioctic acid Drugs 0.000 description 1
- 229940035024 thioglycerol Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 208000030045 thyroid gland papillary carcinoma Diseases 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 230000002110 toxicologic effect Effects 0.000 description 1
- 231100000027 toxicology Toxicity 0.000 description 1
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 238000011277 treatment modality Methods 0.000 description 1
- GETQZCLCWQTVFV-UHFFFAOYSA-N trimethylamine Chemical class CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 1
- 150000004072 triols Chemical class 0.000 description 1
- 150000004043 trisaccharides Chemical class 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 229940045136 urea Drugs 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 238000012418 validation experiment Methods 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Hematology (AREA)
- Public Health (AREA)
- Wood Science & Technology (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Developmental Biology & Embryology (AREA)
- Virology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Molecular Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The present invention provides a tumor-specific T cell receptor that specifically binds to the major tissue compatibility complex (MHC)/MAGE-A1 epitope complex, engineered T cells comprising the receptor, and methods of using the same for treating diseases including cancer.
Description
Technical Field
The present application relates to the field of cancer immunotherapy. In particular, the present application relates in some aspects to binding molecules, such as complexes capable of specifically binding Major Histocompatibility Complex (MHC) molecules and MAGE-A1 peptides. In particular, the present application relates to T Cell Receptors (TCRs), including antigen binding domains thereof, that bind or recognize such peptide epitopes. The application further relates to engineered cells comprising such binding molecules, e.g., TCRs, and their use in adoptive cell therapies.
Background
The human body possesses a complex immune system that protects itself from diseases, including in vivo malignancies. The innate immune response to tumors is usually elicited by tumor antigens, including muteins that are expressed exclusively in cancer cells, as well as tumor-associated antigens (TAAs) that are overexpressed in tissues of cancer origin but are not recognized as "self" at all. Antigen Presenting Cells (APCs), particularly Dendritic Cells (DCs), that encounter tumor antigens can process and present tumor antigens to their cell surfaces. After maturation, DCs loaded with tumor antigens can elicit T cell responses to cancer cells hosting tumor antigens, involving cytotoxic T cells, helper T cells, and functionally different effector T cells and memory T cells. Cytotoxic T cells can specifically bind to and recognize cancer cells expressing tumor antigens through their surface T Cell Receptors (TCRs) and kill cancer cells by releasing cytokines, enzymes and cytotoxins or by triggering pro-apoptotic signaling cascades via cell-cell interactions.
Adoptive lymphocyte therapy (ACT) provides a promising concept for cancer treatment by administering ex vivo expanded lymphocytes to a subject. For example, tumor-infiltrating lymphocytes (TILs) may be isolated from a patient's tumor, the TILs expanded ex vivo, and the TILs infused back into the patient after removal of the patient's natural non-myeloid lymphocytes. However, variability in TIL affinity isolated from each patient or donor limits the anti-tumor efficacy in clinical trials. Furthermore, most antigen-specific mutations that lead to an immune response are found only in the cancer of an individual, not in multiple patients.
An engineered T cell containing a tumor antigen specific T Cell Receptor (TCR) can overcome some of the challenges faced by current methods of adoptive lymphocyte therapy, as it can rapidly produce tumor-reactive T lymphocytes with defined antigen specificity. There is a need in the art to obtain TCRs that target different tumor antigens and that provide high anti-tumor efficacy and low off-target effects in vivo. Problems with common TCR-T cell therapies include serious adverse events in clinical trials (such as central nervous system toxicity), which may be associated with improper selection of targets (so-called on-target off tumor effect) and biased proliferation of T cell populations (biological expansion).
Melanoma-associated antigen A1 (melanoma-associated antigen A1, MAGE-A1) is a cancer-testis antigen, which is present in adult male germ cells and embryonic cells, and plays an important role in tumor detection and immunotherapy. MAGE-A1 genes belong to the MAGE family, which can be divided into two classes: class I and class II, the former on the X chromosome, are important components of tumor-associated antigens, including MAGE-A, MAGE-B and MAGE-C, in which the MAGE-A1 gene is expressed only in tissues whose genome is unstable and in which demethylation is liable to occur, such as normal testis tissues and various tumor tissues, and is considered to be closely related to the progression of tumors and poor prognosis. Research results indicate that tumors and/or tumor-derived factors in individuals genetically predisposed to autoimmunity may trigger myopathies and that immune responses to myositis antigens may be associated with primary or subclinical antitumor responses in patients. MAGE-A1 specific TCR and TCR-T are therefore promising cancer therapies with high anti-tumor efficacy and low off-target effects.
Disclosure of Invention
According to a first aspect of the present invention there is provided an isolated tumour specific T Cell Receptor (TCR) or antigen binding domain thereof which specifically binds to the major tissue compatibility complex (MHC)/MAGE-A1 epitope complex, the tumour specific TCR comprising: a TCR a chain comprising CDR1 having the amino acid sequence of SEQ ID No. 1, CDR2 having the amino acid sequence of SEQ ID No. 2, and CDR3 having the amino acid sequence of SEQ ID No. 3; and a TCR beta chain comprising CDR1 having the amino acid sequence of SEQ ID NO. 4, CDR2 having the amino acid sequence of SEQ ID NO. 5 and CDR3 having the amino acid sequence of SEQ ID NO. 6.
In some embodiments, an isolated tumor-specific TCR, or antigen-binding domain thereof, that specifically binds to a major tissue compatibility complex (MHC)/MAGE-A1 epitope complex is provided, wherein the MAGE-A1 epitope comprises the amino acid sequence shown in SEQ ID No. 93.
In some embodiments according to any of the above, the MHC is HLA-A x 11:01.
In some embodiments according to any one of the above, the isolated tumor-specific TCR, or antigen-binding domain thereof, comprises: a TCR alpha chain comprising a variable region having the amino acid sequence of SEQ ID NO. 7 and a TCR beta chain comprising a variable region having the amino acid sequence of SEQ ID NO. 10.
In some embodiments according to any of the above, the isolated tumor-specific TCR, or antigen-binding domain thereof, comprises:
a TCR alpha chain comprising an amino acid sequence having SEQ ID NOs 7 and 8 or an amino acid sequence having at least 90% sequence identity thereto, and a TCR beta chain comprising an amino acid sequence having SEQ ID NOs 10 and 11 or an amino acid sequence having at least 90% sequence identity thereto.
An isolated TCR, or antigen-binding domain thereof, as described in some embodiments of any of the above, which is isolated or purified or recombinant.
An isolated TCR, or antigen-binding domain thereof, according to any of the embodiments described in some of the above, which is chimeric, humanized or human.
An isolated TCR or antigen-binding domain thereof according to any of the embodiments described above, wherein the TCR or antigen-binding domain thereof is single chain.
An isolated TCR, or antigen-binding domain thereof, according to any of the embodiments above, wherein the TCR a chain further comprises an a constant (ca) region and/or the TCR β chain further comprises a β constant (cβ) region.
An isolated TCR, or antigen-binding domain thereof, according to any of the embodiments above, wherein the cα region and the cβ region are mouse constant regions.
An isolated TCR, or antigen-binding domain thereof, according to any of the embodiments above, wherein the cα region comprises the amino acid sequence of SEQ ID nos. 22 or an amino acid sequence having at least 90% sequence identity thereto, and/or the cβ region comprises the amino acid sequence of SEQ ID nos. 25 or an amino acid sequence having at least 90% sequence identity thereto.
An isolated TCR, or antigen-binding domain thereof, as described in some embodiments of any of the above, comprising: a TCR alpha chain comprising the amino acid sequences having SEQ ID NOs 21 and 22 or an amino acid sequence having at least 90% sequence identity thereto, and a TCR beta chain comprising the amino acid sequences having SEQ ID NOs 24 and 25 or an amino acid sequence having at least 90% sequence identity thereto.
An isolated TCR, or an antigen-binding domain thereof, according to any of the embodiments above, wherein the TCR a chain and/or the TCR β chain further comprises a signal peptide.
In some embodiments, an isolated nucleic acid is provided that encodes an isolated TCR or antigen-binding domain thereof, or a TCR alpha chain or a TCR beta chain thereof, according to the embodiments of any of the above.
The isolated nucleic acid molecule of any of the embodiments above, wherein the nucleic acid sequence is codon optimized.
The isolated nucleic acid molecule of any one of the embodiments above, wherein the nucleotide sequence encoding the TCR a chain and the nucleotide sequence encoding the TCR β chain are separated by a self-cleaving peptide sequence.
The isolated nucleic acid molecule according to any of the embodiments above, wherein the self-cleaving peptide is P2A comprising the amino acid sequence shown in SEQ ID NO. 13.
In some embodiments, an isolated nucleic acid encoding a TCR a chain and a TCR β chain of a tumor-specific TCR as described above is provided.
In some embodiments, an engineered immune cell is provided comprising a tumor-specific TCR or nucleic acid encoding the same, as described in any of the embodiments above, the engineered cell being a cell line or a primary or heterologous cell obtained from a subject, preferably the cell is a human cell, including but not limited to a T cell, NK cell, macrophage, or the like.
An engineered immune cell according to any one of the embodiments above, wherein the immune cell is a T cell.
An engineered cell according to any one of the embodiments above, wherein said engineered cell comprises a cd8+ T cell.
An engineered cell according to any one of the embodiments above, wherein said engineered cell comprises a cd4+ T cell.
In some embodiments, a pharmaceutical composition is provided comprising an engineered immune cell described in any of the embodiments above, and a pharmaceutically acceptable carrier.
In some embodiments, there is provided a method of treating a MAGE-A1 expressing disease or disorder comprising administering to a subject in need thereof an effective amount of a pharmaceutical composition according to any one of the embodiments described above.
The method according to any one of the embodiments above, wherein the disease or disorder is cancer.
The method according to any one of the embodiments above, wherein the cancer is selected from lung cancer, liver cancer, skin cancer, breast cancer and head and neck tumor.
The method according to any one of the embodiments above, wherein the engineered cell is an autologous cell of the subject.
The method of any one of the embodiments above, further comprising administering to the subject one or more of: immunosuppressants, therapeutic antibodies, chemotherapy, radiation therapy, surgery, or any combination thereof.
In some embodiments, the isolated tumor-specific TCR, or antigen-binding domain thereof, as described in the first aspect, comprises:
a TCR a chain comprising CDR1 of the amino acid sequence of SEQ ID No. 1, CDR2 of the amino acid sequence of SEQ ID No. 2, and CDR3 of the amino acid sequence of SEQ ID No. 79; and a TCR beta chain comprising CDR1 of the amino acid sequence of SEQ ID NO. 4, CDR2 of the amino acid sequence of SEQ ID NO. 5 and CDR3 of the amino acid sequence of SEQ ID NO. 6.
In some embodiments, the isolated tumor-specific TCR, or antigen-binding domain thereof, as described in the first aspect, comprises:
a TCR a chain comprising CDR1 of the amino acid sequence of SEQ ID No. 1, CDR2 of the amino acid sequence of SEQ ID No. 2, and CDR3 of the amino acid sequence of SEQ ID No. 80; and a TCR beta chain comprising CDR1 of the amino acid sequence of SEQ ID NO. 4, CDR2 of the amino acid sequence of SEQ ID NO. 5 and CDR3 of the amino acid sequence of SEQ ID NO. 6.
In some embodiments, the isolated tumor-specific TCR, or antigen-binding domain thereof, as described in the first aspect, comprises:
a TCR a chain comprising CDR1 of the amino acid sequence of SEQ ID No. 1, CDR2 of the amino acid sequence of SEQ ID No. 2, and CDR3 of the amino acid sequence of SEQ ID No. 3; and a TCR beta chain comprising CDR1 of the amino acid sequence of SEQ ID NO. 4, CDR2 of the amino acid sequence of SEQ ID NO. 5 and CDR3 of the amino acid sequence of SEQ ID NO. 81.
In some embodiments, the isolated tumor-specific TCR, or antigen-binding domain thereof, as described in the first aspect, comprises:
a TCR a chain comprising CDR1 of the amino acid sequence of SEQ ID No. 1, CDR2 of the amino acid sequence of SEQ ID No. 2, and CDR3 of the amino acid sequence of SEQ ID No. 3; and a TCR beta chain comprising CDR1 of the amino acid sequence of SEQ ID NO. 4, CDR2 of the amino acid sequence of SEQ ID NO. 5 and CDR3 of the amino acid sequence of SEQ ID NO. 82.
In some embodiments, the isolated tumor-specific TCR, or antigen-binding domain thereof, as described in the first aspect, comprises:
A TCR a chain comprising CDR1 of the amino acid sequence of SEQ ID No. 1, CDR2 of the amino acid sequence of SEQ ID No. 2, and CDR3 of the amino acid sequence of SEQ ID No. 3; and a TCR beta chain comprising CDR1 of the amino acid sequence of SEQ ID NO. 4, CDR2 of the amino acid sequence of SEQ ID NO. 5 and CDR3 of the amino acid sequence of SEQ ID NO. 83.
In some embodiments, the isolated tumor-specific TCR, or antigen-binding domain thereof, as described in the first aspect, comprises:
a TCR a chain comprising CDR1 of the amino acid sequence of SEQ ID No. 1, CDR2 of the amino acid sequence of SEQ ID No. 2, and CDR3 of the amino acid sequence of SEQ ID No. 3; and a TCR beta chain comprising CDR1 of the amino acid sequence of SEQ ID NO. 4, CDR2 of the amino acid sequence of SEQ ID NO. 5 and CDR3 of the amino acid sequence of SEQ ID NO. 84.
In some embodiments, the isolated tumor-specific TCR, or antigen-binding domain thereof, as described in the first aspect, comprises:
a TCR a chain comprising CDR1 of the amino acid sequence of SEQ ID No. 1, CDR2 of the amino acid sequence of SEQ ID No. 2, and CDR3 of the amino acid sequence of SEQ ID No. 3; and a TCR beta chain comprising CDR1 of the amino acid sequence of SEQ ID NO. 4, CDR2 of the amino acid sequence of SEQ ID NO. 5 and CDR3 of the amino acid sequence of SEQ ID NO. 85.
Drawings
The following examples are intended to be purely exemplary of the present patent application and therefore should not be considered as limiting the invention in any way. The following examples and detailed description are provided by way of illustration and not by way of limitation.
FIG. 1A shows three exemplary MAGE-A1 specific TCRs which recognize antigen and present MHC of antigen; FIG. 1B shows that the invention shows MAGE-A1 specific TCR constructs (wild type, murine, and murine codon-optimized constructs).
FIGS. 2A-2C show the selection and characterization of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D 08.
FIG. 3 shows HLA restriction assays of T cells expressing MAGE-A1 antigen specific T cell receptor ST09D08 in LCL cell lines.
FIG. 4 shows the characterization of T cells expressing MAGE-A1 antigen specific T cell receptor ST09D 08.
FIG. 5 shows that T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08 were cytotoxic to HLA-A 11:01 and MAGE-A1 protein double positive A549 cell lines in vitro.
FIGS. 6A-B show the selection and characterization of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08-AM 01.
FIG. 7 shows the characterization of T cells expressing MAGE-A1 antigen specific T cell receptor ST09D08 and ST09D08-AM 01.
FIG. 8 shows that T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08-AM01 were cytotoxic to HLA-A 11:01 and MAGE-A1 protein double positive A549 cell lines in vitro.
FIGS. 9A-B show the selection and characterization of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08-AM 03.
FIG. 10 shows the characterization of T cells expressing MAGE-A1 antigen specific T cell receptor ST09D08 and ST09D08-AM 03.
FIG. 11 shows that T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08-AM03 were cytotoxic to HLA-A 11:01 and MAGE-A1 protein double positive A549 cell lines in vitro.
FIGS. 12A-B show the selection and characterization of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08-AM 05.
FIG. 13 shows the characterization of T cells expressing MAGE-A1 antigen specific T cell receptor ST09D08 and ST09D08-AM 05.
FIG. 14 shows that T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08-AM05 were cytotoxic to HLA-A 11:01 and MAGE-A1 protein double positive A549 cell lines in vitro.
FIGS. 15A-B show the selection and characterization of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08-AM 11.
FIG. 16 shows the characterization of T cells expressing MAGE-A1 antigen specific T cell receptor ST09D08 and ST09D08-AM 11.
FIG. 17 shows that T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08-AM11 were cytotoxic to HLA-A 11:01 and MAGE-A1 protein double positive A549 cell lines in vitro.
FIG. 18 shows the selection and characterization of T cells expressing MAGE-A1 antigen specific T cell receptor ST09D08-AM 12.
FIG. 19 shows that T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08-AM12 were cytotoxic to HLA-A 11:01 and MAGE-A1 protein double positive A549 cell lines in vitro.
FIGS. 20A-B show the selection and characterization of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08-AM 14.
FIG. 21 shows the characterization of T cells expressing MAGE-A1 antigen specific T cell receptor ST09D08 and ST09D08-AM 14.
FIG. 22 shows that T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08-AM14 were cytotoxic to HLA-A 11:01 and MAGE-A1 protein double positive A549 cell lines in vitro.
FIGS. 23A-B show the selection and characterization of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08-AM 16.
FIG. 24 shows the characterization of T cells expressing MAGE-A1 antigen specific T cell receptor ST09D08 and ST09D08-AM 16.
FIG. 25 shows that T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08-AM16 were cytotoxic to HLA-A 11:01 and MAGE-A1 protein double positive A549 cell lines in vitro.
Detailed Description
I. Definition of the definition
Before describing the present invention in detail with respect to some preferred embodiments thereof, the following general definitions are provided. Unless otherwise defined as follows, the terms are generally used herein as in the art.
The present invention will be described with respect to particular embodiments and with reference to certain drawings but the invention is not limited thereto but only by the claims, which do not exclude other elements when the term "comprising" is used in the description and in the claims. For the purposes of the present invention, the term "consisting of" is considered to be a preferred embodiment of the term "comprising". If a group is defined hereinafter to include at least a certain number of embodiments, it should also be understood that a group consisting of preferably only these embodiments is disclosed.
For the purposes of the present invention, the term "obtained" is considered to be the preferred embodiment of the term "available". If, in the following, for example, an antibody is defined as being obtainable from a particular source, this is also to be understood as disclosing antibodies obtained from that source.
As used herein, "T cell receptor" or "TCR" refers to an endogenous or engineered T cell receptor that includes an extracellular antigen-binding domain that binds to a specific epitope in an MHC molecule. TCRs may include TCR alpha polypeptide chains and TCR beta polypeptide chains. "tumor-specific TCR" refers to a TCR that specifically recognizes a tumor antigen expressed by a tumor cell. "TCR-T" refers to T cells that express a recombinant TCR. An "antigen binding domain" of a TCR refers to a polypeptide that binds to an antigen with a higher degree of specificity due to its primary, secondary or tertiary sequence and/or post-translational modification and/or charge. The antigen binding domain may be derived from any portion or fragment of a TCR that retains the antigen binding activity of the TCR as part of the TCR. Antigen binding portions encompass, for example, portions of a TCR that retain the ability to specifically bind to the amino acid sequence of MAGE-A1 or a fragment thereof, or to detect, treat, or prevent cancer to a similar extent, to the same extent, or to a greater extent than a wild-type TCR. The TCR antigen-binding domain can comprise, for example, about 10%, about 25%, about 30%, about 50%, about 68%, about 80%, about 90%, about 95% or more of a full-length TCR. The antigen binding domain may comprise an antigen recognition portion of either or both the alpha and beta chains of the TCR, such as a portion comprising one or more of the complementarity determining regions CDR1, CDR2 and CDR3 of the alpha and/or beta chain variable region of the TCR. The antigen binding domain may comprise the following amino acid sequence: CDR1 of the α chain, CDR2 of the α chain, CDR3 of the α chain, CDR1 of the β chain, CDR2 of the β chain, CDR3 of the β chain, or any combination thereof. Preferably, the antigen binding domain comprises the amino acid sequences of CDR1, CDR2 and CDR3 of the α chain or the amino acid sequences of CDR1, CDR2 and CDR3 of the β chain of the TCR; or the amino acid sequences of CDR1, CDR2, CDR3 of all alpha and beta chains. In one embodiment of the invention, the antigen binding portion may comprise, for example, the variable region of a TCR, which comprises a combination of the CDR regions described above. In this regard, the antigen binding portion may comprise the amino acid sequence of the variable region of the α chain of the TCR (vα), the amino acid sequence of the variable region of the β chain (vβ), or both vα and vβ. In one embodiment of the invention, the antigen binding portion may comprise a combination of a variable region and a constant region. In this regard, the antigen binding portion may comprise the full length alpha or beta chain of the TCR, or both the alpha and beta chains.
As used herein, an "immune checkpoint inhibitor" refers to an agent (including antibodies) that inhibits or blocks an inhibitory immune checkpoint molecule on an immune cell (such as a T cell) or a tumor cell. An "immune checkpoint molecule" includes a molecule that increases an immune signal to a tumor cell (i.e., a "co-stimulatory molecule"), or a molecule that decreases an immune signal to a tumor cell (i.e., an "inhibitory immune checkpoint molecule").
As used herein, "treatment" is the manner in which beneficial or desired results (including clinical results) are obtained. For the purposes of the present invention, beneficial or desired clinical results include, but are not limited to, one or more of the following: reducing symptoms caused by yet another disease, reducing the extent of the disease, stabilizing the disease (e.g., preventing or delaying exacerbation of the disease), preventing or delaying the spread of the disease (e.g., metastasis), preventing or delaying the occurrence or recurrence of the disease, delaying or slowing the progression of the disease, ameliorating the disease state, providing (partial or complete) remission of the disease, reducing the dosage of one or more other drugs required to treat the disease, delaying the progression of the disease, increasing quality of life, and/or prolonging survival. Also encompassed by "treatment" is a reduction in the pathological consequences of a disease (e.g., cancer). The methods of the invention contemplate any one or more of these therapeutic aspects.
An "isolated" construct (e.g., MAGE-A1 TCR) as used herein refers to a construct that (1) is not associated with a protein found in nature, (2) is free of other proteins from the same source, (3) is expressed by cells from a different species, or (4) is not found in nature.
The term "isolated nucleic acid" as used herein is intended to mean a nucleic acid of genomic, cDNA or synthetic origin, or some combination thereof, whereby the "isolated nucleic acid" (1) is not associated with all or a portion of a polynucleotide found in nature, (2) is operably linked to a polynucleotide not linked thereto in nature, or (3) is not present in nature as part of a larger sequence.
As used herein, "delaying" the progression of a disease (e.g., cancer) means delaying, impeding, slowing, delaying, stabilizing, and/or delaying the progression of the disease. This delay may be of different lengths of time, depending on the disease history and/or the individual being treated. As will be apparent to those of skill in the art, a sufficient or significant delay may actually encompass prophylaxis, as the individual will not develop the disease. A method of "delaying" the progression of a disease (e.g., cancer) is a method of reducing the likelihood of disease progression in a given period of time and/or reducing the extent of disease in a given period of time when compared to when the method is not used. This simulation is more generally based on clinical studies using statistically significant numbers of individuals. Cancer progression may be detected using standard methods including, but not limited to, computed tomography (CAT scan), magnetic resonance imaging, abdominal ultrasound, coagulation testing, arterial photography, or biopsy. Progression may also refer to progression of the cancer that may be initially undetectable, and includes occurrence, recurrence, and onset.
The terms "individual," "subject," and "patient" are used interchangeably herein to describe a mammal, including a human. Individuals include, but are not limited to, humans, cows, horses, cats, dogs, rodents, or primates. In some embodiments, the subject is a human. In some embodiments, the subject suffers from a disease such as cancer. In some embodiments, the individual is in need of treatment.
As understood in the art, an "effective amount" refers to an amount of a composition (e.g., an engineered immune cell expressing a TCR) sufficient to produce a desired therapeutic outcome (e.g., reduce the severity of, or reduce the duration of, stabilize, or eliminate one or more cancer symptoms). For therapeutic use, beneficial or desired results include, for example, reduction of symptoms (biochemical, histological, and/or behavioral aspects) caused by one or more diseases, including complications and intermediate pathological phenotypes that are present during disease progression; increasing the quality of life of the patient suffering from the disease; reducing the dosage of other medicaments required for treating diseases; enhancing the effect of another drug; delay the progression of the disease; and/or to prolong survival of the patient.
"adjuvant therapy" refers to a clinical setting in which an individual has a history of cancer and has generally (but not necessarily) responded to therapy, including but not limited to surgery (e.g., surgical excision), radiation therapy, and chemotherapy. However, due to their history of cancer, these individuals are considered at risk of developing the disease. Treatment or administration in "adjuvant therapy" refers to a subsequent treatment modality. The degree of risk (e.g., when an individual under adjuvant therapy is considered "high risk" or "low risk") is dependent on a number of factors, most commonly the degree of disease at the time of first treatment.
"neoadjuvant therapy" refers to a clinical setting in which the method is performed prior to primary/definitive therapy.
As used herein, "combination therapy" means that a first agent is administered in combination with another agent. By "in coordination with … …" is meant that one therapeutic modality is administered in addition to another therapeutic modality, such as the compositions described herein (e.g., engineered immune cells expressing a TCR) are administered to the same individual in addition to administration of another agent (such as an immune checkpoint inhibitor). Thus, "co-administered with … …" refers to the administration of one therapeutic modality before, during, or after the delivery of another therapeutic modality to an individual. Such combinations are considered as part of a monotherapy regimen.
As used herein, the term "concurrently administered" means that the first and second therapies in the combination therapy are administered at intervals of no more than about 15 minutes, such as any of no more than about 10, 5, or 1 minute. When the first and second therapies are administered simultaneously, the first and second therapies may be contained in the same composition (e.g., a composition comprising both the first and second therapies) or in different compositions (e.g., the first therapy is contained in one composition and the second therapy is contained in another composition).
As used herein, the term "sequentially administered" means that the first and second therapies in the combination therapy are administered at intervals of more than about 15 minutes, such as more than any of about 20, 30, 40, 50, 60, or more minutes. The first therapy or the second therapy may be administered first. The first and second therapies may be contained in different compositions, such different compositions may be contained in the same or different packages or kits.
As used herein, the term "concurrent administration" means that administration of a first therapy and administration of a second therapy in a combination therapy overlap with each other.
As used herein, "pharmaceutically acceptable" or "pharmacologically compatible" means that the material is not biologically or otherwise undesirable, e.g., the material may be incorporated into a pharmaceutical composition for administration to an individual without causing any significant undesirable biological effects or interacting in a deleterious manner with any of the other components of the composition in which it is contained. The pharmaceutically acceptable carrier or excipient preferably has met the desired toxicological testing criteria and manufacturing testing criteria, and/or includes guidelines for inactive ingredients made by the U.S. food and drug administration.
The following definitions may be used to evaluate target lesion-based responses: "complete response" or "CR" refers to the disappearance of all target lesions; "partial response" or "PR" means a reduction of at least 30% in the sum of the longest diameters of the target lesions, referenced to a baseline SLD; "disease stabilization" or "SD" refers to a decrease in target lesions that is insufficient to meet the conditions of PR, an increase that is insufficient to meet the conditions of PD, and a minimum point SLD since the onset of self-administration is taken as a reference; and "disease progression" or "PD" refers to an increase in SLD of a target lesion of at least 20% (which is referenced to the lowest point SLD recorded since the onset of the lesion), or the presence of one or more new lesions.
The following definitions of response assessment can be used to assess non-target lesions: "complete response" or "CR" refers to the disappearance of all non-target lesions; "disease-stable" or "SD" refers to the persistent presence of one or more non-target lesions that do not meet the conditions of CR or PD; and "disease progression" or "PD" refers to the "clear progression" of existing non-target lesion(s), or the occurrence of one or more new lesions is considered as disease progression (additional criteria need to be met if an individual's PD is assessed for a point in time based entirely on the progression of non-target lesion (s)).
As used herein, the terms "cell," "cell line," and "cell culture" are used interchangeably and all such designations include progeny. It is understood that the DNA content of all progeny may not be exactly the same due to artificial or unexpected mutations. Variant progeny that have the same function or biological activity as the original cell are included.
As used herein, the terms "specifically bind to", "recognize", "specifically recognize", "target", or "specific for … …" refer to a measurable and reproducible interaction, such as binding between a target and an antibody, or between a receptor and a ligand, or between a receptor and an epitope/MHC complex, that determines the presence of a target in the presence of a heterogeneous population of molecules (including biomolecules). For example, a TCR that binds or specifically binds to an epitope of interest is a TCR that binds to an epitope/MHC complex of interest with greater affinity, binding, more readily, and/or for a longer duration than it binds to other epitope/MHC complexes. In one embodiment, the extent of binding of the TCR to the unrelated epitope/MHC complex is less than about 10% of the binding of the TCR to the epitope/MHC complex of interest, as measured (e.g., by Radioimmunoassay (RIA)). In certain embodiments, a TCR that specifically binds to an epitope of interest (i.e., an epitope of interest/MHC complex) has a dissociation constant (Kd) of 1 [ mu ] M, 100 nM, 10 nM, 1 nM, or 0.1 nM. In certain embodiments, the TCR specifically binds to an epitope on a protein that is conserved among proteins from different species. In another embodiment, specific binding may include, but need not be, exclusive binding.
The term "isolated nucleic acid" as used herein is intended to mean a nucleic acid of genomic, cDNA, or synthetic origin, or some combination thereof, that is (1) not associated with all or part of a polynucleotide in which the "isolated nucleic acid" is found in nature, (2) is operably linked to a polynucleotide to which it is not linked in nature, or (3) does not exist in nature as part of a larger sequence due to its origin.
It is understood that the aspects and embodiments of the invention described herein include aspects and embodiments consisting of … … and/or consisting essentially of … ….
Reference herein to "about" a value or parameter includes (and describes) variations with respect to the value or parameter itself. For example, a description referring to "about X" includes a description of "X".
The term "about X to Y" as used herein has the same meaning as "about X to about Y".
As used herein, reference to "not/not" as a value or parameter generally means and describes a value or parameter "outside. For example, the method not being used to treat cancer of type X means that the method is used to treat cancer of a type other than X.
As used herein and in the appended claims, the singular forms "a," "an," and "the" include plural referents unless the context clearly dictates otherwise.
II MAGE-A1 tumor specific TCR
The present application provides TCRs that specifically recognize tumor MAGE-A1 and/or specifically recognize MHC/MAGE-A1 epitope complexes. In some embodiments, the tumor-specific TCR specifically recognizes MAGE-A1. In some embodiments, the tumor-specific TCR specifically recognizes the MHC/MAGE-A1 epitope complex. Nucleic acids and vectors encoding tumor-specific TCRs, engineered immune cells expressing tumor-specific TCRs are also within the scope of the present application.
Exemplary TCRs identified using the methods described herein are shown in table 1 below. V, J, C section is named according to IMGT database. Other nomenclature and segmentation algorithms known in the art may be used. See, e.g., lefranc, m. -p., the immunology, 7, 132-136 (1999), world wide web. IMGT, org/imgtscientific Chart/document/IMGT-frcddefined. CDR1, CDR2, and CDR3 of an exemplary TCR are shown in the "sequence listing" section.
Table 1: exemplary tumor-specific TCRs
In some embodiments, a MAGE-A1 tumor specific TCR or antigen binding domain thereof is provided that specifically binds to an epitope of a MAGE-A1 peptide, such as a MAGE-A1 epitope comprising the amino acid sequence of SEQ ID NO. 93. In some embodiments, the MAGE-A1 tumor specific TCR or antigen binding domain thereof specifically binds to a MAGE-A1 epitope comprising the amino acid sequence of SEQ ID NO. 93. In some embodiments, a MAGE-A1 tumor specific TCR or antigen binding domain thereof is provided that specifically binds to a MAGE-A1 peptide/MHC complex wherein MAGE-A1 comprises the MAGE-A1 epitope of the amino acid sequence of SEQ ID NO: 93. In some embodiments, the MHC protein in the MAGE-A1 peptide/MHC complex is an MHC-class I protein. In some embodiments, the MHC class I protein is HLA-A. In some embodiments, HLA-A is HLA-A x 11:01. In some embodiments, the target antigen of an effector cell (e.g., T cell) that expresses a MAGE-A1 tumor specific TCR or antigen binding domain thereof on the surface is MAGE-A1 96-104 Peptide/mhc i a 11:01 complex.
In some embodiments, there is provided a MAGE-A1 tumor specific TCR or antigen binding domain thereof comprising the amino acid sequence of any one of SEQ ID NOs 3, 6, 17, 20, 31, 34, 79-85. In some embodiments, there is provided a MAGE-A1 tumor specific TCR, or an antigen binding domain thereof, comprising: (a) A TCR a CDR3 having at least about 90% sequence identity (e.g., 100% identity) to SEQ ID No. 3; and a TCR beta CDR3 having at least about 90% sequence identity (e.g., 100% identity) to SEQ ID No. 6; (b) A TCR a CDR3 having at least about 90% sequence identity (e.g., 100% identity) to SEQ ID No. 17; and a TCR beta CDR3 having at least about 90% sequence identity (e.g., 100% identity) to SEQ ID No. 20; (c) A TCR a CDR3 having at least about 90% sequence identity (e.g., 100% identity) to SEQ ID No. 31; and a TCR.beta.CDR 3 having at least about 90% sequence identity (e.g., 100% identity) to SEQ ID NO: 34; (d) A TCR a CDR3 having at least about 90% sequence identity (e.g., 100% identity) to SEQ ID No. 79 or 80; and a TCR.beta.CDR 3 having at least about 90% sequence identity (e.g., 100% identity) to any one of SEQ ID NOS: 81-85. Wherein the MAGE-A1 tumor specific TCR comprising the amino acid sequence set forth in SEQ ID NO. 79-85 or antigen binding domain thereof has a higher affinity.
In some embodiments, there is provided a MAGE-A1 tumor specific TCR or antigen binding domain thereof comprising a TCR alpha chain comprising CDR1, CDR2, and CDR3 of any of the amino acid sequences of SEQ ID NO 9, 23, or 37.
In some embodiments, there is provided a MAGE-A1 tumor specific TCR or antigen binding domain thereof comprising a TCR β chain comprising CDR1, CDR2, and CDR3 of any of the amino acid sequences of SEQ ID NO 12, 26, or 40.
In some embodiments, there is provided a MAGE-A1 tumor specific TCR, or an antigen binding domain thereof, comprising: a TCR alpha chain comprising CDRs of any one of the amino acid sequences of SEQ ID NOs 9, 23, or 37; and a TCR beta chain comprising the CDRs of any one of the amino acid sequences of SEQ ID NO 12, 26, or 40.
The tumor-specific TCRs described herein, or antigen binding domains thereof, also include TCR constant domains. In some embodiments, the tumor-specific TCR, or antigen-binding domain thereof, comprises: a TCR alpha chain comprising a TCR alpha constant domain (TRAC) of any of SEQ ID NOs 9, 23, 37, or a variant thereof; and a TCR β chain comprising any of the amino acid sequences of SEQ ID NOs 12, 26, 40, a TCR β constant domain (TRBC), or a variant thereof. In some embodiments, the tumor-specific TCR, or antigen-binding domain thereof, comprises: human TRAC and human TRBC, such as human C.alpha.and human C.beta.1, or human C.alpha.and human C.beta.2. In some embodiments, the tumor-specific TCR, or antigen-binding domain thereof, comprises murine TRAC and murine TRBC, such as murine cα and murine cβ1, or murine cα and murine cβ2.
In some embodiments, the MAGE-A1 tumor specific TCR, or antigen binding domain thereof, is a human TCR. In some embodiments, the MAGE-A1 tumor specific TCR, or antigen binding domain thereof, is a chimeric TCR, such as a murine TCR, e.g., a TCR comprising a murine constant region of the TCR a chain and the β chain. In some embodiments, the MAGE-A1 tumor specific TCR, or antigen binding domain thereof, comprises a human TCR variable region, as well as a TCR constant region from a non-human species (such as a mouse).
In some embodiments, there is provided a MAGE-A1 tumor specific TCR, or an antigen binding domain thereof, comprising: a TCR a chain comprising an amino acid sequence that is at least about 80% identical (e.g., at least about any of 85%, 90%, 95%, 98%, or more identical, or 100% identical) to any of the amino acid sequences of SEQ ID NOs 9, 23, and 37; and a TCR β chain comprising an amino acid sequence having at least about 80% identity (e.g., any of at least about 85%, 90%, 95%, 98%, or more identity, or having 100% identity) to any of the amino acid sequences of SEQ ID NOs 12, 26, and 40.
Also provided is an isolated nucleic acid encoding the TCR alpha chain and/or the TCR beta chain of a tumor-specific TCR or an antigen-binding domain thereof according to any of the tumor-specific TCRs or antigen-binding domains thereof described above; a vector comprising the isolated nucleic acid(s). In some embodiments, the isolated nucleic acid is a murine nucleic acid sequence. In some embodiments, the isolated nucleic acid is a sequence-optimized murine nucleic acid sequence.
Immune cells expressing MAGE-A1 tumor specific TCR or antigen binding domain thereof
One aspect of the present application provides an engineered immune cell comprising a tumor-specific TCR or antigen-binding domain thereof, an isolated nucleic acid, or a vector according to any of the above.
The present application provides engineered immune cells expressing MAGE-A1 tumor specific TCRs or antigen binding domains thereof. In some embodiments, an effector cell (e.g., T cell) is provided that presents any of the MAGE-A1 tumor specific TCRs or antigen binding domains thereof according to the disclosure on its surface. In some embodiments, the effector cell comprises a nucleic acid encoding a MAGE-A1 tumor specific TCR, or antigen binding domain thereof, wherein the MAGE-A1 tumor specific TCR, or antigen binding domain thereof, is expressed from the nucleic acid and localized to the surface of the effector cell. In some embodiments, the MAGE-A1 tumor specific TCR, or antigen binding domain thereof, is exogenously expressed and combined with effector cells. In some embodiments, the effector cell is a T cell. In some embodiments, the effector cell is selected from the group consisting of: cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells.
Cell modifications for disrupting gene expression include any such techniques known in the art including, for example, RNA interference (e.g., siRNA, shRNA, miRNA), gene editing (e.g., CRISPR or TALEN based gene knockout), and the like. For example, in some embodiments, an effector cell (e.g., T cell) is provided comprising a nucleic acid encoding any of the MAGE-A1 tumor-specific TCRs or antigen binding domains thereof described herein, wherein the MAGE-A1 tumor-specific TCRs or antigen binding domains thereof are expressed from the nucleic acid and localized to the surface of the effector cell. In some embodiments, an effector cell (e.g., T cell) is provided that comprises a first nucleic acid sequence encoding a first polypeptide chain of a MAGE-A1 tumor specific TCR or antigen binding domain thereof and a second nucleic acid sequence encoding a second polypeptide chain of a MAGE-A1 tumor specific TCR or antigen binding domain thereof. In some embodiments, the nucleic acid encoding a MAGE-A1 tumor specific TCR or antigen binding domain thereof is on a vector. In some embodiments, the first nucleic acid sequence is located on a first vector and the second nucleic acid sequence is located on a second vector. In some embodiments, the first and second nucleic acid sequences are located on the same vector. The vector may be selected from, for example, mammalian expression vectors and viral vectors (e.g., vectors derived from retroviruses, adenoviruses, adeno-associated viruses, herpesviruses, and lentiviruses). In some embodiments, the vector is integrated into the host genome of the effector cell. In some embodiments, the nucleic acid sequence encoding a MAGE-A1 tumor specific TCR or antigen binding domain thereof is under the control of a promoter. In some embodiments, the first nucleic acid sequence is under the control of a first promoter and the second nucleic acid sequence is under the control of a second promoter. In some embodiments, the first and second promoters have the same sequence. In some embodiments, the first and second promoters have different sequences. In some embodiments, the first and second nucleic acids are under the control of a single promoter. In some embodiments, the first, second, and/or single promoter is an inducible promoter. In some embodiments, the promoter is an inducible promoter. In some embodiments, the expression of the first polypeptide chain is substantially the same as the expression of the second polypeptide chain. In some embodiments, the expression of the first polypeptide chain is at least about two (e.g., at least about any of 2, 3, 4, 5, or more) times greater than the expression of the second polypeptide chain. In some embodiments, the expression of the first polypeptide chain is no more than about 1/2 (e.g., no more than about any of 1/2, 1/3, 1/4, 1/5, or less) of the expression of the second polypeptide chain.
Expression of a MAGE-1 tumor specific TCR or antigen binding domain thereof can be determined from mRNA or protein levels. The expression level of mRNA can be determined by measuring the amount of mRNA transcribed from the nucleic acid using various well known methods including Northern immunoblotting, quantitative RT-PCR, microarray analysis, and the like. Protein expression levels can be measured by known methods, including immunocytochemistry staining, enzyme-linked immunosorbent assay (ELISA), western blot analysis, luminescence analysis, mass spectrometry, high performance liquid chromatography, high pressure liquid chromatography-tandem mass spectrometry, and the like.
In some embodiments, a MAGE-A1 tumor-specific TCR or antigen binding domain thereof effector cell (e.g., a T cell) is provided that expresses any of the MAGE-A1 tumor-specific TCRs or antigen binding domains thereof described herein on its surface, wherein the MAGE-A1 tumor-specific TCR or antigen binding domain thereof effector cell comprises a host genome-integrated mammalian expression vector and viral vector (e.g., vectors derived from retroviruses, adenoviruses, adeno-associated viruses, herpesviruses, and lentiviruses) comprising a first nucleic acid sequence encoding a first polypeptide chain of the MAGE-A1 tumor-specific TCR or antigen binding domain thereof and a second nucleic acid sequence encoding a second polypeptide chain of the MAGE-A1 tumor-specific TCR or antigen binding domain thereof. In some embodiments, there is a promoter operably linked to the 5' end of the first nucleic acid sequence, and there is a nucleic acid linker selected from the group consisting of an Internal Ribosome Entry Site (IRES) and a nucleic acid encoding a self-cleaving 2A peptide (e.g., P2A, T2A, E a or F2A) to link the 3' end of the first nucleic acid sequence to the 5' end of the second nucleic acid sequence, wherein the first nucleic acid sequence and the second nucleic acid sequence are transcribed into a single RNA under the control of the promoter. In some embodiments, there is a promoter operably linked to the 5' end of the second nucleic acid sequence, and there is a nucleic acid linker selected from the group consisting of an Internal Ribosome Entry Site (IRES) and a nucleic acid encoding a self-cleaving 2A peptide (e.g., P2A, T2A, E a or F2A) to link the 3' end of the second nucleic acid sequence to the 5' end of the first nucleic acid sequence, wherein the first nucleic acid sequence and the second nucleic acid sequence are transcribed into a single RNA under the control of the promoter. In some embodiments, the 2A peptide is P2A. In some embodiments, the promoter is an inducible promoter. In some embodiments, the effector cell is selected from the group consisting of: cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells.
In some embodiments, an effector cell (e.g., a T cell) is provided that expresses a MAGE-A1 tumor specific TCR on a surface, comprising a) a first nucleic acid sequence encoding a first polypeptide chain comprising the amino acid sequence of SEQ ID No. 9 and b) a second nucleic acid sequence encoding a second polypeptide chain comprising the amino acid sequence of SEQ ID No. 12; and/or c) a first nucleic acid sequence encoding a first polypeptide chain comprising the amino acid sequence of SEQ ID NO. 23 and d) a second nucleic acid sequence encoding a second polypeptide chain comprising the amino acid sequence of SEQ ID NO. 26; and/or e) a first nucleic acid sequence encoding a first polypeptide chain comprising the amino acid sequence of SEQ ID NO. 37 and f) a second nucleic acid sequence encoding a second polypeptide chain comprising the amino acid sequence of SEQ ID NO. 40. In some embodiments, effector cells expressing a MAGE-A1 tumor specific TCR or antigen binding domain thereof further comprise a P2A nucleic acid sequence encoding SEQ ID NOs: 13, 27, 41. In some embodiments, an effector cell (e.g., T cell) is provided that expresses a MAGE-A1 tumor specific TCR or antigen binding domain thereof on a surface comprising a nucleic acid sequence encoding the amino acid sequence of one or more of SEQ ID NOs 14, 28, 42.
In some embodiments, the target antigen of an effector cell (e.g., a T cell) that expresses a MAGE-A1 tumor specific TCR or antigen binding domain thereof on the surface is a MAGE-A1 peptide/MHC complex. In some embodiments, the MHC protein in the MAGE-A1 peptide/MHC complex is an MHC-class I protein. In some embodiments, the MHC class I protein is HLA-A. In some embodiments, HLA-A is a 11:01. In some embodiments, the effector cell is a γδ T cell. In some embodiments, the effector cell is an αβ T cell. In some embodiments, the effector cell is selected from the group consisting of: cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells. In some embodiments, the target antigen of an effector cell (e.g., T cell) that expresses a MAGE-A1 tumor specific TCR or antigen binding domain thereof on a surface is MAGE-A1 96-104 Peptide/mhc i a 11:01 complex. In some embodiments, the immune cell is a T cell. In some embodiments, a pharmaceutical composition is provided that includes an engineered immune cell according to any of the engineered immune cells described above, and a pharmaceutically acceptable carrier.
Preparation of effector cells expressing MAGE-A1 TCR or antigen binding Domain thereof
In some embodiments, in one aspect, the invention provides effector cells (e.g., lymphocytes, e.g., T cells) that express a MAGE-A1 tumor-specific TCR, or an antigen binding domain thereof. Provided herein are exemplary methods of making effector cells (e.g., MAGE-A1 tumor-specific TCR effector cells, e.g., MAGE-A1 tumor-specific TCRT cells) that express a MAGE-A1 tumor-specific TCR or antigen binding domain thereof. In some embodiments, a MAGE-A1 tumor-specific TCR effector cell (e.g., a MAGE-A1 tumor-specific TCRT cell) can be produced by introducing into the effector cell one or more nucleic acids (including, for example, lentiviral vectors) encoding a MAGE-A1 tumor-specific TCR or antigen binding domain thereof (e.g., any of the MAGE-A1 tumor-specific TCRs or antigen binding domains thereof described herein) that specifically bind to a target antigen (e.g., a disease-associated antigen). The introduction of one or more nucleic acids into an effector cell may be accomplished using techniques known in the art, such as those described herein for nucleic acids. In some embodiments, the MAGE-A1 tumor-specific TCR effector cells of the invention (e.g., MAGE-A1 tumor-specific TCRT cells) are capable of replication in vivo, resulting in long-term persistence that can facilitate sustained control of a disease (e.g., cancer) associated with expression of a target antigen.
In some embodiments, the invention relates to the use of lymphocyte infusion to administer genetically modified T cells that express a MAGE-A1 tumor specific TCR, or any of its antigen binding domains, according to the disclosure, to treat a patient suffering from or at risk of suffering from a disease and/or disorder associated with expression of a target antigen (also referred to herein as a "target antigen positive" or "TA positive" disease or disorder), including, for example, cancer. In some embodiments, autologous lymphocyte infusion is used in the treatment. Autologous PBMCs are collected from the patient in need of treatment and T cells are activated and expanded using methods described herein and known in the art and then infused back into the patient. In some embodiments, a T cell (also referred to herein as a "MAGE-A1 tumor-specific TCRT cell") is provided that expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that specifically binds to a target antigen according to any of the MAGE-A1 tumor-specific TCRs or antigen binding domains thereof described herein. The MAGE-A1 tumor-specific TCRT cells of the invention can undergo robust in vivo T cell expansion and can establish target antigen-specific memory cells that persist in blood and bone marrow for a prolonged period of time at high levels. In some embodiments, MAGE-A1 tumor specific TCRT cells of the invention infused into a patient can deplete cells presenting a target antigen in vivo in a patient with a target antigen-associated disease, e.g., cancer cells presenting the target antigen. In some embodiments, the MAGE-A1 tumor-specific TCRT cells of the invention infused into a patient can eliminate in vivo cells presenting a target antigen, such as cancer cells presenting a target antigen, in a patient having a target antigen-related disorder that is difficult to treat with at least one known therapy.
Prior to T cell expansion and genetic modification, a T cell source is obtained from an individual. T cells can be obtained from a variety of sources including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from an infection site, ascites, pleural effusion, spleen tissue, and tumors. In some embodiments of the invention, any number of T cell lines available in the art may be used. In some embodiments of the invention, T cells may be obtained from blood units collected from an individual using any number of techniques known to those skilled in the art (e.g., ficoll ™ isolation). In some embodiments, cells from the circulating blood of the individual are obtained by blood cell separation (apheresis). The blood cell separation product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated leukocytes, erythrocytes, and platelets. In some embodiments, cells collected by blood cell separation may be washed to remove plasma fractions and placed in an appropriate buffer or medium for subsequent processing steps. In some embodiments, the cells are washed with Phosphate Buffered Saline (PBS). In some embodiments, the wash solution lacks calcium and may lack magnesium or may lack many, if not all, divalent cations. As will be readily appreciated by those skilled in the art, the washing step may be accomplished by methods known to those skilled in the art, for example, by using semi-automated "flow-through" centrifugation (e.g., cobe 2991 cell processor Baxter CytoMate or Haemonetics cell holder 5) according to manufacturer's instructions. After washing, the cells may be resuspended in a variety of biocompatible buffers, such as ca2+ free, mg2+ free PBS, plasmaLyteA or other physiological saline solution with or without buffers. Alternatively, the undesired components of the blood cell separation sample may be removed and the cells resuspended directly in culture medium.
In some embodiments, T cells are isolated from peripheral blood lymphocytes by lysing the erythrocytes and elutriating the depleted monocytes, e.g., by gradient centrifugation through PERCOLL ™ or by countercurrent centrifugation. Specific subsets of T cells (e.g., cd3+, cd28+, cd4+, cd8+, cd45ra+ and cd45ro+ T5 cells) can be further isolated by positive selection or negative selection techniques. For example, in some embodiments, T cells are isolated by incubating with anti-CD 3/anti-CD 28 (i.e., 3X 28) bound beads (e.g., DYNABEADS cube M-450CD3/CD 28T) for a period of time sufficient to positively select for the desired T cells. In some embodiments, the period of time is about 30 minutes. In some embodiments, the period of time is in the range of 30 minutes to 36 hours or longer (including all ranges between these values). In some embodiments, the period of time is at least 1, 2, 3, 4, 5, or 6 hours. In some embodiments, the period of time is from 10 to 24 hours. In some embodiments, the incubation period is 24 hours. Regarding the isolation of T cells from patients with leukemia, the use of longer incubation times (e.g., 24 hours) can increase cell yield. Longer incubation times may be used to isolate T cells in any situation where fewer T cells are present than other cell types, such as isolating Tumor Infiltrating Lymphocytes (TILs) from tumor tissue or immunocompromised individuals. In addition, the use of longer incubation times can increase the efficiency of cd8+ T cell capture. Thus, by only shortening or extending the time allowed for T cells to bind to CD3/CD28 beads and/or by increasing or decreasing the bead to T cell ratio, T cell subpopulations can be preferentially selected for or against other time points at the beginning of the culture or during the process. In addition, by increasing or decreasing the ratio of anti-CD 3 and/or anti-CD 28 antibodies on the beads or other surfaces, T cell subsets can be preferentially selected for or against at the beginning of culture or at other desired time points. Those skilled in the art will recognize that multiple selection wheels may also be used in the context of the present invention. In some embodiments, it may be desirable to perform a selection procedure and use "unselected" cells in the activation and expansion process. The "unselected" cells may also undergo other selection rounds.
Enrichment of T cell populations by negative selection can be achieved using a combination of antibodies directed against surface markers specific for the negative selection cells. One approach is to sort and/or select cells via negative magnetic immunoadhesion or flow cytometry using a monoclonal antibody mixture directed against cell surface markers present on negatively selected cells. For example, to enrich for cd4+ cells by negative selection, monoclonal antibody mixtures typically include antibodies directed against CD14, CD20, CD11b, CD16, HLA-DR, and CD 8. In some embodiments, it may be desirable to enrich for or forward select regulatory T cells that normally express cd4+, cd25+, cd62lhi, gitr+ and foxp3+. Alternatively, in some embodiments, T regulatory cells are depleted by anti-CD 25 binding beads or other similar selection methods.
To isolate a desired cell population by positive or negative selection, the cell concentration and surface (e.g., particles, such as beads) may be varied. In some embodiments, it may be desirable to significantly reduce the volume of the beads and cells mixed together (i.e., increase the cell concentration) to ensure maximum contact of the cells and beads. For example, in some embodiments, a concentration of about 20 hundred million cells/ml is used. In some embodiments, a concentration of about 10 hundred million cells/ml is used. In some embodiments, greater than about 100,000,000 cells/ml are used. In some embodiments, a cell concentration of any of about 10,000,000, 15,000,000, 20,000,000, 25,000,000, 30,000,000, 35,000,000, 40,000,000, 45,000,000, or 50,000,000 cells/milliliter is used. In some embodiments, a cell concentration of any of about 75,000,000, 80,000,000, 85,000,000, 90,000,000, 95,000,000, or 100,000,000 cells/ml is used. In some embodiments, a concentration of about 125,000,000 or about 150,000,000 cells/ml is used. The use of high concentrations can result in increased cell yield, cell activation, and cell expansion. In addition, the use of high cell concentrations allows for more efficient capture of cells that may weakly express the target antigen of interest (e.g., CD28 negative T cells) or from samples where many tumor cells are present (i.e., leukemia blood, tumor tissue, etc.). Such cell populations may be of therapeutic value and are desirably available. For example, the use of high cell concentrations allows for more efficient selection of cd8+ T cells that typically have weaker CD28 expression.
In some embodiments of the invention, the T cells are obtained directly from the patient after treatment. In this regard, it has been observed that after certain cancer treatments, particularly after treatment with drugs that disrupt the immune system, the quality of the T cells obtained may be optimal or its ability to expand ex vivo is improved shortly after treatment during the period in which the patient will normally resume the therapy. Also, enhanced transplantation and in vivo expansion of these cells may be in a preferred state after ex vivo manipulation using the methods described herein. Thus, the context of the present invention encompasses the collection of blood cells (including T cells), dendritic cells, or other cells of the hematopoietic lineage during this recovery phase. Furthermore, in some embodiments, movement (e.g., movement with GM-CSF) and modulation schemes may be used to establish conditions in an individual, wherein it is desirable to re-proliferate, re-circulate, regenerate and/or expand specific cell types, particularly during a defined time window after treatment. Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system. Whether before or after genetically modifying T cells to express a desired MAGE-A1 tumor specific TCR or antigen binding domain thereof, T cells can generally be activated and expanded using methods such as those described, for example, in: U.S. patent No. 6,352,694;6,534,055;6,905,680;6,692,964;5,858,358;6,887,466;6,905,681;7,144,575;7,067,318;7,172,869;7,232,566;7,175,843;5,883,223;6,905,874;6,797,514;6,867,041; U.S. patent application publication No. 20060121005.
In general, T cells of the invention are expanded by contact with a surface to which are attached agents that stimulate a CD3/TCR complex-associated signal and ligands that stimulate costimulatory molecules on the surface of the T cell. In particular, the T cell population may be stimulated, for example, by contact with an anti-CD 3 antibody or antigen binding domain thereof, or an anti-CD 2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) that is bound to a calcium ionophore. To co-stimulate the accessory molecules on the surface of the T cells, ligands that bind the accessory molecules are used. For example, a population of T cells may be contacted with an anti-CD 3 antibody and an anti-CD 28 antibody under conditions suitable to stimulate T cell proliferation. anti-CD 3 antibodies and anti-CD 28 antibodies in order to stimulate proliferation of cd4+ T cells or cd8+ T cells. Examples of anti-CD 28 antibodies include 9.3, B-T3, XR-CD28 (DiaClone, besan ç on, france), and other methods generally known in the art may be used (Berg et al, transplantProc.30 (8): 3975-3977,1998; haanen et al, J.exp. Med.190 (9): 13191328,1999; garland et al, J.Immunol Meth.227 (1-2): 53-63,1999).
Genetic modification
In some embodiments, a MAGE-A1 tumor-specific TCR effector cell of the invention (e.g., a MAGE-A1 tumor-specific TCRT cell) is produced by transducing the effector cell (e.g., a T cell prepared by a method described herein) with a viral vector encoding a MAGE-A1 tumor-specific TCR as described herein. Viral vector delivery systems include DNA and RNA viruses that have episomal or integrated genomes after delivery to effector cells. For a review of gene therapy procedures, see Anderson, science256:808-813 (1992); nabel and Feigner, TIBTECH11:211-217 (1993); mitani and Caskey, TIBTECH11:162-166 (1993); dillon, TIBTECH11:167-175 (1993); miller, 5Nature357:455-460 (1992); vanBrunnt, biotechnology6 (10): 1149-1154 (1988); vigne, restorative Neurology andNeuroscience 8:35-36 (1995); kremer and Perricaudet, british Medical Bulletin (l): 31-44 (1995); and Yu et al, gene Therapy1:13-26 (1994). In some embodiments, the viral vector is a lentiviral vector, and the MAGE-A1 tumor specific TCR effector cell comprises a lentiviral vector integrated into the genome of the MAGE-A1 tumor specific TCR effector cell. In some embodiments, the MAGE-A1 tumor-specific TCR effector cell is a MAGE-A1 tumor-specific TCRT cell comprising a lentiviral vector integrated into its genome. In some embodiments, the MAGE-A1 tumor specific TCR effector cells are T cells modified to block or reduce expression of one or both of the endogenous TCR chains. For example, in some embodiments, the MAGE-A1 tumor-specific TCR effector cells are αβt cells modified to block or reduce expression of TCR α and/or β chains, or the MAGE-A1 tumor-specific TCR effector cells are γδ T cells modified to block or reduce expression of TCR γ and/or δ chains. Cell modifications for disrupting gene expression include any such techniques known in the art including, for example, RNA interference (e.g., siRNA, shRNA, miRNA), gene editing (e.g., CRISPR or TALEN based gene knockout), and the like.
In some embodiments, the CRISPR/Cas system is used to generate MAGE-A1 tumor specific TCRT cells with reduced expression of one or both of the T cell's endogenous TCR chains. For reviews of gene-edited CRISPR/Cas systems, see, e.g., jianW and Marraffini LA, annu. Rev. Microbiol.69,2015; hsuPD et al, cell, 157 (6): 1262-1278,2014; and O' ConnellMR et al Nature516:263-266,2014. In some embodiments, MAGE-A1 tumor specific TCRT cells that produce reduced expression of one or both of the T cell's endogenous TCR chains are edited using a TALEN-based genome.
Enrichment
In some embodiments, a method of enriching a heterogeneous population of cells for MAGE-A1 tumor-specific TCR effector cells according to any of the MAGE-A1 tumor-specific TCR effector cells described herein is provided. Specific subsets of MAGE-A1 tumor-specific TCR effector cells (e.g., MAGE-A1 tumor-specific TCRT cells) that specifically bind to a target antigen can be enriched by forward selection techniques. For example, in some embodiments, MAGE-A1 tumor-specific TCR effector cells (e.g., MAGE-A1 tumor-specific TCR-expressing T cells) are enriched by incubating with beads that bind to a target antigen for a period of time sufficient to positively select for the desired MAGE-A1 tumor-specific TCR effector cells. In some embodiments, the period of time is about 30 minutes. In some embodiments, the period of time is in the range of 30 minutes to 36 hours or longer (including all ranges between these values). In some embodiments, the period of time is at least 1, 2, 3, 4, 5, or 6 hours. In some embodiments, the period of time is from 10 to 24 hours. In some embodiments, the incubation period is 24 hours. Regarding the isolation of MAGE-A1 tumor specific TCR effector cells present in low levels in heterogeneous cell populations, the use of longer incubation times (e.g., 24 hours) can increase cell yield. Longer incubation times may be used to isolate MAGE-A1 tumor-specific TCR effector cells in any situation where there are fewer MAGE-A1 tumor-specific TCR effector cells than other cell types.
Those skilled in the art will recognize that multiple selection wheels may also be used in the context of the present invention. To isolate a desired MAGE-A1 tumor-specific TCR effector cell population by positive or negative selection, the cell concentration and surface (e.g., particles, such as beads) can be varied. In some embodiments, it may be desirable to significantly reduce the volume of the beads and cells mixed together (i.e., increase the cell concentration) to ensure maximum contact of the cells and beads. For example, in some embodiments, a concentration of about 20 hundred million cells/ml is used. In some embodiments, a concentration of about 10 hundred million cells/ml is used. In some embodiments, greater than about 1 hundred million cells/ml are used. In some embodiments, a cell concentration of any of about 10,000,000, 15,000,000, 20,000,000, 25,000,000, 30,000,000, 35,000,000, 40,000,000, 45,000,000, or 50,000,000 cells/milliliter is used. In some embodiments, a cell concentration of any of about 75,000,000, 80,000,000, 85,000,000, 90,000,000, 95,000,000, or 100,000,000 cells/ml is used. In some embodiments, a concentration of about 125,000,000 or about 150,000,000 cells/ml is used. The use of high concentrations can result in increased cell yield, cell activation, and cell expansion. Furthermore, the use of high cell concentrations allows for more efficient capture of MAGE-A1 tumor-specific TCR effector cells that may weakly express the MAGE-A1 tumor-specific TCR or antigen binding domain thereof.
In some of any of such embodiments described herein, the enrichment results in minimal or substantially no depletion of MAGE-A1 tumor specific TCR effector cells. For example, in some embodiments, the enrichment results in depletion of less than about 50% (e.g., less than about any of 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, or 5%) of the MAGE-A1 tumor-specific TCR effector cells. Effector cell depletion can be determined by any means known in the art, including any means described herein. In some of any of such embodiments described herein, the enrichment results in minimal or substantially no final differentiation of MAGE-A1 tumor specific TCR effector cells. For example, in some embodiments, the enrichment results in less than about 50% (e.g., less than about any of 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, or 5%) of the MAGE-A1 tumor-specific TCR effector cells undergoing final differentiation. Effector cell differentiation may be determined by any means known in the art, including any means described herein.
In some of any of such embodiments described herein, the enrichment results in minimal or substantially no internalization of the MAGE-A1 tumor specific TCR or antigen binding domain thereof on the MAGE-A1 tumor specific TCR effector cells. For example, in some embodiments, the enrichment results in internalization of less than about 50% (e.g., less than about any of 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, or 5%) of the MAGE-A1 tumor-specific TCR, or antigen binding domain thereof, on the MAGE-A1 tumor-specific TCR effector cell. Internalization of the MAGE-A1 tumor specific TCR or antigen binding domain thereof on a MAGE-A1 tumor specific TCR effector cell can be determined by any means known in the art, including any means described herein.
In some of any of the embodiments described herein, the enrichment results in increased proliferation of MAGE-A1 tumor specific TCR effector cells. For example, in some embodiments, the enrichment results in an increase in the number of MAGE-A1 tumor specific TCR effector cells by at least about 10% (e.g., any of at least about 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 200%, 300%, 400%, 500%, 1000% or more) after the enrichment. Thus, in some embodiments, there is provided a method of enriching a heterogeneous population of cells for MAGE-A1 tumor-specific TCR effector cells expressing a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that specifically binds to a target antigen, comprising: a) Contacting a heterogeneous population of cells with a ligand comprising a target antigen or one or more epitopes contained therein to form a complex comprising MAGE-A1 tumor specific TCR effector cells bound to the ligand; and b) isolating the complex from the heterogeneous cell population, thereby producing a MAGE-A1 tumor specific TCR effector cell enriched cell population. In some embodiments, the ligand is immobilized to a solid support. In some embodiments, the solid support is a microparticle (e.g., a bead). In some embodiments, the solid support is a surface (e.g., the bottom of a well). In some embodiments, the ligand is labeled with a tag. In some embodiments, the tag is a fluorescent molecule, an affinity tag, or a magnetic tag. In some embodiments, the method further comprises eluting the MAGE-A1 tumor specific TCR effector cells from the ligand and recovering the eluate.
In some embodiments, T cells can be enriched by FACS methods by screening for CD3 and IFN-gamma. In some embodiments, T cells can be enriched by ELISA methods by screening for IFN-gamma.
Library screening
To isolate a candidate MAGE-A1 tumor-specific TCR, or antigen-binding domain construct thereof, that is specific for a target antigen, a library of MAGE-A1 tumor-specific TCRs, or antigen-binding domains thereof (e.g., cells expressing a library of nucleic acids encoding a plurality of MAGE-A1 tumor-specific TCRs, or antigen-binding domains thereof) can be exposed to a ligand comprising the target antigen, or one or more epitopes contained therein, followed by isolation of affinity members of the library that specifically bind the ligand. In some embodiments, the ligand is immobilized on a solid support. In some embodiments, the carrier may be a bead surface, a microtiter plate, an immune tube, or any material known in the art to be suitable for such purposes.
In some embodiments, interactions occur on a labeled ligand target (e.g., biotin-labeled ligand) in solution. In some embodiments, the procedure involves one or more wash steps (panning) for removing non-specific and non-responsive library members. In some embodiments, to purify the complexes in solution, the complexes are captured by immobilization or by centrifugation. In some embodiments, the affinity members are captured on a soluble biotin-labeled ligand, followed by immobilization of the affinity complex (affinity members and ligand) on streptavidin beads. In some embodiments, the solid support is a bead. In some embodiments, the beads include, for example, magnetic beads (e.g., from Bangs laboratories, polysciences inc., dynal Biotech, miltenyi Biotech, or Quantum Magnetic), non-Magnetic beads (e.g., pierce and Upstatetechnology), monodisperse beads (e.g., dynal Biotech and Microparticle Gmbh), and polydisperse beads (e.g., chemagen). The use of magnetic beads is described in detail in the literature (Uhlen, M et al (1994) Advances in Biomagnetic Separation, bio Techniques press, 5 Westborough, mass.). In some embodiments, the affinity member is purified by forward selection. In some embodiments, the affinity members are purified by negative selection to remove undesired library members. In some embodiments, the affinity members are purified by positive and negative selection steps.
In general, the techniques used to prepare the library constructs will be based on known genetic engineering techniques. In this regard, the nucleic acid sequence encoding the MAGE-A1 tumor specific TCR or antigen binding domain thereof in the library to be expressed is incorporated into an expression vector suitable for the type of expression system to be used. Suitable expression vectors for presentation in cells such as cd3+ cells are well known and described in the art. For example, in some embodiments, the expression vector is a viral vector, such as a lentiviral vector.
In some embodiments, a nucleic acid library is provided comprising sequences encoding a plurality of MAGE-A1 tumor specific TCRs or antigen binding domains thereof according to any one of the embodiments described herein. In some embodiments, the nucleic acid library comprises viral vectors encoding a plurality of MAGE-A1 tumor specific TCRs or antigen binding domains thereof. In some embodiments, the viral vector is a lentiviral vector. In some embodiments, there is provided a method of screening a nucleic acid library according to any of the embodiments described herein for a sequence encoding a MAGE-A1 tumor specific TCR, or an antigen binding domain thereof, specific for a target antigen, comprising: a) Introducing the nucleic acid library into a plurality of cells such that the MAGE-A1 tumor specific TCR, or antigen binding domain thereof, is expressed on the surface of the plurality of cells; b) Incubating a plurality of cells with a ligand comprising a target antigen or one or more epitopes contained therein; c) Collecting cells bound to the ligand; and d) isolating the sequence encoding the MAGE-A1 tumor specific TCR or antigen binding domain thereof from the cells collected in step c) thereby identifying a MAGE-A1 tumor specific TCR or antigen binding domain thereof that is specific for the target antigen. In some embodiments, the method further comprises one or more washing steps. In some embodiments, one or more washing steps are performed between steps b) and c). In some embodiments, the plurality of cells is a plurality of cd3+ cells. In some embodiments, the ligand is immobilized on a solid support. In some embodiments, the solid support is a bead. In some embodiments, collecting the cells bound to the ligand comprises eluting the cells from the ligand bound to the solid support and collecting the eluate. In some embodiments, the ligand is labeled with a tag. In some embodiments, the tag is a fluorescent molecule, an affinity tag, or a magnetic tag. In some embodiments, collecting cells that bind to a ligand comprises isolating a complex comprising the cells and a labeled ligand. In some embodiments, the cell is dissociated from the complex.
MHC proteins
The Human Leukocyte Antigen (HLA) gene is a human version of the MHC gene. Three major MHC class I proteins involved in antigen presentation in humans are HLA-A, HLDA-B and HLA-C. In some embodiments, the antigen of interest (e.g., tumor-associated or virus-encoded antigen) and mhc class i protein. In some embodiments, the MHC class I protein is HLA-A in some embodiments. Peptides suitable for use in generating antigen binding moieties may be determined, for example, based on the presence of proteasome and immunoproteasome HLA (e.g., HLA-DRA 01: 01) binding motifs and cleavage sites, using computer predictive models known to those skilled in the art. With respect to predicting MHC binding sites, such models include, but are not limited to, proPred1 (described in more detail in Singh and Raghava, proPred: prediction20 of HLA-DR binding sites. BIOINFORMATICS 17 (12): 1236-1237, 2001) and SYFPEITHI (see Schulter et al SYFPEITHI, database for Searching and T-Cell epidemic prediction Immunoinformatics Methods in Molecular Biology, volume 409 (1): 75-93,2007).
Once the appropriate peptide is identified, peptide synthesis can be accomplished according to protocols generally known to those skilled in the art. The peptides of the invention, due to their relatively small size, can be synthesized directly in solution or on a solid support according to known peptide synthesis techniques. Various automated synthesizers are commercially available and can be used according to known schemes. The synthesis of peptides in the solution phase has become a well-established procedure for large-scale manufacture of synthetic peptides and is thus a suitable alternative method for the preparation of the peptides of the invention (see e.g. Solid Phase Peptide Synthesis, johnMorrow Stewart and Martin et al Application of Almez-mediated Amidation Reactionsto Solution Phase Peptide Synthesis, tetrahedron Letters, volume 39, pages 1517-1520, 1998).
In some embodiments, the MHC protein in the MAGE-A1 peptide/MHC complex is an MHC-class I protein. In some embodiments, the MHC class I protein is HLA-A. In some embodiments, the target antigen of an effector cell (e.g., T cell) that expresses a MAGE-A1 tumor specific TCR or antigen binding domain thereof on a surface is MAGE-A1 96-104 Peptide/mhc i a 11:01 complex.
Variants
In some embodiments, amino acid sequence variants of the MAGE-A1 TCRs provided herein or antigen binding domains thereof are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of a MAGE-A1TCR or antigen binding domain thereof. Amino acid sequence variants of the MAGE-A1TCR or antigen binding domain thereof can be prepared by introducing appropriate modifications into the nucleotide sequence encoding the MAGE-A1TCR or antigen binding domain thereof, or by peptide synthesis. Such modifications include, for example, deletions and/or insertions and/or substitutions of residues within the amino acid sequence. Any combination of deletions, insertions, and substitutions can be made to obtain the final construct, provided that the final construct has the desired characteristics, such as antigen binding. In some embodiments, MAGE-A1TCR or antigen binding domain variants thereof having one or more amino acid substitutions are provided. Amino acid substitutions may be introduced into the relevant MAGE-A1TCR or antigen binding domain thereof and the product is screened for a desired activity, such as retention/increased antigen binding or reduced immunogenicity.
Conservative substitutions are shown in table 2 below.
Amino acids can be grouped into different classes according to common side chain characteristics:
hydrophobicity: norleucine, met, ala, val, leu, ile;
neutral hydrophilicity: cys, ser, thr, asn, gln;
acid: asp, glu;
alkaline: his, lys, arg;
residues that affect chain orientation: gly, pro;
aromatic: trp, tyr, phe.
Non-conservative substitutions will entail changing a member of one of these classes to another class. Exemplary substitution variants are affinity matured antibody portions, which can be conveniently generated, for example, using phage display-based affinity maturation techniques. Briefly, one or more CDR residues are mutated and variant antibody portions are presented on phage and screened for a particular biological activity (e.g., binding affinity).
Table 2: conservative substitutions
Briefly, one or more CDR residues are mutated and the variant is presented on phage and screened for a particular biological activity (e.g., binding affinity).
Alterations (e.g., substitutions) may be made in the MAGE-A1 TCR or antigen binding domain thereof, for example, to increase affinity. Affinity maturation achieved by construction of and reselection from secondary libraries has been described, for example, in Hoogenboom et al Methods in Molecular Biology178:1-37 (O' Brien et al, human Press, totowa, N.J. (2001)). In some embodiments of affinity maturation, diversity is introduced into the variable gene selected for maturation by any of a variety of methods (e.g., error-prone PCR, strand shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then generated. The library is then screened to identify any TCR or antigen binding domain portion variants thereof having the desired affinity. CDR residues involved in antigen binding may be specifically identified, for example, using alanine scanning mutagenesis or modeling. Specifically, CDR3 is typically targeted.
In some embodiments, substitutions, insertions, or deletions may occur within one or more CDRs, provided that such changes do not substantially reduce the ability of the antibody moiety to bind to an antigen. For example, conservative changes (e.g., conservative substitutions as provided herein) may be made in the TCR or antigen-binding domain thereof that do not substantially reduce binding affinity. In certain embodiments of the variant TCRs or antigen binding domains thereof provided above, each CDR is unchanged or contains no more than one, two or three amino acid substitutions.
A suitable method for identifying residues or regions of an antibody moiety that can be targeted for mutation-induction is referred to as "alanine scanning mutagenesis" as described by Cunningham and Wells (1989) Science, 244:1081-1085. In this method, a residue or set of target residues (e.g., charged residues, such as arg, asp, his, lys and glu) are identified and replaced with neutral or negatively charged amino acids (e.g., alanine or polyalanine) to determine whether the interaction of the TCR or antigen-binding domain thereof with the MHC antigen complex is affected. Additional substitutions may be introduced at amino acid positions that exhibit functional sensitivity to the initial substitution. Alternatively or additionally, the crystal structure of the antigen-MHC-TCR portion complex can be determined to identify the point of contact between the antibody portion and the antigen. Such contact residues and neighboring residues may be targeted or excluded from the substitution candidates. Variants may be screened to determine if they contain the desired property.
Amino acid sequence insertions include amino and/or carboxy-terminal fusions ranging in length from one residue to polypeptides containing one hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include TCR portions with N-terminal methionyl residues. Other insertional variants of the TCR portion include fusions of the N-or C-terminus of the TCR portion with an enzyme (e.g., for ADEPT) or a polypeptide that extends the serum half-life of the antibody portion.
Derivatives and their use as inhibitors of viral infection
In some embodiments, a MAGE-A1 tumor-specific TCR, or an antigen binding domain thereof, according to any of the MAGE-A1 tumor-specific TCRs or antigen binding domains thereof described herein, can be further modified to contain additional non-protein moieties known in the art and readily available. Suitable moieties for MAGE-A1 tumor specific TCRs or antigen binding domain derivatives thereof include, but are not limited to, water soluble polymers. Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), ethylene glycol/propylene glycol copolymers, carboxymethyl cellulose, poly-5-glucose, polyvinyl alcohol, polyvinylpyrrolidone, poly-1, 3-dioxolane, poly-1, 3, 6-trioxane, ethylene/maleic anhydride copolymers, polyaminoacids (homo-or random copolymers), poly-glucose or poly (n-vinylpyrrolidone) polyethylene glycol, propylene glycol homopolymers, polyoxypropylene/ethylene oxide copolymers, polyoxyethylene polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have manufacturing advantages due to its stability in water. The polymer may have any molecular weight and may be branched or unbranched. The number of polymers attached to the MAGE-A1 tumor specific TCR or antigen binding domain thereof can vary, and if more than one polymer is attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization may be determined based on considerations including, but not limited to, the particular property or function to be improved of the MAGE-A1 tumor-specific TCR or antigen binding domain thereof, whether the MAGE-A1 tumor-specific TCR or antigen binding domain derivative thereof will be used in a defined condition therapy, and the like.
In some embodiments, conjugates of MAGE-A1 tumor specific TCRs or antigen binding domains thereof with non-protein moieties that can be selectively heated by exposure to radiation are provided. In some embodiments, the non-protein moiety is a carbon nanotube (Kam et al, proc. Natl. Acad. Sci. USA 102:11600-11605 (2005)). The radiation may have any wavelength and includes, but is not limited to, wavelengths that do not damage normal cells but heat the non-protein fraction to a temperature that kills cells proximal to the MAGE-A1 tumor specific TCR-non-protein fraction.
V. pharmaceutical composition
Also provided herein is a composition (e.g., a pharmaceutical composition, also referred to herein as a formulation) comprising a MAGE-A1 tumor-specific TCR or antigen binding domain thereof according to any of the embodiments described herein, a nucleic acid encoding a MAGE-A1 tumor-specific TCR or antigen binding domain thereof according to any of the embodiments described herein, or a MAGE-A1 tumor-specific TCR effector cell according to any of the embodiments described herein. In some embodiments, the composition is a MAGE-A1 tumor-specific TCR effector cell composition (e.g., a pharmaceutical composition) comprising effector cells (e.g., T cells) that present on the surface a MAGE-A1 tumor-specific TCR or antigen binding domain thereof according to any of the MAGE-A1 tumor-specific TCRs or antigen binding domains thereof described herein. In some embodiments, the MAGE-A1 tumor specific TCR effector cell composition is a pharmaceutical composition. The composition may comprise a homogeneous cell population comprising MAGE-A1 tumor-specific TCR effector cells of the same cell type and expressing the same MAGE-A1 tumor-specific TCR or antigen binding domain thereof, or a heterogeneous cell population comprising a plurality of populations comprising MAGE-A1 tumor-specific TCR effector cells of different cell types and/or expressing different MAGE-A1 tumor-specific TCRs or antigen binding domains thereof. The composition may further comprise cells that are not MAGE-A1 tumor specific TCR effector cells. Thus, in some embodiments, a MAGE-A1 tumor-specific TCR effector cell composition is provided comprising a homogeneous population of MAGE-A1 tumor-specific TCR effector cells (e.g., MAGE-A1 tumor-specific TCRT cells) of the same cell type and expressing the same MAGE-A1 tumor-specific TCR. In some embodiments, the MAGE-A1 tumor specific TCR effector cell is a T cell. In some embodiments, the MAGE-A1 tumor specific TCR effector cell is selected from the group consisting of: cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells. In some embodiments, the MAGE-A1 tumor specific TCR effector cell composition is a pharmaceutical composition.
In some embodiments, a MAGE-A1 tumor-specific TCR effector cell composition is provided comprising a heterogeneous population of cells comprising a plurality of MAGE-A1 tumor-specific TCR effector cell populations comprising different cell types and/or MAGE-A1 tumor-specific TCR effector cells expressing different MAGE-A1 tumor-specific TCRs or antigen binding domains thereof. In some embodiments, the MAGE-A1 tumor specific TCR effector cell is a T cell. In some embodiments, each MAGE-A1 tumor specific TCR effector cell population has a cell type selected from the group consisting of cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells. In some embodiments, all MAGE-A1 tumor specific TCR effector cells in the composition have the same cell type (e.g., all MAGE-A1 tumor specific TCR effector cells are cytotoxic T cells). In some embodiments, at least one MAGE-A1 tumor-specific TCR effector cell population has a different cell type than other MAGE-A1 tumor-specific TCR effector cell populations (e.g., one MAGE-A1 tumor-specific TCR effector cell population consists of cytotoxic T cells and the other MAGE-A1 tumor-specific TCR effector cell population consists of natural killer T cells). In some embodiments, each MAGE-A1 tumor-specific TCR effector cell population expresses the same MAGE-A1 tumor-specific TCR or antigen binding domain thereof. In some embodiments, at least one of the MAGE-A1 tumor-specific TCR effector cell populations expresses a MAGE-A1 tumor-specific TCR, or antigen binding domain thereof, that is different from the other MAGE-A1 tumor-specific TCR effector cell populations. In some embodiments, each MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that is different from other MAGE-A1 tumor-specific TCR effector cell populations. In some embodiments, each MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that specifically binds to the same target antigen. In some embodiments, at least one MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that specifically binds to a target antigen that is different from other MAGE-A1 tumor-specific TCR effector cell populations (e.g., one MAGE-A1 tumor-specific TCR effector cell population specifically binds to the pMHC complex and other MAGE-A1 tumor-specific TCR effector cell populations specifically bind to a cell surface receptor). In some embodiments, wherein at least one population of MAGE-A1 tumor-specific TCR effector cells expresses a MAGE-A1 tumor-specific TCR or antigen-binding domain thereof that specifically binds to a different target antigen, each population of MAGE-A1 tumor-specific TCR effector cells expresses a MAGE-A1 tumor-specific TCR or antigen-binding domain thereof that specifically binds to a target antigen associated with the same disease or disorder (e.g., each of the target antigens is associated with cancer, such as breast cancer). In some embodiments, the MAGE-A1 tumor specific TCR effector cell composition is a pharmaceutical composition.
Thus, in some embodiments, there is provided a MAGE-A1 tumor-specific TCR effector cell composition comprising a plurality of MAGE-A1 tumor-specific TCR effector cell populations according to any of the embodiments described herein, wherein all MAGE-A1 tumor-specific TCR effector cells in the composition have the same cell type (e.g., all MAGE-A1 tumor-specific TCR effector cells are cytotoxic T cells), and wherein each MAGE-A1 tumor-specific TCR effector cell population expresses a different MAGE-A1 tumor-specific TCR or antigen binding domain thereof than the other MAGE-A1 tumor-specific TCR effector cell populations. In some embodiments, the MAGE-A1 tumor specific TCR effector cell is a T cell. In some embodiments, the MAGE-A1 tumor specific TCR effector cell is selected from the group consisting of: cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells. In some embodiments, each MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that specifically binds to the same target antigen. In some embodiments, at least one MAGE-A1 tumor-specific TCR effector cell population expresses a target antigen MAGE-A1 tumor-specific TCR or antigen binding domain thereof that specifically binds to a different than other MAGE-A1 tumor-specific TCR effector cell populations (e.g., one MAGE-A1 tumor-specific TCR effector cell population specifically binds to the pMHC complex and other MAGE-A1 tumor-specific TCR effector cell populations specifically bind to a cell surface receptor). In some embodiments, wherein at least one population of MAGE-A1 tumor-specific TCR effector cells expresses a MAGE-A1 tumor-specific TCR or antigen-binding domain thereof that specifically binds to a different target antigen, each population of MAGE-A1 tumor-specific TCR effector cells expresses a MAGE-A1 tumor-specific TCR or antigen-binding domain thereof that specifically binds to a target antigen associated with the same disease or disorder (e.g., each of the target antigens is associated with cancer, such as breast cancer). In some embodiments, the MAGE-A1 tumor specific TCR effector cell composition is a pharmaceutical composition.
In some embodiments, a composition is provided comprising a plurality of MAGE-A1 tumor-specific TCR effector cell populations according to any of the embodiments described herein, wherein at least one MAGE-A1 tumor-specific TCR effector cell population has a different cell type than the other MAGE-A1 tumor-specific TCR effector cell populations. In some embodiments, all MAGE-A1 tumor specific TCR effector cell populations all have different cell types. In some embodiments, the MAGE-A1 tumor specific TCR effector cell is a T cell. In some embodiments, each MAGE-A1 tumor specific TCR effector cell population has a cell type selected from the group consisting of cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells. In some embodiments, each MAGE-A1 tumor-specific TCR effector cell population expresses the same MAGE-A1 tumor-specific TCR or antigen binding domain thereof. In some embodiments, at least one of the MAGE-A1 tumor-specific TCR effector cell populations expresses a MAGE-A1 tumor-specific TCR, or antigen binding domain thereof, that is different from the other MAGE-A1 tumor-specific TCR effector cell populations. In some embodiments, each MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that is different from other MAGE-A1 tumor-specific TCR effector cell populations. In some embodiments, each MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that specifically binds to the same target antigen. In some embodiments, at least one MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that specifically binds to a target antigen that is different from other MAGE-A1 tumor-specific TCR effector cell populations (e.g., one MAGE-A1 tumor-specific TCR effector cell population specifically binds to the pMHC complex and other MAGE-A1 tumor-specific TCR effector cell populations specifically bind to a cell surface receptor). In some embodiments, wherein at least one population of MAGE-A1 tumor-specific TCR effector cells expresses a MAGE-A1 tumor-specific TCR or antigen-binding domain thereof that specifically binds to a different target antigen, each population of MAGE-A1 tumor-specific TCR effector cells expresses a MAGE-A1 tumor-specific TCR or antigen-binding domain thereof that specifically binds to a target antigen associated with the same disease or disorder (e.g., each of the target antigens is associated with cancer, such as breast cancer). In some embodiments, the MAGE-A1 tumor specific TCR effector cell composition is a pharmaceutical composition.
At various points during the preparation of the composition, it may be desirable or desirable to cryopreserve the cells. The term "frozen" and "cryopreserved" are used interchangeably. Freezing includes freeze drying.
As will be appreciated by those skilled in the art, frozen cells can be destructive (see Mazur, P., 1977, cryobiology 14:251-272), but there are a number of procedures available for preventing such damage. For example, damage may be avoided by (a) using cryoprotectants, (b) controlling the rate of freezing, and/or (c) storing at a temperature low enough to minimize degradation response. Exemplary cryoprotectants include Dimethylsulfoxide (DMSO) (Lovelock and Bishop, 1959, nature 183:1394-1395; ashwood-Smith, 1961, nature 190:1204-1205), glycerol, polyvinylpyrrolidone (Rinfret, 1960, ann.N. Y. Acad. Sci.85:576), polyethylene glycol (Sloviter and Ravidin, 1962, nature 196:548), albumin, polydextrose, sucrose, ethylene glycol, i-erythritol, D-ribitol, D-mannitol (Rowe et al, 1962, fed. Proc.21:157), D-sorbitol, i-inositol, D-lactose, choline chloride (Bender et al, 1960, J.Appl. Physiol.15:520), amino acids (Phan. And Bender,1960, exp. Res. 20:651), methanol, acetylamine, glycerol monoacetate (v. 1954, biological.J.56:56), inorganic salts (Phan. And Bender,1960, medical society, and medical society, 35, and 35 b.35). In particular embodiments, DMSO may be used. The addition of plasma (e.g., to a concentration of 20-25%) may enhance the protective effect of DMSO. After DMSO addition, the cells may be kept at 0 ℃ until frozen, as 1% DMSO concentration may be toxic at temperatures above 4 ℃.
In cryopreservation of cells, slow controlled cooling rates can be critical and different cryoprotectants (Rapatz et al 1968, cryobiligy 5 (1): 18-25) and different cell types have different optimal cooling rates (see, e.g., rowe and Rinfret,1962,Blood 20:636;Rowe,5 1966,Cryo biology3 (1): 12-18; lewis et al 1967, transfusion7 (1): 17-32; and Mazur,1970, science168: 939-949) for the effect of cooling rates on the viability of stem cells and their transplantation potential). The heat of the melting phase, where the water turns into ice, should be minimal. The cooling procedure may be performed by using, for example, a programmable freezer or a methanol bath procedure. The programmable freezing apparatus allows for determination of optimal cooling rates and facilitates standard reproducible cooling.
In particular embodiments, DMSO-treated cells can be pre-cooled on ice and transferred to trays containing chilled methanol, which in turn are placed in a mechanical refrigerator (e.g., harris or Revco) at-80 ℃. Thermocouple measurements of the methanol bath and sample indicated a cooling rate of 1 ℃ to 3 ℃/min may be preferred. After at least two hours, the sample may reach a temperature of-80 ℃ and may be placed directly in liquid nitrogen (-196 ℃). After bottom freezing, the cells can be rapidly transferred to long-term cryogenic storage vessels.
In a preferred embodiment, the sample may be stored cryogenically in liquid nitrogen (-196 ℃) or in vapor (-1 ℃). The availability of high efficiency liquid nitrogen refrigerators facilitates such storage. Other considerations and procedures for handling, cryopreservation and long term storage of cells can be found in the following exemplary references: U.S. Pat. nos. 4,199,022, 3,753,357 and 4,559,298; gorin,1986,Clinics In Haematology 15 (1): 19-48Bone-Marrow Conservation, culture and Transplantation, proceedings of a Panel, moscow,1968, 7 months 22-26 days, international Atomic Energy Agency, vienna, pages 107-186; livesey and Linner, 1987, nature 327:255; linner et al, 1986, J.Histochem. Cytochem.34 (9): 1123-1135; simione, 1992, J.Parenter. Sci. Technol.46 (6): 226-32.
After cryopreservation, the frozen cells may be thawed for use according to methods known to those skilled in the art. Frozen cells are preferably thawed rapidly and frozen immediately after thawing. In certain embodiments, vials containing frozen cells may be immersed in a warm water bath until their neck; gentle rotation will ensure that the cell suspension mixes with the thawing and increase the heat transfer from the warm water to the internal ice cubes. Once the ice is completely melted, the vials are placed on the ice immediately.
In certain embodiments, methods of preventing cell aggregation may be used during thawing. An exemplary method includes: deoxyribonuclease (Spitzer et al 113, 1980, cancer 45:3075-3085), low molecular weight polydextrose, citrate, hydroxyethyl starch (Stiff et al, 1983, cryolog 20:17-24) and the like are added before and/or after freezing. As will be appreciated by those skilled in the art, if cryoprotectants toxic to humans are used, they should be removed prior to therapeutic use. DMSO is not severely toxic.
Exemplary vehicle and cell administration modes are described in U.S. patent publication No. 2010/0183564, pages 14-15. Other pharmaceutical carriers are described in Remington, the Science and Practice of Pharmacy, 21 st edition, division David B.Troy, lippicotWilliams & Wilkins (2005).
In certain embodiments, cells can be collected from the culture medium and washed and concentrated in a carrier to a therapeutically effective amount. Exemplary carriers include saline, buffered saline, water, hanks 'solution, ringer's solution, nonnosol-R (Abbott Labs), plasma-LyteA (R) (baxter laboratories, inc., morton grove, IL), glycerin, ethanol, and combinations thereof.
In particular embodiments, the carrier may be supplemented with Human Serum Albumin (HSA) or other human serum components or fetal bovine serum. In particular embodiments, the infusion vehicle comprises buffered saline containing 5% has or dextrose. Other isotonic agents include polyhydroxy sugar alcohols including triols or higher sugar alcohols, such as glycerol, erythritol, arabitol, xylitol, sorbitol, or mannitol.
The carrier may include buffers such as citrate buffer, succinate buffer, tartrate buffer, fumarate buffer, gluconate buffer, oxalate buffer, lactate buffer, acetate buffer, phosphate buffer, histidine buffer, and/or trimethylamine salt.
Stabilizers refer to a broad class of excipients that can range in function from an extender to an additive that helps prevent cells from adhering to the walls of the container. Typical stabilizers may include polyhydroxy sugar alcohols; amino acids such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2-phenylalanine, glutamic acid, threonine; organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myoinositol, galactitol, glycerol, and cyclic alcohols, such as inositol; PEG; an amino acid polymer; sulfur-containing reducing agents such as urea, glutathione, lipoic acid, sodium thioglycolate, thioglycerol, alpha-monothioglycerol, and sodium thiosulfate; low molecular weight polypeptides (i.e., <10 residues); proteins such as HSA, bovine serum albumin, gelatin or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; monosaccharides such as xylose, mannose, fructose, and glucose; disaccharides such as lactose, maltose and sucrose; trisaccharides, such as raffinose; and polysaccharides such as polydextrose.
The composition may include a local anesthetic such as lidocaine (lidocaine) to reduce pain at the injection site, if desired or advantageous.
Exemplary preservatives include phenol, benzyl alcohol, m-cresol, methyl parahydroxybenzoate, propyl parahydroxybenzoate, octadecyl dimethyl benzyl ammonium chloride, benzalkonium halides, quaternary ammonium hexa-hydroxy chloride, alkyl parahydroxybenzoates (e.g., methyl or propyl parahydroxybenzoate), catechol, resorcinol, cyclohexanol, and 3-pentanol.
The therapeutically effective amount of cells in the composition may be greater than 10 2 Individual cells, greater than 10 3 Individual cells, greater than 10 4 Individual cells, greater than 10 5 Individual cells, greater than 10 6 Individual cells, greater than 10 7 Individual cells, greater than 10 8 Individual cells, greater than 10 9 Individual cells, greater than 10 10 Individual cells or greater than 10 11 Individual cells. In the compositions and formulations disclosed herein, the volume of the cells is typically one liter or less, 500ml or less, 250ml or less, or 100ml or less. Thus, the cell density administered is typically greater than 10 4 Individual cells/ml, 10 7 Individual cells/ml or 10 8 Individual cells/ml.
Also provided herein are MAGE-A1 tumor-specific TCR nucleic acid compositions (e.g., pharmaceutical compositions, also referred to herein as formulations) comprising any of the nucleic acids encoding the MAGE-A1 tumor-specific TCRs described herein or antigen binding domains thereof. In some embodiments, the MAGE-A1 tumor specific TCR nucleic acid composition is a pharmaceutical composition. In some embodiments, the MAGE-A1 tumor specific TCR nucleic acid composition further comprises any one of: isotonic agents, excipients, diluents, thickeners, stabilizers, buffers and/or preservatives; and/or an aqueous vehicle, such as purified water, aqueous sugar solution, buffer solution, physiological saline, aqueous polymer solution, or water free of ribonuclease. The amount of such additives and aqueous vehicles to be added may be appropriately selected depending on the form of use of the MAGE-A1 tumor specific TCR nucleic acid composition.
The compositions and formulations disclosed herein may be prepared for administration by, for example, injection, infusion, perfusion, or lavage. The compositions and formulations may further be formulated for bone marrow, intravenous, intradermal, intraarterial, intranodular, intralymphatic, intraperitoneal, intralesional, intraprostatic, intravaginal, intrarectal, topical, intrathecal, intratumoral, intramuscular, intracapsular, and/or subcutaneous injection.
Formulations for in vivo administration must be sterile. This requirement is easily achieved by filtration, for example through sterile filtration membranes. Methods of treatment using a MAGE-A1 tumor-specific TCR or antigen-binding domain thereof the MAGE-A1 tumor-specific TCR or antigen-binding domain thereof and/or compositions of the invention can be administered to an individual (e.g., a mammal, such as a human) to treat diseases and/or disorders associated with expression of a Target Antigen (TA) (also referred to herein as "target antigen positive" or "TA positive" diseases or disorders), including, for example, cancer. Thus in some embodiments, the present application provides a method for treating a target antigen positive disease (e.g., cancer) in an individual comprising administering to the individual an effective amount of a composition (e.g., a pharmaceutical composition) comprising, for example, any of the MAGE-A1 tumor specific TCRs described herein or antigen binding domains thereof.
In some embodiments, the composition further comprises a cell (e.g., an effector cell) associated with the MAGE-A1 tumor specific TCR or antigen binding domain thereof. In some embodiments, the cancer is selected from, for example, the group consisting of: adrenal cortex cancer, bladder cancer, breast cancer, cervical cancer, bile duct cancer, colorectal cancer, esophageal cancer, glioblastoma, glioma, liver cancer, head and neck cancer, renal cancer, lung cancer, melanoma, mesothelioma, multiple myeloma, pancreatic cancer, pheochromocytoma, plasmacytoma, neuroblastoma, ovarian cancer, prostate cancer, sarcoma, gastric cancer, uterine cancer, and thyroid cancer.
VI therapeutic methods
In some embodiments, a method of treating a target antigen-related disease (e.g., cancer) in an individual in need thereof is provided, comprising administering to the individual an effective amount of a composition comprising a MAGE-A1 tumor-specific TCR, or an antigen-binding domain thereof, according to any of the herein, or a nucleic acid encoding a MAGE-A1 tumor-specific TCR, or an antigen-binding domain thereof, according to any of the herein, or an effector cell (e.g., T cell or natural killer cell) presenting a MAGE-A1 tumor-specific TCR, or an antigen-binding domain thereof, on a surface (e.g., a MAGE-A1 tumor-specific TCR, or an antigen-binding domain thereof). In some embodiments, the above-described composition comprises a) a first nucleic acid sequence encoding a first polypeptide chain comprising the amino acid sequence of SEQ ID NO. 9 and b) a second nucleic acid sequence encoding a second polypeptide chain comprising the amino acid sequence of SEQ ID NO. 12; and/or c) a first nucleic acid sequence encoding a first polypeptide chain comprising the amino acid sequence of SEQ ID NO. 23 and d) a second nucleic acid sequence encoding a second polypeptide chain comprising the amino acid sequence of SEQ ID NO. 26; and/or e) a first nucleic acid sequence encoding a first polypeptide chain comprising the amino acid sequence of SEQ ID NO. 37 and f) a second nucleic acid sequence encoding a second polypeptide chain comprising the amino acid sequence of SEQ ID NO. 40. In some embodiments, effector cells expressing a MAGE-A1 tumor specific TCR or antigen binding domain thereof further comprise a P2A nucleic acid sequence encoding SEQ ID NOs: 13, 27, 41. In some embodiments, an effector cell (e.g., T cell) is provided that expresses a MAGE-A1 tumor specific TCR or antigen binding domain thereof on a surface comprising a nucleic acid sequence encoding the amino acid sequence of one or more of SEQ ID NOs 14, 28, 42.
In some embodiments, the above composition comprises an isolated MAGE-A1 TCR or antigen binding domain thereof comprising a) a TCR alpha chain comprising the amino acid sequence of SEQ ID NO. 9 and b) a TCR beta chain comprising the amino acid sequence of SEQ ID NO. 12; and/or c) a TCR alpha chain comprising the amino acid sequence of SEQ ID NO. 23 and d) a TCR beta chain comprising the amino acid sequence of SEQ ID NO. 26; and/or e) a TCR alpha chain comprising the amino acid sequence of SEQ ID NO. 37 and f) a TCR beta chain comprising the amino acid sequence of SEQ ID NO. 40. In some embodiments, the MAGE-A1 tumor specific TCR or antigen binding domain thereof further comprises the P2A sequence of SEQ ID NOs: 13, 27, 41. In some embodiments, a MAGE-A1 tumor specific TCR or antigen binding domain thereof is provided comprising the amino acid sequences of one or more of SEQ ID NOs 14, 28, 42.
In some embodiments, a method of treating a target antigen-related disease (e.g., cancer) in a subject in need thereof is provided, comprising administering to the subject an effective amount of a composition comprising an effector cell (e.g., a T cell or natural killer cell) that presents a MAGE-A1 tumor-specific TCR or antigen binding domain thereof (e.g., a MAGE-A1 tumor-specific TCR or antigen binding domain thereof) on a surface, wherein the target antigen of the effector cell (e.g., T cell) of the MAGE-A1 tumor-specific TCR is a MAGE-A1 peptide/MHC complex. In some embodiments, the MHC protein in the MAGE-A1 peptide/MHC complex is an MHC-class I protein. In some embodiments, the MHC class I protein is HLA-A. In some embodiments, the effector cell is a γδ T cell. In some embodiments, the effector cell is an αβ T cell. In some embodiments, the effector cell is selected from the group consisting of: cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells. In some embodiments, the target antigen of an effector cell (e.g., T cell) that expresses a MAGE-A1 tumor specific TCR or antigen binding domain thereof on a surface is MAGE-A1 96-104 Peptide/mhc i a 11:01 complex. The invention also encompasses a method of treating a target antigen-related disease in an individual in need thereof comprising administering to the individual a composition comprising a plurality of effector cells expressing different MAGE-A1 tumor-specific TCRs or antigen binding domains thereof. Thus, in some embodiments, the composition is a heterogeneous MAGE-A1 tumor specific TCR effector cell composition as described herein, according to any of the methods of treating a target antigen-related disease in an individual described herein. For example, in some embodiments, a method of treating a target antigen-related disease (e.g., cancer) in an individual in need thereof is provided comprising administering to the individual an effective amount of a heterogeneous MAGE-A1 tumor-specific TCR effector cell composition comprisingThe composition comprises a plurality of MAGE-A1 tumor-specific TCR effector cell populations according to any of the embodiments described herein, wherein all MAGE-A1 tumor-specific TCR effector cells in the composition have the same cell type (e.g., all MAGE-A1 tumor-specific TCR effector cells are cytotoxic T cells), wherein each MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR that is different from the other MAGE-A1 tumor-specific TCR effector cell populations, and wherein at least one MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR that specifically binds to a target antigen. In some embodiments, the MAGE-A1 tumor specific TCR effector cell is a T cell. In some embodiments, the MAGE-A1 tumor specific TCR effector cell is selected from the group consisting of: cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells. In some embodiments, each MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that specifically binds to a target antigen. In some embodiments, at least one population of MAGE-A1 tumor-specific TCR effector cells expresses MAGE-A1 tumor-specific TCRs or antigen binding domains thereof that specifically bind to different target antigens. In some embodiments, wherein at least one population of MAGE-A1 tumor-specific TCR effector cells expresses a MAGE-A1 tumor-specific TCR, or an antigen binding domain thereof, that specifically binds to a different target antigen, each of which is associated with a target antigen-related disease.
In some embodiments, a method of treating a target antigen-related disease (e.g., cancer) in an individual in need thereof is provided, comprising administering to the individual an effective amount of a heterogeneous MAGE-A1 tumor-specific TCR effector cell composition comprising a plurality of MAGE-A1 tumor-specific TCR effector cell populations according to any of the embodiments described herein, wherein at least one MAGE-A1 tumor-specific TCR effector cell population has a different cell type than the other MAGE-A1 tumor-specific TCR effector cell populations, and wherein at least one MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that specifically binds to the target antigen. In some embodiments, all MAGE-A1 tumor specific TCR effector cell populations all have different cell types. In some embodiments, the MAGE-A1 tumor specific TCR effector cell is a T cell. In some embodiments, each MAGE-A1 tumor specific TCR effector cell population has a cell type selected from the group consisting of cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells. In some embodiments, each MAGE-A1 tumor-specific TCR effector cell population expresses the same MAGE-A1 tumor-specific TCR or antigen binding domain thereof. In some embodiments, at least one of the MAGE-A1 tumor-specific TCR effector cell populations expresses a MAGE-A1 tumor-specific TCR, or antigen binding domain thereof, that is different from the other MAGE-A1 tumor-specific TCR effector cell populations. In some embodiments, each MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that is different from other MAGE-A1 tumor-specific TCR effector cell populations. In some embodiments, each MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that specifically binds to a target antigen. In some embodiments, at least one population of MAGE-A1 tumor-specific TCR effector cells expresses MAGE-A1 tumor-specific TCRs or antigen binding domains thereof that specifically bind to different target antigens. In some embodiments, wherein at least one population of MAGE-A1 tumor-specific TCR effector cells expresses a MAGE-A1 tumor-specific TCR, or an antigen binding domain thereof, that specifically binds to a different target antigen, each of which is associated with a target antigen-related disease.
In some embodiments, a method of treating a disease associated with a plurality of target antigens in an individual in need thereof is provided, comprising administering to the individual an effective amount of a heterogeneous MAGE-A1 tumor-specific TCR effector cell composition comprising a plurality of MAGE-A1 tumor-specific TCR effector cell populations according to any of the embodiments described herein, wherein all MAGE-A1 tumor-specific TCR effector cells in the composition have the same cell type (e.g., all MAGE-A1 tumor-specific TCR effector cells are cytotoxic T cells), wherein each MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that is different from the other MAGE-A1 tumor-specific TCR effector cell populations, and wherein at least one MAGE-A1 tumor-effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that specifically binds to a target antigen for each of the plurality of target antigens. In some embodiments, the MAGE-A1 tumor specific TCR effector cell is a T cell. In some embodiments, the MAGE-A1 tumor specific TCR effector cell is selected from the group consisting of: cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells.
In some embodiments, a method of treating a disease associated with a plurality of target antigens in an individual in need thereof is provided, comprising administering to the individual an effective amount of a heterogeneous MAGE-A1 tumor-specific TCR effector cell composition comprising a plurality of MAGE-A1 tumor-specific TCR effector cell populations according to any of the embodiments described herein, wherein at least one MAGE-A1 tumor-specific TCR effector cell population has a different cell type than the other MAGE-A1 tumor-specific TCR effector cell populations, and wherein for each target antigen of the plurality of target antigens, at least one MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that specifically binds to the target antigen. In some embodiments, all MAGE-A1 tumor specific TCR effector cell populations all have different cell types. In some embodiments, the MAGE-A1 tumor specific TCR effector cell is a T cell. In some embodiments, each MAGE-A1 tumor specific TCR effector cell population has a cell type selected from the group consisting of cytotoxic T cells, helper T cells, natural killer T cells, and suppressor T cells. In some embodiments, each MAGE-A1 tumor-specific TCR effector cell population expresses a MAGE-A1 tumor-specific TCR or antigen binding domain thereof that is different from other MAGE-A1 tumor-specific TCR effector cell populations.
In some embodiments, the individual is a mammal (e.g., human, non-human primate, rat, mouse, cow, horse, pig, sheep, goat, dog, cat, etc.). In some embodiments, the subject is a human. In some embodiments, the individual is a clinical patient, a clinical trial volunteer, a laboratory animal, or the like. In some embodiments, the individual is less than about 60 years old (including, for example, any of ages less than about 50, 40, 30, 25, 20, 15, or 10 years old). In some embodiments, the individual is older than about 60 years (including, for example, any of ages older than about 70, 80, 90, or 100). In some embodiments, the individual is diagnosed with or is environmentally or genetically predisposed to one or more of the diseases or disorders described herein (e.g., cancer). In some embodiments, the individual has one or more risk factors associated with one or more of the diseases or conditions described herein.
In some embodiments, the MAGE-A1 tumor specific TCR effector cell compositions of the invention are administered in combination with a second, third, or fourth agent (including, for example, an anti-neoplastic agent, a growth inhibitor, a cytotoxic agent, or a chemotherapeutic agent) to treat a disease or disorder involving expression of a target antigen. In some embodiments, the MAGE-A1 tumor specific TCR effector cell composition is administered in combination with a cytokine (e.g., IL-2). In some embodiments, the MAGE-A1 tumor specific TCR, or antigen binding domain thereof, is administered in combination with an agent that increases MHC protein expression and/or enhances surface presentation of the peptide by the MHC protein. In some embodiments, the agents include, for example, IFN receptor agonists, hsp90 inhibitors, p53 expression enhancers, and chemotherapeutic agents. In some embodiments, the agent is an IFN receptor agonist, including for example IFN gamma, IFN beta and IFN alpha. In some embodiments, the agent is an Hsp90 inhibitor, including, for example, tamsulosin (tanespimycin; 17-AAG), azithromycin (alvespimycin; 17-DMAG), rithromycin (retespimycin; IPI-504), IPI-493, CNF2024/BIIB021, MPC-3100, debio0932 (CUDC-305), PU-H71, add Li Tepi (Ganetespib; STA-9090), NVP-AUY922 (VER-52269), HSP990, KW-2478, AT13387, SNX-5422, DS-2248, and XL888. In some embodiments, the agent is a p53 expression enhancer, including, for example, 5-fluorouracil and nutlin-3. In some embodiments, the agent is a chemotherapeutic agent, including, for example, topotecan (topotecan), etoposide (etoposide), cisplatin (cispratin), paclitaxel (paclitaxel), and vinblastine (vinblastine). In some embodiments, a method of treating a target antigen-positive disease in a subject in need thereof is provided, comprising administering to the subject a MAGE-A1 tumor specific TCR effector cell composition according to any of the embodiments described herein, and a cytokine (e.g., IL-2). In some embodiments, the MAGE-A1 tumor specific TCR effector cell composition and cytokine are administered simultaneously. In some embodiments, the MAGE-A1 tumor specific TCR effector cell composition and cytokine are administered sequentially.
In some embodiments, a method of treating a target antigen-positive disease in an individual in need thereof is provided, wherein cells expressing the target antigen are not normally presented or present at relatively low levels on their surfaces a complex comprising the target antigen and an mhc class of proteins, the method comprising administering to the individual a MAGE-A1 tumor-specific TCR effector cell composition according to any of the embodiments described herein and an agent that increases expression of the mhc class of proteins and/or enhances surface presentation of the target antigen by the mhc class of proteins. In some embodiments, the agents include, for example, IFN receptor agonists, hsp90 inhibitors, p53 expression enhancers, and chemotherapeutic agents. In some embodiments, the agent is an IFN receptor agonist, including for example IFN gamma, IFN beta and IFN alpha. In some embodiments, the agent is an Hsp90 inhibitor, including, for example, tamsulosin (17-AAG), azithromycin (17-DMAG), rithromycin (IPI-504), IPI-493, CNF2024/BIIB021, MPC-3100, debio0932 (CUDC-305), PU-H71, and Li Tepi (STA-9090), NVP-AUY922 (VER-52269), HSP990, KW-2478, AT13387, SNX-5422, DS-2248, and XL888. In some embodiments, the agent is a p53 expression enhancer, including, for example, 5-fluorouracil and nutlin-3. In some embodiments, the agent is a chemotherapeutic agent, including, for example, topotecan, etoposide, cisplatin, paclitaxel, and vinblastine. In some embodiments, the MAGE-A1 tumor specific TCR effector cell composition and the agent are administered simultaneously. In some embodiments, the MAGE-A1 tumor specific TCR effector cell composition and the agent are administered sequentially.
In some embodiments, a method of treating a target antigen-related disease (e.g., cancer) in an individual in need thereof is provided, comprising administering to the individual an effective amount of a composition comprising a nucleic acid encoding a MAGE-A1 tumor specific TCR, or an antigen binding domain thereof, according to any of the embodiments described herein. Methods of gene delivery are known in the art. See, for example, U.S. Pat. nos. 5,399,346, 5,580,859, 5,589,466, which are incorporated herein by reference in their entirety.
Cancer treatment can be assessed by, for example, tumor regression, tumor weight or size shrinkage, percent cancer cell death, time to progression, duration of survival, progression free survival, overall response rate, duration of response, quality of life, protein expression, and/or activity. Methods for determining efficacy of a therapy may be used, including measuring response, for example, via radiological imaging.
In some embodiments, the efficacy of treatment is measured as percent tumor growth inhibition (TGI%), calculated using formula 100- (T/C x 100), where T is the average relative tumor volume of the treated tumor and C is the average relative tumor volume of the untreated tumor. In some embodiments, the TGI% is about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, or greater than 95%.
In some embodiments, the therapeutic efficacy is measured as percent tumor growth inhibition (TGI%), calculated using formula 100- (T/C x 100), where T is the number of treated target cells and C is the number of untreated target cells. In some embodiments, the TGI% is about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, or greater than 95%.
In some embodiments, according to any of the methods of treating a target antigen-related disease in an individual described herein, further in combination with an immunosuppressant, a therapeutic antibody, chemotherapy, radiation therapy, surgery, or any combination thereof.
Disease of the human body
In some embodiments, MAGE-A1 tumor specific TCR effector cells can be useful for treating cancers associated with a target antigen. Cancers that may be treated using any of the methods described herein include non-vascularized, or tumors that have not been substantially vascularized, as well as vascularized tumors. The cancer may comprise a non-solid tumor (e.g., hematological tumors such as leukemia and lymphoma) or may comprise a solid tumor. Types of cancers to be treated by the MAGE-A1 tumor-specific TCR effector cells of the invention include, but are not limited to, carcinoma, blastoma and sarcoma, as well as certain leukemia or lymphoid malignancies, benign and malignant tumors, and malignant diseases, such as sarcoma, carcinoma and melanoma. Adult tumors/cancers and pediatric tumors/cancers are also included. Hematological cancer is a cancer of the blood or bone marrow. Examples of hematological (or hematopoietic) cancers include leukemias, including acute leukemias (e.g., acute lymphoblastic leukemia, acute myelogenous leukemia and myeloblastosis, promyelocytic, myelomonocytic, monocytic, and erythroleukemia), chronic leukemias (e.g., chronic myelogenous (granulocytic) leukemia, chronic myelogenous leukemia, and chronic lymphocytic leukemia), polycythemia vera, lymphomas, hodgkin's disease, non-Hodgkin's lymphomas (refractory and advanced forms), multiple myelomas, plasmacytomas, waldenstrom's macroglobulinemia (Waldenstrom's macroglobulinemia), heavy chain diseases, myelodysplastic syndrome, hairy cell leukemia, and myelodysplasia. Solid tumors are abnormal tissue masses that do not typically contain cysts or liquid areas. Solid tumors may be benign or malignant. Different types of solid tumors are named by the cell type from which they are formed (e.g., sarcomas, carcinomas, and lymphomas). Examples of solid tumors (e.g., sarcomas and carcinomas) include adrenocortical, cholangiocarcinomas, fibrosarcomas, myxosarcomas, liposarcomas, chondrosarcomas, osteosarcomas and other sarcomas, synoviomas, mesotheliomas, ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, gastric cancer, lymphoid malignancies, pancreatic cancer, breast cancer, lung cancer, ovarian cancer, prostate cancer, hepatocellular carcinoma, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, thyroid cancer (e.g., medullary thyroid cancer and papillary thyroid cancer), pheochromocytoma sebaceous gland carcinoma, papillary adenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, liver cancer, cholangiocarcinoma, wilms' tumor, cervical cancer (e.g., cervical cancer and pre-invasive cervical dysplasia), colorectal cancer, anal canal cancer or anal rectal cancer, vaginal cancer, vulvar cancer (e.g., squamous cell carcinoma, intraepithelial cancer, adenocarcinoma, and fibrosarcoma), penile cancer, oropharyngeal cancer, esophageal cancer, head cancer (e.g., squamous cell carcinoma), neck cancer (e.g., squamous cell carcinoma), testicular cancer (e.g., seminoma, teratoma, embryo cancer, teratocarcinoma, choriocarcinoma, sarcoma, leydigcell tumor (leydigcell), fibroma, fibroadenoma, adenomatoid tumor, and lipoma), bladder cancer, renal cancer, melanoma, uterine cancer (e.g., endometrial cancer), urothelial cancer (e.g., squamous cell carcinoma, transitional cell carcinoma, adenocarcinoma, ureteral cancer, and bladder cancer), and CNS tumors (e.g., gliomas (e.g., brain stem gliomas and mixed gliomas), glioblastoma (also known as polymorphic glioblastoma) astrocytomas, CNS lymphomas, blastomas, neuroblastomas, neurosheath tumors, craniopharyngeal tube tumors, ependymomas, pineal tumors, angioblastomas, acoustic neuromas, oligodendrogliomas, meningiomas, neuroblastomas, retinoblastomas, and brain metastases).
Cancer treatment may be assessed, for example, by tumor regression, tumor weight or size shrinkage, time to progression, duration of survival, progression free survival, overall response rate, duration of response, quality of life, protein expression, and/or activity. Methods for determining efficacy of a therapy may be used, including measuring response, for example, via radiological imaging.
Product and kit
In some embodiments of the invention, an article of manufacture is provided that contains a material suitable for treating a target antigen-positive disease, such as cancer (e.g., adrenocortical, bladder, breast, cervical, cholangiocarcinoma, colorectal, esophageal, glioblastoma, glioma, hepatocellular, head and neck, renal, lung, melanoma, mesothelioma, multiple myeloma, pancreatic, pheochromocytoma, plasmacytoma, neuroblastoma, ovarian, prostate, sarcoma, gastric, uterine, or thyroid cancer). The article of manufacture may comprise a container, a label on or accompanying the container, or a pharmaceutical instruction. Suitable containers include, for example, bottles, vials, syringes, and the like. The container may be formed of various materials, such as glass or plastic. In general, the container contains a composition effective for treating the diseases or conditions described herein, and may have a sterile access port (e.g., the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is an effector cell that presents on the surface a MAGE-A1 tumor specific TCR of the invention or an antigen binding domain thereof. The label or pharmaceutical instructions indicate that the composition is used to treat a particular condition. The labeling or pharmaceutical instructions will further comprise instructions for administering the MAGE-A1 tumor specific TCR effector cell composition to the patient. Articles of manufacture and kits comprising the combination therapies described herein are also contemplated.
The pharmaceutical instructions refer to instructions that are typically included in commercial therapeutic product packages that contain instructions for indications, uses, dosages, administration, contraindications and/or warnings regarding the use of such therapeutic products. In some embodiments, the pharmaceutical instructions indicate that the composition is used to treat a target antigen positive cancer (e.g., adrenocortical cancer, bladder cancer, breast cancer, cervical cancer, cholangiocarcinoma, colorectal cancer, esophageal cancer, glioblastoma, hepatocellular carcinoma, head and neck cancer, renal cancer, lung cancer, melanoma, mesothelioma, multiple myeloma, pancreatic cancer, pheochromocytoma, plasmacytoma, neuroblastoma, ovarian cancer, prostate cancer, sarcoma, gastric cancer, uterine cancer, or thyroid cancer). Additionally, the article of manufacture may further comprise a second container comprising a pharmaceutically acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate buffered saline, ringer's solution, and dextrose solution. It may further include other substances, including other buffers, diluents, filters, needles and syringes, as desired from a commercial and user standpoint.
Kits suitable for various purposes, such as for treating a target antigen positive disease or disorder described herein, optionally in combination with an article of manufacture, are also provided. Kits of the invention include one or more containers comprising a MAGE-A1 tumor specific TCR effector cell composition (or unit dosage form and/or article of manufacture), and in some embodiments, further comprising another agent (as described herein) and/or instructions for use according to any of the methods described herein. The kit may further comprise instructions for the selection of individuals suitable for treatment. The instructions provided in the kits of the invention are written instructions that are typically on labels or pharmaceutical instructions (e.g., paper sheets included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetized or optical storage disc) are also acceptable.
For example, in some embodiments, the kit comprises a composition comprising effector cells that present a MAGE-A1 tumor specific TCR on a surface. In some embodiments, the kit comprises a) a composition comprising effector cells that present a MAGE-A1 tumor specific TCR or antigen binding domain thereof on a surface, and b) an effective amount of at least one additional agent, wherein the additional agent increases expression of an MHC protein and/or enhances surface presentation of the MHC protein (e.g., ifnγ, ifnβ, ifnα, or Hsp90 inhibitor) to the peptide. In some embodiments, the kit comprises a) a composition comprising effector cells that present on the surface a MAGE-A1 tumor specific TCR or antigen binding domain thereof, and b) administering to the individual
Instructions for MAGE-A1 tumor specific TCR effector cell compositions to treat target cell positive diseases (e.g., cancer). In some embodiments, the kit comprises a) a composition comprising effector cells that present a MAGE-A1 tumor-specific TCR or antigen binding domain thereof on a surface, b) an effective amount of at least one additional agent, wherein the additional agent increases expression of MHC proteins and/or enhances surface presentation of peptides by MHC proteins (e.g., ifnγ, ifnβ, ifnα, or Hsp90 inhibitors), and c) instructions for administering the MAGE-A1 tumor-specific TCR effector cell composition and additional agent to an individual to treat a target cell positive disease (e.g., cancer). The MAGE-A1 tumor specific TCR effector cell composition and other agents can be present in separate containers or in a single container. For example, the kit may comprise one unique composition or two or more compositions, wherein one composition comprises MAGE-A1 tumor specific TCR effector cells and the other composition comprises another agent.
In some embodiments, the kit comprises a) a composition comprising a MAGE-A1 tumor-specific TCR or antigen binding domain thereof, and b) instructions relating to the combination of the MAGE-A1 tumor-specific TCR or antigen binding domain thereof with an effector cell (e.g., an effector cell derived from an individual, such as a T cell or a natural killer cell) to form a composition comprising an effector cell presenting the MAGE-A1 tumor-specific TCR or antigen binding domain thereof on a surface, and administering the MAGE-A1 tumor-specific TCR effector cell composition to the individual to treat a target antigen-positive disease (e.g., cancer). In some embodiments, the kit comprises a) a composition comprising a MAGE-A1 tumor specific TCR, or an antigen binding domain thereof, and b) an effector cell (e.g., a cytotoxic cell). In some embodiments, the kit comprises a) a composition comprising a MAGE-A1 tumor-specific TCR or antigen binding domain thereof, b) an effector cell (e.g., a cytotoxic cell), and c) instructions directed to combining the MAGE-A1 tumor-specific TCR or antigen binding domain thereof with the effector cell to form a composition comprising an effector cell that presents the MAGE-A1 tumor-specific TCR or antigen binding domain thereof on a surface, and administering the MAGE-A1 tumor-specific TCR effector cell composition to a subject to treat a target antigen-positive disease (e.g., cancer).
In some embodiments, the kit comprises one nucleic acid (or a set of nucleic acids) encoding a MAGE-A1 tumor specific TCR or antigen binding domain thereof. In some embodiments, the kit comprises a) a nucleic acid (or a set of nucleic acids) encoding a MAGE-A1 tumor specific TCR or antigen binding domain thereof, and b) a host cell (e.g., an effector cell) for expressing the nucleic acid (or set of nucleic acids). In some embodiments, the kit comprises a) a nucleic acid (or a set of nucleic acids) encoding a MAGE-A1 tumor-specific TCR or antigen binding domain thereof, and b) instructions for i) expressing the MAGE-A1 tumor-specific TCR or antigen binding domain thereof in a host cell (e.g., an effector cell, such as a T cell), ii) preparing a composition comprising a host cell that expresses the MAGE-A1 tumor-specific TCR or antigen binding domain thereof, and iii) administering to the subject the composition comprising a host cell that expresses the MAGE-A1 tumor-specific TCR or antigen binding domain thereof, to treat the target antigen-positive disease (e.g., cancer). In some embodiments, the host cell is derived from an individual. In some embodiments, the kit comprises a) a nucleic acid (or a set of nucleic acids) encoding a MAGE-A1 tumor-specific TCR or antigen binding domain thereof, b) a host cell (e.g., an effector cell) for expressing the nucleic acid (or the set of nucleic acids), and c) instructions for i) expressing the MAGE-A1 tumor-specific TCR or antigen binding domain thereof in the host cell, ii) preparing a composition comprising a host cell expressing the MAGE-A1 tumor-specific TCR or antigen binding domain thereof, and iii) administering to the subject a composition comprising a host cell expressing the MAGE-A1 tumor-specific TCR or antigen binding domain thereof, to treat the target antigen-positive disease (e.g., cancer). The kit of the invention is in a suitable package. Suitable packages include, but are not limited to, vials, bottles, cans, plastic packages (e.g., sealed Mylar or plastic bags), and the like. The kit may optionally provide additional components such as buffers and instructional information. The present application thus also provides articles including vials (e.g., sealed vials), bottles, cans, plastic packages, and the like.
Instructions relating to the use of MAGE-A1 tumor specific TCR effector cell compositions generally include information regarding the dosage, timing of administration, and route of administration of the desired treatment. The container may be a unit dose, a bulk (e.g., multi-dose package) or a sub-unit dose. For example, a kit can be provided containing a sufficient dose of a MAGE-A1 tumor specific TCR effector cell composition as disclosed herein for providing an effective treatment for an individual for a longer period of time, e.g., any one of one week, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 2 weeks, 3 weeks, 4 weeks, 6 weeks, 8 weeks, 3 months, 4 months, 5 months, 7 months, 8 months, 9 months, or more.
The kit may also include a plurality of unit doses of the MAGE-A1 tumor specific TCR, or antigen binding domain thereof, and pharmaceutical compositions and instructions for use, and packaged in amounts sufficient for storage and use in a pharmacy, such as a hospital pharmacy and pharmacy.
Those skilled in the art will recognize that several embodiments are possible within the scope and spirit of the invention. The invention will now be described in more detail with reference to the following non-limiting examples. The following embodiments further illustrate the invention but, of course, should not be construed as in any way limiting its scope. It is to be understood that one, some, or all of the properties of the various embodiments described herein may be combined to form other embodiments of the invention.
Examples
The following examples are intended to be purely exemplary of the present patent application and therefore should not be considered as limiting the invention in any way. The following examples and detailed description are provided by way of illustration and not by way of limitation.
Example 1 preparation of MAGE-A1 specific T cells
A MAGE-A1 antigen-specific T cell receptor ST09D08 was prepared for characterization and validation experiments. The HLA and epitope of the tumor antigen specific T cell receptor are shown in FIG. 1A. For each tumor antigen-specific T cell receptor, preparing a human (i.e., wild-type) TCR construct and a murine TCR construct corresponding thereto; codon optimization was performed for ST09D 08. The murine TCR construct has murine constant domains (mcα and mcβ1). Schematic of the wild-type, murine and murine codon-optimized constructs for tumor antigen specific T cell receptors are shown in fig. 1B.
Example 2 verification of MAGE-A1 specific T cell receptor ST09D08
This example aims at verifying T Cell Receptor (TCR) ST09D08 expression, polypeptide recognition, epitope recognition, HLA blocking and in vitro toxicity.
TCR expression and polypeptide recognition assays
The TCR expression and polypeptide recognition assay is shown in figure 2A.
TCR expression was assessed using FACS assays that detect stained TCR vβ chains. Briefly, TCR-transferred T cells were collected and washed by adding 10 mL PBS (containing 2% fetal bovine serum), centrifuged at 350g for 5 min, and the supernatant was completely aspirated. Cell pellets were resuspended and adjusted to about 2X 10 by addition of PBS (containing 2% fetal bovine serum) 6 Individual cells/mL. 100 μl/sample cell suspension was collected and used for TCR vβ chain surface staining and detected by FACS.
Using MAGE-A1 96-104 The polypeptides determine the recognition of MAGE-A1 by TCR transduced T cells. TCR transduced T cells were collected and washed by adding 10 mL PBS, centrifuged at 350g for 5 min, and the supernatant was completely aspirated. The TCR transduced T cells were then resuspended and adjusted to 1X 10 by addition of AIM-V medium (containing 10% fetal bovine serum) 6 Individual cells/mL to 96-well plate. MAGE-A1 96-104 The polypeptide was mixed with tumor specific T cells, braytokinetin A (brefeldin A) (final concentration 3 μg/mL) was added to the wells and incubated for 4 hours. After 4 hours, cells were collected and used for intracellular IFN-. Gamma.and CD3 staining and detection by FACS. For ELISA detection of IFN-gamma, 100 μl/well of LCL (1×10 6 Individual cells/mL) and 100 μl/well of TCR transduced T cells (1 x 10 6 Individual cells/mL) were mixed into 96-well plates and cultured in an incubator for 24 hours. After 24 hours, 175 μl of supernatant was collected per well in 96 discs and used for ELISA detection of IFN- γ using the IFN- γ ELISA HRP kit.
As shown in FIGS. 2A-2C, ST09D08 specifically recognizes the polypeptide MAGE-A1 96-104 。
LCL stimulation assay for validation of epitope recognition
LCL stimulation assays were performed as follows. First, LCL was loaded with peptide: LCLs were collected in 15 mL tubes, washed by adding 10 mL PBS, centrifuged at 350g for 5 min, and the supernatant was completely aspirated. The cell pellet was resuspended in medium (RPMI 1640 containing 10% FBS) and adjusted to 1X 10 6 Individual cells/mL. Tumor antigen peptide was added to LCL to final concentration 5. Mu.g/mL and in incubatorCulturing for 8 to 24 hours. The TCR-T cells were then stimulated with peptide-loaded LCLs as follows: peptide-loaded LCLs were collected and washed by adding 10 mL PBS, centrifuged at 350g for 5 min, and the supernatant was completely aspirated. LCL was resuspended and adjusted to 1X 10 by adding AIM-V medium (containing 10% fetal bovine serum) 6 Individual cells/mL. TCR transduced T cells were collected and washed by adding 10 mL PBS, centrifuged at 350g for 5 min, and the supernatant was completely aspirated. The TCR transduced T cells were then resuspended and adjusted to 1X 10 by addition of AIM-V medium (containing 10% fetal bovine serum) 6 Individual cells/mL. LCL of 100 μl/well (1×10 6 Individual cells/mL) and 100 μl/well of TCR transduced T cells (1 x 10 6 Individual cells/mL) were mixed into 96-well plates and cultured in an incubator for 24 hours. After 24 hours, 175 μl of supernatant was collected per well in 96 discs and used for ELISA detection of IFN- γ using the IFN- γ ELISA HRP kit.
HLA restriction assay
Loading MAGE-A1 on cells with various HLA-A subtypes 96-104 The polypeptides are used to stimulate T cells transfected with T cell receptors in HLA restriction assays. Washed by adding 10 mL of PBS, centrifuged at 350g for 5 min, and the supernatant was completely aspirated. The cell pellet was resuspended to 1X 10 by addition of AIM-V medium (containing 10% fetal bovine serum) 6 Individual cells/mL. 100 μl/well of cell suspension was added to the 96-well plate, and HLA blocking antibodies were added (final concentration 50 μg/mL) to the appropriate wells and incubated in an incubator for 2 hours. TCR-transferred T cells were collected, washed by adding 10 mL PBS, centrifuged at 350g for 5 min, and the supernatant was completely aspirated. Cell pellet was collected and adjusted to 1X 10 by adding AIM-V medium (containing 10% fetal bovine serum) 6 Individual cells/mL. 100 μl/well of TCR transduced cell suspension was added to the corresponding well, mixed with LCL, and cultured in an incubator for 24 hours. After 24 hours, 175 μl of supernatant was collected per well of 96 discs and finally measured using a human IFN- γ ELISA.
On day 1, high protein binding ELISA plates were used for antibody 1-D1K (IFN- γ ELISA HRP kit) coating (by addition of 50 μl/well) diluted to 2 μg/mL in PBS (pH 7.4) and incubated overnight at 4 ℃. On day 2, the discs were washed twice with PBS (200 μl/well). The discs were blocked by adding 200 μl/well of medium and incubated for 1 hour at Room Temperature (RT). Human IFN-gamma standard (IFN-gamma ELISA HRP kit) was prepared in 2 mL PBS (with 1% BSA) to a concentration of 0.5 μg/mL and placed at RT for 15 min, after which the tube was vortexed. Samples or standards of 50 μl/well were diluted in medium and incubated for 2 hours at RT. The sample and standard probes were tested in duplicate. The discs were washed five times with PBS containing 0.05% Tween 20. 50. Mu.L/well of antibody 7-B6-1-biotin (IFN-. Gamma.ELISA HRP kit) was added at 1. Mu.g/mL (in PBS), incubated for 1 hour at RT, and washed. 50 μl/well of streptavidin-HRP (IFN- γ ELISA HRP kit) diluted 1:1000 in PBS was added, incubated for 1 hour at RT, and washed. 100 μl/well of TMB substrate solution was added and incubated in the dark at RT for 15 to 30 minutes until the solution turned visible blue in the well. A 50 μl/well of stop solution was added to terminate the enzymatic reaction. The color of the solution changed from blue to yellow. The light intensity was measured with an ELISA reader at 450 nm.
As shown in FIG. 3, T cells transfected with ST09D08 recognize MAGE-A1 presented by HLA-A 11:01 96-104 An antigenic peptide.
In vitro toxicity assay
T cells transfected with T cell receptor ST09D08 as effector cells at 5:1 was mixed with the target cells as an experimental group. The target cells used in this experiment were A549 cells transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells not transfected with T cell receptor were mixed with target cells in the same ratio as a control group. The killing of target cells by effector cells of the experimental and control groups was measured continuously over 48 hours.
As shown in fig. 4-5, T cells transfected with ST09D08 had significant killing effect on a549 target cells expressing HLA-A x 11:01 and MAGE-A1 proteins, with 93.8% of target cells killed. The untransfected T cells in the control group had no killing effect on the target cells.
Example 3 verification of MAGE-A1 specific T cell receptor ST09D08-AM01
The purpose of this example was to verify the expression of T Cell Receptor (TCR) ST09D08-AM01, polypeptide recognition, epitope recognition and in vitro toxicity.
TCR expression and polypeptide recognition assays
The TCR expression and polypeptide recognition assay is shown in figure 2A. The specific experimental procedure was the same as in example 2.
As shown in FIGS. 6A-B, ST09D08-AM01 can specifically recognize the polypeptide MAGE-A1 96-104 。
In vitro toxicity assay
T cells transfected with T cell receptors ST09D08 and ST09D08-AM01 were used as effector cells at 5:1 was mixed with the target cells as an experimental group. The target cells used in this experiment were A549 cells transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells not transfected with T cell receptor were mixed with target cells in the same ratio as a control group. The killing of target cells by effector cells of the experimental and control groups was measured continuously over 48 hours.
FIGS. 7-8 show cytotoxicity of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08 and ST09D08-AM01 in vitro on A549 cell lines transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells transfected with ST09D08-AM01 had significant killing effect on A549 target cells loaded with MAGE-A1 protein, and 90.5% of target cells were killed.
Example 4 verification of MAGE-A1 specific T cell receptor ST09D08-AM03
The purpose of this example was to verify the expression of T Cell Receptor (TCR) ST09D08-AM03, polypeptide recognition, epitope recognition and in vitro toxicity.
TCR expression and polypeptide recognition assays
The TCR expression and polypeptide recognition assay is shown in figure 2A. The specific experimental procedure was the same as in example 2.
As shown in FIGS. 9A-B, ST09D08-AM03 can specifically recognize the polypeptide MAGE-A1 96-104 。
In vitro toxicity assay
T cells transfected with T cell receptors ST09D08 and ST09D08-AM03 were used as effector cells at 5:1 was mixed with the target cells as an experimental group. The target cells used in this experiment were A549 cells transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells not transfected with T cell receptor were mixed with target cells in the same ratio as a control group. The killing of target cells by effector cells of the experimental and control groups was measured continuously over 48 hours.
FIGS. 10-11 show cytotoxicity of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08 and ST09D08-AM03 in vitro against A549 cell lines transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells transfected with ST09D08-AM03 had significant killing effect on A549 target cells loaded with MAGE-A1 protein, with 95.3% of target cells killed.
Example 5 verification of MAGE-A1 specific T cell receptor ST09D08-AM05
The purpose of this example was to verify the expression of T Cell Receptor (TCR) ST09D08-AM05, polypeptide recognition, epitope recognition and in vitro toxicity.
TCR expression and polypeptide recognition assays
The TCR expression and polypeptide recognition assay is shown in figure 2A. The specific experimental procedure was the same as in example 2.
As shown in FIGS. 12A-B, ST09D08-AM05 can specifically recognize the polypeptide MAGE-A1 96-104 。
In vitro toxicity assay
T cells transfected with T cell receptors ST09D08 and ST09D08-AM05 were used as effector cells at 5:1 was mixed with the target cells as an experimental group. The target cells used in this experiment were A549 cells transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells not transfected with T cell receptor were mixed with target cells in the same ratio as a control group. The killing of target cells by effector cells of the experimental and control groups was measured continuously over 48 hours.
FIGS. 13-14 show cytotoxicity of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08 and ST09D08-AM05 in vitro on A549 cell lines transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells transfected with ST09D08-AM05 had significant killing effect on A549 target cells loaded with MAGE-A1 protein, 94.2% of target cells were killed.
Example 6 verification of MAGE-A1 specific T cell receptor ST09D08-AM11
The purpose of this example was to verify the expression of T Cell Receptor (TCR) ST09D08-AM11, polypeptide recognition, epitope recognition and in vitro toxicity.
TCR expression and polypeptide recognition assays
The TCR expression and polypeptide recognition assay is shown in figure 2A. The specific experimental procedure was the same as in example 2.
As shown in FIGS. 15A-B, ST09D08-AM11 can specifically recognize the polypeptide MAGE-A1 96-104 。
In vitro toxicity assay
T cells transfected with T cell receptors ST09D08 and ST09D08-AM11 were used as effector cells at 5:1 was mixed with the target cells as an experimental group. The target cells used in this experiment were A549 cells transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells not transfected with T cell receptor were mixed with target cells in the same ratio as a control group. The killing of target cells by effector cells of the experimental and control groups was measured continuously over 48 hours.
FIGS. 16-17 show cytotoxicity of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08 and ST09D08-AM11 in vitro on A549 cell lines transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells transfected with ST09D08-AM11 had significant killing effect on A549 target cells loaded with MAGE-A1 protein, with 96.5% of target cells killed.
Example 7 verification of MAGE-A1 specific T cell receptor ST09D08-AM12
The purpose of this example was to verify the expression of T Cell Receptor (TCR) ST09D08-AM12, polypeptide recognition, epitope recognition and in vitro toxicity.
TCR expression and polypeptide recognition assays
The TCR expression and polypeptide recognition assay is shown in figure 2A. The specific experimental procedure was the same as in example 2.
As shown in FIG. 18, ST09D08-AM12 can specifically recognize the polypeptide MAGE-A1 96-104 。
In vitro toxicity assay
T cells transfected with T cell receptors ST09D08 and ST09D08-AM12 were used as effector cells at 5:1 was mixed with the target cells as an experimental group. The target cells used in this experiment were A549 cells transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells not transfected with T cell receptor were mixed with target cells in the same ratio as a control group. The killing of target cells by effector cells of the experimental and control groups was measured continuously over 48 hours.
FIG. 19 shows cytotoxicity of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08 and ST09D08-AM12 in vitro on A549 cell lines transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells transfected with ST09D08-AM12 had significant killing effect on A549 target cells loaded with MAGE-A1 protein, and 81.9% of target cells were killed.
Example 8 verification of MAGE-A1 specific T cell receptor ST09D08-AM14
The purpose of this example was to verify the expression of T Cell Receptor (TCR) ST09D08-AM14, polypeptide recognition, epitope recognition and in vitro toxicity.
TCR expression and polypeptide recognition assays
The TCR expression and polypeptide recognition assay is shown in figure 2A. The specific experimental procedure was the same as in example 2.
As shown in FIGS. 20A-B, ST09D08-AM14 can specifically recognize the polypeptide MAGE-A1 96-104 。
In vitro toxicity assay
T cells transfected with T cell receptors ST09D08 and ST09D08-AM14 were used as effector cells at 5:1 was mixed with the target cells as an experimental group. The target cells used in this experiment were A549 cells transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells not transfected with T cell receptor were mixed with target cells in the same ratio as a control group. The killing of target cells by effector cells of the experimental and control groups was measured continuously over 48 hours.
FIGS. 21-22 show cytotoxicity of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08 and ST09D08-AM14 in vitro on A549 cell lines transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells transfected with ST09D08-AM14 had significant killing effect on A549 target cells loaded with MAGE-A1 protein, and 89.8% of target cells were killed.
Example 9 verification of MAGE-A1 specific T cell receptor ST09D08-AM16
The purpose of this example was to verify the expression of T Cell Receptor (TCR) ST09D08-AM16, polypeptide recognition, epitope recognition and in vitro toxicity.
TCR expression and polypeptide recognition assays
The TCR expression and polypeptide recognition assay is shown in figure 2A. The specific experimental procedure was the same as in example 2.
As shown in FIGS. 23A-B, ST09D08-AM16 can specifically recognize the polypeptide MAGE-A1 96-104 。
In vitro toxicity assay
T cells transfected with T cell receptors ST09D08 and ST09D08-AM16 were used as effector cells at 5:1 was mixed with the target cells as an experimental group. The target cells used in this experiment were A549 cells transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells not transfected with T cell receptor were mixed with target cells in the same ratio as a control group. The killing of target cells by effector cells of the experimental and control groups was measured continuously over 48 hours.
FIGS. 24-25 show cytotoxicity of T cells expressing the MAGE-A1 antigen specific T cell receptor ST09D08 and ST09D08-AM16 in vitro on A549 cell lines transfected with HLA-A 11:01 and MAGE-A1 proteins. T cells transfected with ST09D08-AM16 had significant killing effect on A549 target cells loaded with MAGE-A1 protein, and 92.6% of target cells were killed.
CDR sequences of TCRs of the invention
The sequence related to the invention is as follows
Sequence(s) Number (number) | Annotating | Sequence(s) |
1 | ST09D0 8α-CDR1 | VSNAYN(SEQ ID NO.1) |
2 | ST09D08 α-CDR2 | GSKP(SEQ ID NO.2) |
3 | ST09D08 α-CDR3 | CAVEGQTGANNLFF(SEQ ID NO.3) |
4 | ST09D08 β-CDR1 | LNHDA(SEQ ID NO.4) |
5 | ST09D08 β-CDR2 | SQIVND(SEQ ID NO.5) |
6 | ST09D08 β-CDR3 | CASSIYGQLELYSYNEQFF(SEQ ID NO.6) |
7 | ST09D08 Vα-Jα | MALQSTLGAVWLGLLLNSLWKVAESKDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFW YLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVEGQTGAN NLFFGTGTRLTVIPY(SEQ ID NO.7) |
8 | ST09D08 Cα | IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSN SAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIG FRILLLKVAGFNLLMTLRLWSS(SEQ ID NO.8) |
9 | ST09D08 alpha chain | MALQSTLGAVWLGLLLNSLWKVAESKDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFW YLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVEGQTGAN NLFFGTGTRLTVIPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYIT DKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSF ETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS(SEQ ID NO.9) |
10 | ST09D08 Vβ-Jβ | MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPG QGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIYGQL ELYSYNEQFFGPGTRLTVLE(SEQ ID NO.10) |
11 | ST09D08 Cβ | DLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDP QPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQ IVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG (SEQ ID NO.11) |
12 | ST09D08 beta chain | MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPG QGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIYGQL ELYSYNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDH VELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQ FYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATL YAVLVSALVLMAMVKRKDSRG(SEQ ID NO.12) |
13 | ST09D08 P2A | GSGATNFSLLKQAGDVEENPGP(SEQ ID NO.13) |
14 | ST09D08 full Length | MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPG QGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIYGQL ELYSYNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDH VELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQ FYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATL YAVLVSALVLMAMVKRKDSRGGSGATNFSLLKQAGDVEENPGPMALQSTLGAVWLGLLL NSLWKVAESKDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGS KPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVEGQTGANNLFFGTGTRLTVIPYI QNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNS AVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGF RILLLKVAGFNLLMTLRLWSS(SEQ ID NO.14) |
15 | Murine ST09D08 alpha-CDR 1 | VSNAYN(SEQ ID NO.15) |
16 | Murine ST09D08 alpha-CDR 2 | GSKP(SEQ ID NO.16) |
17 | Murine ST09D08 alpha-CDR 3 | CAVEGQTGANNLFF(SEQ ID NO.17) |
18 | Murine ST09D08 beta-CDR 1 | LNHDA(SEQ ID NO.18) |
19 | Murine ST09D08 beta-CDR 2 | SQIVND(SEQ ID NO.19) |
20 | Murine ST09D08 beta-CDR 3 | CASSIYGQLELYSYNEQFF(SEQ ID NO.20) |
21 | Murine ST09D 08V alpha-J alpha | MALQSTLGAVWLGLLLNSLWKVAESKDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFW YLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVEGQTGAN NLFFGTGTRLTVIPY(SEQ ID NO.21) |
22 | Murine ST09D 08C alpha | IQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSN GAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVMVLRIL LLKVAGFNLLMTLRLWSS(SEQ ID NO.22) |
23 | Murine ST09D08 alpha chain | MALQSTLGAVWLGLLLNSLWKVAESKDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFW YLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVEGQTGAN NLFFGTGTRLTVIPYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFIT DKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDM NLNFQNLLVMVLRILLLKVAGFNLLMTLRLWSS(SEQ ID NO.23) |
24 | Murine ST09D 08V beta-J beta | MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPG QGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIYGQL ELYSYNEQFFGPGTRLTVLE(SEQ ID NO.24) |
25 | Murine ST09D 08C beta | DLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDP QAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISA EAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS(SEQ ID NO.25) |
26 | Murine ST09D08 beta chain | MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPG QGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIYGQL ELYSYNEQFFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDH VELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGL SEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVL VSTLVVMAMVKRKNS(SEQ ID NO.26) |
27 | Murine ST09D08P2A | GSGATNFSLLKQAGDVEENPGP(SEQ ID NO.27) |
28 | Murine ST09D08 full Length | MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPG QGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIYGQL ELYSYNEQFFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDH VELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGL SEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVL VSTLVVMAMVKRKNSGSGATNFSLLKQAGDVEENPGPMALQSTLGAVWLGLLLNSLWKV AESKDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGSKPSQQG RYNMTYERFSSSLLILQVREADAAVYYCAVEGQTGANNLFFGTGTRLTVIPYIQNPEPA VYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSN QTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVMVLRILLLKVAGF NLLMTLRLWSS(SEQ ID NO.28) |
29 | Murine+sequence optimization ST09D08 α-CDR1 | VSNAYN(SEQ ID NO.29) |
30 | Murine+sequence optimization ST09D08 α-CDR2 | GSKP(SEQ ID NO.30) |
31 | Murine+sequence optimization ST09D08 α-CDR3 | CAVEGQTGANNLFF(SEQ ID NO.31) |
32 | Murine+sequence optimization ST09D08 β-CDR1 | LNHDA(SEQ ID NO.32) |
33 | Murine+sequence optimization ST09D08 β-CDR2 | SQIVND(SEQ ID NO.33) |
34 | Murine+sequence optimization ST09D08 β-CDR3 | CASSIYGQLELYSYNEQFF(SEQ ID NO.34) |
35 | Murine+sequence optimization ST09D08 Vα-Jα | MALQSTLGAVWLGLLLNSLWKVAESKDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFW YLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVEGQTGAN NLFFGTGTRLTVIPY(SEQ ID NO.35) |
36 | Murine+sequence optimization ST09D08 Cα | IQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSN GAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVMVLRIL LLKVAGFNLLMTLRLWSS(SEQ ID NO.36) |
37 | Murine+sequence optimization ST09D08 Alpha chain | MALQSTLGAVWLGLLLNSLWKVAESKDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFW YLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVEGQTGAN NLFFGTGTRLTVIPYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFIT DKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDM NLNFQNLLVMVLRILLLKVAGFNLLMTLRLWSS(SEQ ID NO.37) |
38 | Murine+sequence optimization ST09D08 Vβ-Jβ | MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPG QGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIYGQL ELYSYNEQFFGPGTRLTVLE(SEQ ID NO.38) |
39 | Murine+sequence optimization ST09D08 Cβ | DLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDP QAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISA EAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS(SEQ ID NO.39) |
40 | Murine + sequence optimization ST09D08 beta Chain | MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPG QGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIYGQL ELYSYNEQFFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDH VELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGL SEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVL VSTLVVMAMVKRKNS(SEQ ID NO.40) |
41 | Murine+sequence optimization ST09D08P2A | GSGATNFSLLKQAGDVEENPGP(SEQ ID NO.41) |
42 | Murine + sequence optimization ST09D08 whole Long length | MSNQVLCCVVLCFLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPG QGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIYGQL ELYSYNEQFFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDH VELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGL SEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVL VSTLVVMAMVKRKNSGSGATNFSLLKQAGDVEENPGPMALQSTLGAVWLGLLLNSLWKV AESKDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGSKPSQQG RYNMTYERFSSSLLILQVREADAAVYYCAVEGQTGANNLFFGTGTRLTVIPYIQNPEPA VYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSN QTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLLVMVLRILLLKVAGF NLLMTLRLWSS(SEQ ID NO.42) |
43 | ST09D08 α-CDR1 DNA | GTGTCCAATGCTTACAAC(SEQ ID NO.43) |
44 | ST09D08 α-CDR2 DNA | GGCTCAAAGCCT(SEQ ID NO.44) |
45 | ST09D08 α-CDR3 DNA | TGTGCTGTGGAGGGACAAACTGGGGCAAACAACCTCTTCTTT(SEQ ID NO.45) |
46 | ST09D08 β-CDR1 DNA | TTGAACCACGATGCC(SEQ ID NO.46) |
47 | ST09D08 β-CDR2 DNA | TCACAGATAGTAAATGAC(SEQ ID NO.47) |
48 | ST09D08 β-CDR3 DNA | TGTGCCAGTAGTATATATGGTCAATTAGAACTATACTCCTACAATGAGCAGTTCTTC (SEQ ID NO.48) |
49 | ST09D08 Vα-Jα DNA | ATGGCTTTGCAGAGCACTCTGGGGGCGGTGTGGCTAGGGCTTCTCCTCAACTCTCTCTG GAAGGTTGCAGAAAGCAAGGACCAAGTGTTTCAGCCTTCCACAGTGGCATCTTCAGAGG GAGCTGTGGTGGAAATCTTCTGTAATCACTCTGTGTCCAATGCTTACAACTTCTTCTGG TACCTTCACTTCCCGGGATGTGCACCAAGACTCCTTGTTAAAGGCTCAAAGCCTTCTCA GCAGGGACGATACAACATGACCTATGAACGGTTCTCTTCATCGCTGCTCATCCTCCAGG TGCGGGAGGCAGATGCTGCTGTTTACTACTGTGCTGTGGAGGGACAAACTGGGGCAAAC AACCTCTTCTTTGGGACTGGAACGAGACTCACCGTTATTCCCTAT(SEQ ID NO.49) |
50 | ST09D08 Vβ-Jβ DNA | ATGAGCAACCAGGTGCTCTGCTGTGTGGTCCTTTGTTTCCTGGGAGCAAACACCGTGGA TGGTGGAATCACTCAGTCCCCAAAGTACCTGTTCAGAAAGGAAGGACAGAATGTGACCC TGAGTTGTGAACAGAATTTGAACCACGATGCCATGTACTGGTACCGACAGGACCCAGGG CAAGGGCTGAGATTGATCTACTACTCACAGATAGTAAATGACTTTCAGAAAGGAGATAT AGCTGAAGGGTACAGCGTCTCTCGGGAGAAGAAGGAATCCTTTCCTCTCACTGTGACAT CGGCCCAAAAGAACCCGACAGCTTTCTATCTCTGTGCCAGTAGTATATATGGTCAATTA GAACTATACTCCTACAATGAGCAGTTCTTCGGGCCAGGGACACGGCTCACCGTGCTAGAG (SEQ ID NO.50) |
51 | ST09D08 Cα DNA | ATCCAGAACCCTGACCCTGCCGTGTACCAGCTGAGAGACTCTAAATCCAGTGACAAGTC TGTCTGCCTATTCACCGATTTTGATTCTCAAACAAATGTGTCACAAAGTAAGGATTCTG ATGTGTATATCACAGACAAAACTGTGCTAGACATGAGGTCTATGGACTTCAAGAGCAAC AGTGCTGTGGCCTGGAGCAACAAATCTGACTTTGCATGTGCAAACGCCTTCAACAACAG CATTATTCCAGAAGACACCTTCTTCCCCAGCCCAGAAAGTTCCTGTGATGTCAAGCTGG TCGAGAAAAGCTTTGAAACAGATACGAACCTAAACTTTCAAAACCTGTCAGTGATTGGG TTCCGAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCTCATGACGCTGCGGCTGTG GTCCAGCTGA(SEQ ID NO.51) |
52 | ST09D08 Cβ DNA | GACCTGAAAAACGTGTTCCCACCCGAGGTCGCTGTGTTTGAGCCATCAGAAGCAGAGAT CTCCCACACCCAAAAGGCCACACTGGTGTGCCTGGCCACAGGCTTCTACCCCGACCACG TGGAGCTGAGCTGGTGGGTGAATGGGAAGGAGGTGCACAGTGGGGTCAGCACAGACCCG CAGCCCCTCAAGGAGCAGCCCGCCCTCAATGACTCCAGATACTGCCTGAGCAGCCGCCT GAGGGTCTCGGCCACCTTCTGGCAGAACCCCCGCAACCACTTCCGCTGTCAAGTCCAGT TCTACGGGCTCTCGGAGAATGACGAGTGGACCCAGGATAGGGCCAAACCTGTCACCCAG ATCGTCAGCGCCGAGGCCTGGGGTAGAGCAGACTGTGGCTTCACCTCCGAGTCTTACCA GCAAGGGGTCCTGTCTGCCACCATCCTCTATGAGATCTTGCTAGGGAAGGCCACCTTGT ATGCCGTGCTGGTCAGTGCCCTCGTGCTGATGGCCATGGTCAAGAGAAAGGATTCCAGA GGC(SEQ ID NO.52) |
53 | ST09D08P2A DNA | GGAAGCGGCGCCACGAACTTCTCTCTGTTAAAGCAAGCAGGAGACGTGGAAGAAAACCC CGGTCCC(SEQ ID NO.53) |
54 | ST09D08 full-length DNA | ATGAGCAACCAGGTGCTCTGCTGTGTGGTCCTTTGTTTCCTGGGAGCAAACACCGTGGA TGGTGGAATCACTCAGTCCCCAAAGTACCTGTTCAGAAAGGAAGGACAGAATGTGACCC TGAGTTGTGAACAGAATTTGAACCACGATGCCATGTACTGGTACCGACAGGACCCAGGG CAAGGGCTGAGATTGATCTACTACTCACAGATAGTAAATGACTTTCAGAAAGGAGATAT AGCTGAAGGGTACAGCGTCTCTCGGGAGAAGAAGGAATCCTTTCCTCTCACTGTGACAT CGGCCCAAAAGAACCCGACAGCTTTCTATCTCTGTGCCAGTAGTATATATGGTCAATTA GAACTATACTCCTACAATGAGCAGTTCTTCGGGCCAGGGACACGGCTCACCGTGCTAGA GGACCTGAAAAACGTGTTCCCACCCGAGGTCGCTGTGTTTGAGCCATCAGAAGCAGAGA TCTCCCACACCCAAAAGGCCACACTGGTGTGCCTGGCCACAGGCTTCTACCCCGACCAC GTGGAGCTGAGCTGGTGGGTGAATGGGAAGGAGGTGCACAGTGGGGTCAGCACAGACCC GCAGCCCCTCAAGGAGCAGCCCGCCCTCAATGACTCCAGATACTGCCTGAGCAGCCGCC TGAGGGTCTCGGCCACCTTCTGGCAGAACCCCCGCAACCACTTCCGCTGTCAAGTCCAG TTCTACGGGCTCTCGGAGAATGACGAGTGGACCCAGGATAGGGCCAAACCTGTCACCCA GATCGTCAGCGCCGAGGCCTGGGGTAGAGCAGACTGTGGCTTCACCTCCGAGTCTTACC AGCAAGGGGTCCTGTCTGCCACCATCCTCTATGAGATCTTGCTAGGGAAGGCCACCTTG TATGCCGTGCTGGTCAGTGCCCTCGTGCTGATGGCCATGGTCAAGAGAAAGGATTCCAG AGGCGGAAGCGGCGCCACGAACTTCTCTCTGTTAAAGCAAGCAGGAGACGTGGAAGAAA ACCCCGGTCCCATGGCTTTGCAGAGCACTCTGGGGGCGGTGTGGCTAGGGCTTCTCCTC AACTCTCTCTGGAAGGTTGCAGAAAGCAAGGACCAAGTGTTTCAGCCTTCCACAGTGGC ATCTTCAGAGGGAGCTGTGGTGGAAATCTTCTGTAATCACTCTGTGTCCAATGCTTACA ACTTCTTCTGGTACCTTCACTTCCCGGGATGTGCACCAAGACTCCTTGTTAAAGGCTCA AAGCCTTCTCAGCAGGGACGATACAACATGACCTATGAACGGTTCTCTTCATCGCTGCT CATCCTCCAGGTGCGGGAGGCAGATGCTGCTGTTTACTACTGTGCTGTGGAGGGACAAA CTGGGGCAAACAACCTCTTCTTTGGGACTGGAACGAGACTCACCGTTATTCCCTATATC CAGAACCCTGACCCTGCCGTGTACCAGCTGAGAGACTCTAAATCCAGTGACAAGTCTGT CTGCCTATTCACCGATTTTGATTCTCAAACAAATGTGTCACAAAGTAAGGATTCTGATG TGTATATCACAGACAAAACTGTGCTAGACATGAGGTCTATGGACTTCAAGAGCAACAGT GCTGTGGCCTGGAGCAACAAATCTGACTTTGCATGTGCAAACGCCTTCAACAACAGCAT TATTCCAGAAGACACCTTCTTCCCCAGCCCAGAAAGTTCCTGTGATGTCAAGCTGGTCG AGAAAAGCTTTGAAACAGATACGAACCTAAACTTTCAAAACCTGTCAGTGATTGGGTTC CGAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCTCATGACGCTGCGGCTGTGGTC CAGCTGA(SEQ ID NO.54) |
55 | Murine ST09D08 alpha-CDR 1 DNA | GTGTCCAATGCTTACAAC(SEQ ID NO.55) |
56 | Murine ST09D08 alpha-CDR 2 DNA | GGCTCAAAGCCT(SEQ ID NO.56) |
57 | Murine ST09D08 alpha-CDR 3 DNA | TGTGCTGTGGAGGGACAAACTGGGGCAAACAACCTCTTCTTT(SEQ ID NO.57) |
58 | Murine ST09D08 beta-CDR 1 DNA | TTGAACCACGATGCC(SEQ ID NO.58) |
59 | Murine ST09D08 beta-CDR 2 DNA | TCACAGATAGTAAATGAC(SEQ ID NO.59) |
60 | Murine ST09D08 beta-CDR 3 DNA | TGTGCCAGTAGTATATATGGTCAATTAGAACTATACTCCTACAATGAGCAGTTCTTC (SEQ ID NO.60) |
61 | Murine ST09D 08V alpha-J alpha DNA | ATGGCTTTGCAGAGCACTCTGGGGGCGGTGTGGCTAGGGCTTCTCCTCAACTCTCTCTG GAAGGTTGCAGAAAGCAAGGACCAAGTGTTTCAGCCTTCCACAGTGGCATCTTCAGAGG GAGCTGTGGTGGAAATCTTCTGTAATCACTCTGTGTCCAATGCTTACAACTTCTTCTGG TACCTTCACTTCCCGGGATGTGCACCAAGACTCCTTGTTAAAGGCTCAAAGCCTTCTCA GCAGGGACGATACAACATGACCTATGAACGGTTCTCTTCATCGCTGCTCATCCTCCAGG TGCGGGAGGCAGATGCTGCTGTTTACTACTGTGCTGTGGAGGGACAAACTGGGGCAAAC AACCTCTTCTTTGGGACTGGAACGAGACTCACCGTTATTCCCTAT(SEQ ID NO.61) |
62 | Murine ST09D 08V beta-J beta DNA | ATGAGCAACCAGGTGCTCTGCTGTGTGGTCCTTTGTTTCCTGGGAGCAAACACCGTGGA TGGTGGAATCACTCAGTCCCCAAAGTACCTGTTCAGAAAGGAAGGACAGAATGTGACCC TGAGTTGTGAACAGAATTTGAACCACGATGCCATGTACTGGTACCGACAGGACCCAGGG CAAGGGCTGAGATTGATCTACTACTCACAGATAGTAAATGACTTTCAGAAAGGAGATAT AGCTGAAGGGTACAGCGTCTCTCGGGAGAAGAAGGAATCCTTTCCTCTCACTGTGACAT CGGCCCAAAAGAACCCGACAGCTTTCTATCTCTGTGCCAGTAGTATATATGGTCAATTA GAACTATACTCCTACAATGAGCAGTTCTTCGGGCCAGGGACACGGCTCACCGTGCTAGAG (SEQ ID NO.62) |
63 | Murine ST09D 08C alpha DNA | ATCCAGAACCCAGAACCTGCTGTGTACCAGTTAAAAGATCCTCGGTCTCAGGACAGCAC CCTCTGCCTGTTCACCGACTTTGACTCCCAAATCAATGTGCCGAAAACCATGGAATCTG GAACGTTCATCACTGACAAAACTGTGCTGGACATGAAAGCTATGGATTCCAAGAGCAAT GGGGCCATTGCCTGGAGCAACCAGACAAGCTTCACCTGCCAAGATATCTTCAAAGAGAC CAACGCCACCTACCCCAGTTCAGACGTTCCCTGTGATGCCACGTTGACTGAGAAAAGCT TTGAAACAGATATGAACCTAAACTTTCAAAACCTGCTGGTTATGGTTCTCCGAATCCTC CTGCTGAAAGTAGCCGGATTTAACCTGCTCATGACGCTGAGGCTGTGGTCCAGTTGA (SEQ ID NO.63) |
64 | Murine ST09D 08C beta DNA | GATCTGAGAAATGTGACTCCACCCAAGGTCTCCTTGTTTGAGCCATCAAAAGCAGAGAT TGCAAACAAACAAAAGGCTACCCTCGTGTGCTTGGCCAGGGGCTTCTTCCCTGACCACG TGGAGCTGAGCTGGTGGGTGAATGGCAAGGAGGTCCACAGTGGGGTCAGCACGGACCCT CAGGCCTACAAGGAGAGCAATTATAGCTACTGCCTGAGCAGCCGCCTGAGGGTCTCTGC TACCTTCTGGCACAATCCTCGCAACCACTTCCGCTGCCAAGTGCAGTTCCATGGGCTTT CAGAGGAGGACAAGTGGCCAGAGGGCTCACCCAAACCTGTCACACAGAACATCAGTGCA GAGGCCTGGGGCCGAGCAGACTGTGGGATTACCTCAGCATCCTATCAACAAGGGGTCTT GTCTGCCACCATCCTCTATGAGATCCTGCTAGGGAAAGCCACCCTGTATGCTGTGCTTG TCAGTACACTGGTGGTGATGGCTATGGTCAAAAGAAAAAATTCA(SEQ ID NO.64) |
65 | Murine ST09D08P2A DNA | GGAAGCGGCGCCACGAACTTCTCTCTGTTAAAGCAAGCAGGAGACGTGGAAGAAAACCC CGGTCCC(SEQ ID NO.65) |
66 | Murine ST09D08 full-length DNA | ATGAGCAACCAGGTGCTCTGCTGTGTGGTCCTTTGTTTCCTGGGAGCAAACACCGTGGA TGGTGGAATCACTCAGTCCCCAAAGTACCTGTTCAGAAAGGAAGGACAGAATGTGACCC TGAGTTGTGAACAGAATTTGAACCACGATGCCATGTACTGGTACCGACAGGACCCAGGG CAAGGGCTGAGATTGATCTACTACTCACAGATAGTAAATGACTTTCAGAAAGGAGATAT AGCTGAAGGGTACAGCGTCTCTCGGGAGAAGAAGGAATCCTTTCCTCTCACTGTGACAT CGGCCCAAAAGAACCCGACAGCTTTCTATCTCTGTGCCAGTAGTATATATGGTCAATTA GAACTATACTCCTACAATGAGCAGTTCTTCGGGCCAGGGACACGGCTCACCGTGCTAGA GGATCTGAGAAATGTGACTCCACCCAAGGTCTCCTTGTTTGAGCCATCAAAAGCAGAGA TTGCAAACAAACAAAAGGCTACCCTCGTGTGCTTGGCCAGGGGCTTCTTCCCTGACCAC GTGGAGCTGAGCTGGTGGGTGAATGGCAAGGAGGTCCACAGTGGGGTCAGCACGGACCC TCAGGCCTACAAGGAGAGCAATTATAGCTACTGCCTGAGCAGCCGCCTGAGGGTCTCTG CTACCTTCTGGCACAATCCTCGCAACCACTTCCGCTGCCAAGTGCAGTTCCATGGGCTT TCAGAGGAGGACAAGTGGCCAGAGGGCTCACCCAAACCTGTCACACAGAACATCAGTGC AGAGGCCTGGGGCCGAGCAGACTGTGGGATTACCTCAGCATCCTATCAACAAGGGGTCT TGTCTGCCACCATCCTCTATGAGATCCTGCTAGGGAAAGCCACCCTGTATGCTGTGCTT GTCAGTACACTGGTGGTGATGGCTATGGTCAAAAGAAAAAATTCAGGAAGCGGCGCCAC GAACTTCTCTCTGTTAAAGCAAGCAGGAGACGTGGAAGAAAACCCCGGTCCCATGGCTT TGCAGAGCACTCTGGGGGCGGTGTGGCTAGGGCTTCTCCTCAACTCTCTCTGGAAGGTT GCAGAAAGCAAGGACCAAGTGTTTCAGCCTTCCACAGTGGCATCTTCAGAGGGAGCTGT GGTGGAAATCTTCTGTAATCACTCTGTGTCCAATGCTTACAACTTCTTCTGGTACCTTC ACTTCCCGGGATGTGCACCAAGACTCCTTGTTAAAGGCTCAAAGCCTTCTCAGCAGGGA CGATACAACATGACCTATGAACGGTTCTCTTCATCGCTGCTCATCCTCCAGGTGCGGGA GGCAGATGCTGCTGTTTACTACTGTGCTGTGGAGGGACAAACTGGGGCAAACAACCTCT TCTTTGGGACTGGAACGAGACTCACCGTTATTCCCTATATCCAGAACCCAGAACCTGCT GTGTACCAGTTAAAAGATCCTCGGTCTCAGGACAGCACCCTCTGCCTGTTCACCGACTT TGACTCCCAAATCAATGTGCCGAAAACCATGGAATCTGGAACGTTCATCACTGACAAAA CTGTGCTGGACATGAAAGCTATGGATTCCAAGAGCAATGGGGCCATTGCCTGGAGCAAC CAGACAAGCTTCACCTGCCAAGATATCTTCAAAGAGACCAACGCCACCTACCCCAGTTC AGACGTTCCCTGTGATGCCACGTTGACTGAGAAAAGCTTTGAAACAGATATGAACCTAA ACTTTCAAAACCTGCTGGTTATGGTTCTCCGAATCCTCCTGCTGAAAGTAGCCGGATTT AACCTGCTCATGACGCTGAGGCTGTGGTCCAGTTGA(SEQ ID NO.66) |
67 | Murine+sequence optimization ST09D08 α-CDR1 DNA | GTGAGCAACGCTTACAAC(SEQ ID NO.67) |
68 | Murine+sequence optimization ST09D08 α-CDR2 DNA | GGCAGCAAGCCT(SEQ ID NO.68) |
69 | Murine+sequence optimization ST09D08 α-CDR3 DNA | TGCGCCGTGGAGGGGCAGACCGGCGCCAACAACCTGTTCTTC(SEQ ID NO.69) |
70 | Murine+sequence optimization ST09D08 β-CDR1 DNA | CTGAACCACGACGCC(SEQ ID NO.70) |
71 | Murine+sequence optimization ST09D08 β-CDR2 DNA | AGCCAAATCGTGAACGAC(SEQ ID NO.71) |
72 | Murine+sequence optimization ST09D08 β-CDR3 DNA | TGCGCTAGCAGCATCTACGGGCAGCTGGAGCTGTACAGCTACAACGAGCAGTTCTTC (SEQ ID NO.72) |
73 | Murine+sequence optimization ST09D08 Vα-JαDNA | ATGGCCCTCCAAAGCACCCTGGGCGCCGTGTGGCTGGGCCTGCTCCTGAACTCCCTGTG GAAGGTGGCCGAGAGCAAGGACCAAGTGTTTCAGCCTAGCACCGTGGCTAGCAGCGAGG GCGCCGTGGTGGAGATCTTCTGCAACCACAGCGTGAGCAACGCTTACAACTTCTTCTGG TACCTGCACTTCCCCGGCTGCGCCCCTAGACTGCTGGTGAAGGGCAGCAAGCCTAGCCA ACAAGGCAGATACAACATGACCTACGAGAGATTCAGCAGCAGCCTGCTGATCCTGCAAG TGAGAGAGGCCGACGCCGCCGTGTACTACTGCGCCGTGGAGGGGCAGACCGGCGCCAAC AACCTGTTCTTCGGCACCGGCACAAGACTGACCGTGATCCCCTAC(SEQ ID NO.73) |
74 | Murine+sequence optimization ST09D08 Cα DNA | ATTCAGAACCCCGAGCCCGCCGTGTATCAGCTGAAGGACCCTAGAAGCCAAGACAGCAC CCTGTGCCTGTTCACCGACTTCGACAGCCAAATCAACGTGCCCAAGACCATGGAGAGCG GCACCTTCATCACCGACAAGACCGTGCTGGATATGAAGGCCATGGACAGCAAGAGCAAC GGCGCCATCGCCTGGAGCAATCAGACAAGCTTCACCTGCCAAGACATCTTCAAGGAGAC CAACGCCACCTACCCTAGCAGCGACGTGCCCTGCGACGCCACCCTGACCGAGAAGAGCT TCGAGACCGACATGAACCTGAACTTTCAGAACCTGCTGGTGATGGTGCTGAGAATCCTC CTGCTGAAAGTGGCCGGCTTCAACCTGCTGATGACCCTGAGACTGTGGAGCAGCTGA (SEQ ID NO.74) |
75 | Murine+sequence optimization ST09D08 Vβ-Jβ DNA | ATGAGCAACCAAGTGCTGTGCTGCGTGGTGCTGTGCTTCCTGGGCGCCAACACCGTGGA CGGCGGCATCACACAGAGCCCCAAGTACCTGTTCAGAAAGGAGGGGCAGAACGTGACCC TGAGCTGCGAGCAGAACCTGAACCACGACGCCATGTACTGGTACAGACAAGACCCCGGC CAAGGCCTGAGACTGATCTACTACAGCCAAATCGTGAACGACTTTCAGAAGGGCGACAT CGCCGAGGGCTACTCCGTCAGCAGAGAGAAGAAGGAGAGCTTCCCCCTGACCGTGACAA GCGCTCAGAAGAACCCCACCGCCTTCTACCTGTGCGCTAGCAGCATCTACGGGCAGCTG GAGCTGTACAGCTACAACGAGCAGTTCTTCGGCCCCGGCACCCGGCTCACCGTCCTGGAG (SEQ ID NO.75) |
76 | Murine+sequence optimization ST09D08 Cβ DNA | GACCTGAGAAACGTGACCCCCCCCAAGGTGAGCCTGTTCGAGCCTAGCAAGGCCGAGAT CGCCAACAAGCAGAAGGCTACCCTGGTGTGCCTGGCTAGAGGCTTCTTCCCCGACCACG TGGAGCTGAGCTGGTGGGTGAACGGCAAAGAGGTGCACAGCGGCGTGAGCACCGACCCC CAAGCCTACAAGGAGAGCAACTACAGCTACTGCCTGAGCAGCAGACTGAGAGTGAGCGC CACCTTCTGGCACAACCCTAGAAACCACTTCAGATGCCAAGTGCAGTTCCACGGCCTGA GCGAGGAGGACAAGTGGCCCGAGGGCAGCCCCAAGCCCGTGACACAGAACATCAGCGCC GAGGCCTGGGGCAGAGCCGACTGCGGCATCACAAGCGCTAGCTATCAGCAAGGCGTGCT GAGCGCCACCATCCTGTACGAGATCCTGCTGGGCAAAGCCACCCTGTATGCCGTGCTGG TGAGCACCCTGGTGGTGATGGCCATGGTGAAGAGAAAGAACAGC(SEQ ID NO.76) |
77 | Murine+sequence optimization ST09D08P2A DNA | GGCAGCGGCGCCACCAACTTCAGCCTGCTGAAGCAAGCCGGCGACGTGGAGGAGAACCC CGGCCCC(SEQ ID NO.77) |
78 | Murine + sequence optimization ST09D08 whole Long DNA | ATGAGCAACCAAGTGCTGTGCTGCGTGGTGCTGTGCTTCCTGGGCGCCAACACCGTGGA CGGCGGCATCACACAGAGCCCCAAGTACCTGTTCAGAAAGGAGGGGCAGAACGTGACCC TGAGCTGCGAGCAGAACCTGAACCACGACGCCATGTACTGGTACAGACAAGACCCCGGC CAAGGCCTGAGACTGATCTACTACAGCCAAATCGTGAACGACTTTCAGAAGGGCGACAT CGCCGAGGGCTACTCCGTCAGCAGAGAGAAGAAGGAGAGCTTCCCCCTGACCGTGACAA GCGCTCAGAAGAACCCCACCGCCTTCTACCTGTGCGCTAGCAGCATCTACGGGCAGCTG GAGCTGTACAGCTACAACGAGCAGTTCTTCGGCCCCGGCACCCGGCTCACCGTCCTGGA GGACCTGAGAAACGTGACCCCCCCCAAGGTGAGCCTGTTCGAGCCTAGCAAGGCCGAGA TCGCCAACAAGCAGAAGGCTACCCTGGTGTGCCTGGCTAGAGGCTTCTTCCCCGACCAC GTGGAGCTGAGCTGGTGGGTGAACGGCAAAGAGGTGCACAGCGGCGTGAGCACCGACCC CCAAGCCTACAAGGAGAGCAACTACAGCTACTGCCTGAGCAGCAGACTGAGAGTGAGCG CCACCTTCTGGCACAACCCTAGAAACCACTTCAGATGCCAAGTGCAGTTCCACGGCCTG AGCGAGGAGGACAAGTGGCCCGAGGGCAGCCCCAAGCCCGTGACACAGAACATCAGCGC CGAGGCCTGGGGCAGAGCCGACTGCGGCATCACAAGCGCTAGCTATCAGCAAGGCGTGC TGAGCGCCACCATCCTGTACGAGATCCTGCTGGGCAAAGCCACCCTGTATGCCGTGCTG GTGAGCACCCTGGTGGTGATGGCCATGGTGAAGAGAAAGAACAGCGGCAGCGGCGCCAC CAACTTCAGCCTGCTGAAGCAAGCCGGCGACGTGGAGGAGAACCCCGGCCCCATGGCCC TCCAAAGCACCCTGGGCGCCGTGTGGCTGGGCCTGCTCCTGAACTCCCTGTGGAAGGTG GCCGAGAGCAAGGACCAAGTGTTTCAGCCTAGCACCGTGGCTAGCAGCGAGGGCGCCGT GGTGGAGATCTTCTGCAACCACAGCGTGAGCAACGCTTACAACTTCTTCTGGTACCTGC ACTTCCCCGGCTGCGCCCCTAGACTGCTGGTGAAGGGCAGCAAGCCTAGCCAACAAGGC AGATACAACATGACCTACGAGAGATTCAGCAGCAGCCTGCTGATCCTGCAAGTGAGAGA GGCCGACGCCGCCGTGTACTACTGCGCCGTGGAGGGGCAGACCGGCGCCAACAACCTGT TCTTCGGCACCGGCACAAGACTGACCGTGATCCCCTACATTCAGAACCCCGAGCCCGCC GTGTATCAGCTGAAGGACCCTAGAAGCCAAGACAGCACCCTGTGCCTGTTCACCGACTT CGACAGCCAAATCAACGTGCCCAAGACCATGGAGAGCGGCACCTTCATCACCGACAAGA CCGTGCTGGATATGAAGGCCATGGACAGCAAGAGCAACGGCGCCATCGCCTGGAGCAAT CAGACAAGCTTCACCTGCCAAGACATCTTCAAGGAGACCAACGCCACCTACCCTAGCAG CGACGTGCCCTGCGACGCCACCCTGACCGAGAAGAGCTTCGAGACCGACATGAACCTGA ACTTTCAGAACCTGCTGGTGATGGTGCTGAGAATCCTCCTGCTGAAAGTGGCCGGCTTC AACCTGCTGATGACCCTGAGACTGTGGAGCAGCTGA(SEQ ID NO.78) |
79 | ST09D08 alpha-CDR 3 optimized amino groups Acid sequence (ST 09D08-AM 01) | CAVEFQTGANNLFF(SEQ ID NO.79) |
80 | ST09D08 alpha-CDR 3 optimized amino groups Acid sequence (ST 09D08-AM 03) | CAVEGQTGADNLFF(SEQ ID NO.80) |
81 | ST09D08 beta-CDR 3 optimized amino group Acid sequence (ST 09D08-AM 05) | CASSIYYQLELYSYNEQFF(SEQ ID NO.81) |
82 | ST09D08 beta-CDR 3 optimized amino group Acid sequence (ST 09D08-AM 11) | CASSIYGELELYSYNEQFF(SEQ ID NO.82) |
83 | ST09D08 beta-CDR 3 optimized amino group Acid sequence (ST 09D08-AM 12) | CASSIYGILELYSYNEQFF(SEQ ID NO.83) |
84 | ST09D08 beta-CDR 3 optimized amino group Acid sequence (ST 09D08-AM 14) | CASSIYGQLELYDYNEQFF(SEQ ID NO.84) |
85 | ST09D08 beta-CDR 3 optimized amino group Acid sequence (ST 09D08-AM 16) | CASSIYGQLELYSANEQFF(SEQ ID NO.85) |
86 | ST09D08 alpha-CDR 3 optimized nucleosides Acid sequence (ST 09D08-AM 01) | TGCGCCGTGGAGTTCCAGACCGGCGCCAACAACCTGTTCTTC(SEQ ID NO.86) |
87 | ST09D08 alpha-CDR 3 optimized nucleosides Acid sequence (ST 09D08-AM 03) | TGCGCCGTGGAGGGGCAGACCGGCGCCGACAACCTGTTCTTC(SEQ ID NO.87) |
88 | ST09D08 beta-CDR 3 optimized nucleosides Acid sequence (ST 09D08-AM 05) | TGCGCTAGCAGCATCTACTACCAGCTGGAGCTGTACAGCTACAACGAGCAGTTCTTC (SEQ ID NO.88) |
89 | ST09D08 beta-CDR 3 optimized nucleosides Acid sequence (ST 09D08-AM 11) | TGCGCTAGCAGCATCTACGGGGAGCTGGAGCTGTACAGCTACAACGAGCAGTTCTTC (SEQ ID NO.89) |
90 | ST09D08 beta-CDR 3 optimized nucleosides Acid sequence (ST 09D08-AM 12) | TGCGCTAGCAGCATCTACGGGATCCTGGAGCTGTACAGCTACAACGAGCAGTTCTTC (SEQ ID NO.90) |
91 | ST09D08 beta-CDR 3 optimized nucleosides Acid sequence (ST 09D08-AM 14) | TGCGCTAGCAGCATCTACGGGCAGCTGGAGCTGTACGACTACAACGAGCAGTTCTTC (SEQ ID NO.91) |
92 | ST09D08 beta-CDR 3 optimized nucleosides Acid sequence (ST 09D08-AM 16) | TGCGCTAGCAGCATCTACGGGCAGCTGGAGCTGTACAGCGCCAACGAGCAGTTCTTC (SEQ ID NO.92) |
93 | MAGE-A196-104 | SLFRAVITK(SEQ ID NO.93) |
Claims (27)
1. An isolated tumor-specific T Cell Receptor (TCR), or antigen binding domain thereof, that specifically binds to a major tissue compatibility complex (MHC)/MAGE-A1 epitope complex, the tumor-specific TCR comprising: a TCR a chain comprising CDR1 of the amino acid sequence of SEQ ID No. 1, CDR2 of the amino acid sequence of SEQ ID No. 2, and CDR3 of the amino acid sequence of SEQ ID No. 3; and a TCR beta chain comprising CDR1 of the amino acid sequence of SEQ ID NO. 4, CDR2 of the amino acid sequence of SEQ ID NO. 5 and CDR3 of the amino acid sequence of SEQ ID NO. 6.
2. The isolated tumor-specific TCR, or antigen-binding domain thereof, according to claim 1, wherein the MAGE-A1 epitope is the amino acid sequence set forth in SEQ ID No. 93.
3. The isolated tumor-specific TCR or antigen-binding domain thereof of claim 1 or 2, wherein the MHC is HLA-A x 11:01.
4. The isolated tumor-specific TCR, or antigen-binding domain thereof, of claim 1, comprising: a TCR alpha chain comprising the variable region of the amino acid sequence of SEQ ID NO. 7, and a TCR beta chain comprising the variable region of the amino acid sequence of SEQ ID NO. 10.
5. The isolated tumor-specific TCR, or antigen-binding domain thereof, of claim 1, comprising: a TCR alpha chain comprising the amino acid sequences of SEQ ID NOs 7 and 8, and a TCR beta chain comprising the amino acid sequences of SEQ ID NOs 10 and 11.
6. An isolated TCR or antigen-binding domain thereof according to claim 1, which is isolated or purified or recombinant.
7. An isolated TCR or antigen-binding domain thereof according to claim 1, which is chimeric, humanised or human.
8. The isolated TCR or antigen-binding domain thereof according to claim 1, wherein the TCR or antigen-binding domain thereof is single chain.
9. An isolated TCR or antigen-binding domain thereof according to claim 8, wherein the TCR a chain further comprises an a constant (ca) region and/or the TCR β chain further comprises a β constant (cβ) region.
10. The isolated TCR or antigen-binding domain thereof according to claim 9, wherein the cα region and the cβ region are mouse constant regions.
11. An isolated TCR or antigen-binding domain thereof according to claim 10 wherein the cα region comprises the amino acid sequence of SEQ ID No. 22 and/or the cβ region comprises the amino acid sequence of SEQ ID No. 25.
12. An isolated TCR, or an antigen-binding domain thereof, according to claim 11, comprising: a TCR alpha chain comprising the amino acid sequences of SEQ ID NOs: 21 and 22, and a TCR beta chain comprising the amino acid sequences of SEQ ID NOs:24 and 25.
13. The isolated TCR or antigen-binding domain thereof according to claim 1, wherein the TCR alpha chain and/or the TCR beta chain further comprises a signal peptide.
14. An isolated nucleic acid molecule encoding the TCR a chain and the TCR β chain of an isolated TCR or antigen-binding domain thereof according to any of the preceding claims.
15. The isolated nucleic acid molecule of claim 14, wherein the sequence of the nucleic acid molecule is codon optimized.
16. The isolated nucleic acid molecule of claim 14 or 15, wherein the nucleotide sequence encoding the TCR a chain and the nucleotide sequence encoding the TCR β chain are separated by a self-cleaving peptide sequence.
17. The isolated nucleic acid molecule of claim 16, wherein the self-cleaving peptide is P2A comprising the amino acid sequence shown in SEQ ID nos. 13.
18. An engineered immune cell comprising the isolated TCR or antigen-binding domain thereof, or nucleic acid encoding the same, of any one of claims 1-13, which is a cell line or a primary or heterologous cell obtained from a subject.
19. The engineered immune cell of claim 18, wherein the immune cell is a human cell, including but not limited to a T cell, NK cell, or macrophage.
20. The engineered immune cell of claim 19, wherein the immune cell is a T cell.
21. The engineered immune cell of claim 20, wherein the engineered cell comprises a cd8+ T cell.
22. The engineered immune cell of claim 20, wherein the engineered cell comprises a cd4+ T cell.
23. A pharmaceutical composition comprising the engineered immune cell of claim 21 or 22, and a pharmaceutically acceptable carrier.
24. Use of the engineered immune cell of claim 18 in the manufacture of a medicament for the treatment of MAGE-A1 expressing lung cancer, liver cancer and colorectal cancer.
25. The use of claim 24, wherein the engineered immune cell is an autologous or allogeneic cell of the subject.
26. An isolated tumor-specific T Cell Receptor (TCR) or antigen binding domain thereof that specifically binds to a major tissue compatibility complex (MHC)/MAGE-A1 epitope complex, wherein the tumor-specific TCR comprises: a TCR a chain comprising CDR1 of the amino acid sequence of SEQ ID No. 1, CDR2 of the amino acid sequence of SEQ ID No. 2, and CDR3 of the amino acid sequence of SEQ ID No. 3; and a TCR beta chain comprising CDR1 of the amino acid sequence of SEQ ID NO. 4, CDR2 of the amino acid sequence of SEQ ID NO. 5 and CDR3 of the amino acid sequence of SEQ ID NO. 81.
27. An isolated tumor-specific T Cell Receptor (TCR) or antigen binding domain thereof that specifically binds to a major tissue compatibility complex (MHC)/MAGE-A1 epitope complex, wherein the tumor-specific TCR comprises: a TCR a chain comprising CDR1 of the amino acid sequence of SEQ ID No. 1, CDR2 of the amino acid sequence of SEQ ID No. 2, and CDR3 of the amino acid sequence of SEQ ID No. 3; and a TCR beta chain comprising CDR1 of the amino acid sequence of SEQ ID NO. 4, CDR2 of the amino acid sequence of SEQ ID NO. 5 and CDR3 of the amino acid sequence of SEQ ID NO. 84.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202311208572.4A CN116970066B (en) | 2023-09-19 | 2023-09-19 | MAGE-A1 specific T cell receptor and uses thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202311208572.4A CN116970066B (en) | 2023-09-19 | 2023-09-19 | MAGE-A1 specific T cell receptor and uses thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN116970066A CN116970066A (en) | 2023-10-31 |
CN116970066B true CN116970066B (en) | 2024-03-12 |
Family
ID=88485217
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202311208572.4A Active CN116970066B (en) | 2023-09-19 | 2023-09-19 | MAGE-A1 specific T cell receptor and uses thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN116970066B (en) |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN110114085A (en) * | 2016-12-08 | 2019-08-09 | 伊玛提克斯生物技术有限公司 | Novel T cell receptor and its immunization therapy application |
CN111499763A (en) * | 2020-03-31 | 2020-08-07 | 江苏省省级机关医院 | Specific fully human chimeric antigen receptor targeting MAGE-A1 and application thereof |
IL276599A (en) * | 2020-08-09 | 2022-03-01 | Yeda Res & Dev | Mage-a1 specific t cell receptor and uses thereof |
CN114539386A (en) * | 2022-04-27 | 2022-05-27 | 恒瑞源正(广州)生物科技有限公司 | MAGE-A1 specific T cell receptor and uses thereof |
-
2023
- 2023-09-19 CN CN202311208572.4A patent/CN116970066B/en active Active
Patent Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN110114085A (en) * | 2016-12-08 | 2019-08-09 | 伊玛提克斯生物技术有限公司 | Novel T cell receptor and its immunization therapy application |
CN111499763A (en) * | 2020-03-31 | 2020-08-07 | 江苏省省级机关医院 | Specific fully human chimeric antigen receptor targeting MAGE-A1 and application thereof |
IL276599A (en) * | 2020-08-09 | 2022-03-01 | Yeda Res & Dev | Mage-a1 specific t cell receptor and uses thereof |
CN114539386A (en) * | 2022-04-27 | 2022-05-27 | 恒瑞源正(广州)生物科技有限公司 | MAGE-A1 specific T cell receptor and uses thereof |
CN116063458A (en) * | 2022-04-27 | 2023-05-05 | 恒瑞源正(广州)生物科技有限公司 | MAGE-A1 specific T cell receptor and uses thereof |
CN116063457A (en) * | 2022-04-27 | 2023-05-05 | 恒瑞源正(广州)生物科技有限公司 | MAGE-A1 specific T cell receptor and uses thereof |
CN116693656A (en) * | 2022-04-27 | 2023-09-05 | 恒瑞源正(广州)生物科技有限公司 | MAGE-A1 specific T cell receptor and uses thereof |
Non-Patent Citations (2)
Title |
---|
Avidity optimization of a MAGE-A1-specific TCR with somatic hypermutatiion;David bassan, et al.;《Eur J Immunol.》;第51卷(第6期);第1505-1518页 * |
全人源抗MAGE-A1单链抗体的筛选及免疫活性鉴定;丁贵鹏 等;《南京医科大学学报(自然科学版)》;第25卷(第7期);第484-488页 * |
Also Published As
Publication number | Publication date |
---|---|
CN116970066A (en) | 2023-10-31 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10822389B2 (en) | Antibody/T-cell receptor chimeric constructs and uses thereof | |
KR20200133370A (en) | How to strengthen the persistence of adoptively injected T cells | |
JP2017500009A (en) | Modified hematopoietic stem / progenitor cells and non-effector T cells and uses thereof | |
JP2022542321A (en) | NK cell compositions and preparations for immunotherapy and methods for their production | |
CN114539386B (en) | MAGE-A1 specific T cell receptor and uses thereof | |
KR20210055034A (en) | How to use immune effector cells to treat tumors | |
CN116970066B (en) | MAGE-A1 specific T cell receptor and uses thereof | |
CN117567595B (en) | MAGE-A4 specific T cell receptor and uses thereof | |
CN117624339A (en) | MAGE-A1 specific T cell receptor and uses thereof | |
CN117624338A (en) | MAGE-A1 specific T cell receptor and uses thereof | |
CN117659165A (en) | MAGE-A1 specific T cell receptor and uses thereof | |
CN117946248A (en) | MAGE-A1 specific T cell receptor and uses thereof | |
CN117924461A (en) | MAGE-A1 specific T cell receptor and uses thereof | |
CN116496411A (en) | AFP specific T cell receptor and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant | ||
CB03 | Change of inventor or designer information |
Inventor after: Han Yanyan Inventor after: Chu Junjun Inventor after: Ou Shudan Inventor after: Ma Minjun Inventor before: Han Yanyan Inventor before: Chu Junjun Inventor before: Ou Shudan Inventor before: Ma Minjun |
|
CB03 | Change of inventor or designer information |