CN116789857A

CN116789857A - CXCR-based signal transduction receptor

Info

Publication number: CN116789857A
Application number: CN202310742450.7A
Authority: CN
Inventors: 金华君; 李建辉; 黄晨
Original assignee: Shanghai Junsai Biotechnology Co ltd
Current assignee: Shanghai Junsai Biotechnology Co ltd
Priority date: 2022-06-21
Filing date: 2023-06-21
Publication date: 2023-09-22

Abstract

The present invention relates to CXC chemokine receptor-based signaling receptors, and in particular provides an isolated fusion protein comprising: a CXC chemokine receptor region which is a CXC chemokine receptor or a fragment or mutant thereof, and an intracellular region comprising an intracellular domain of a costimulatory signaling molecule or a functional fragment or mutant thereof. The immune effector cell expressing the signal conversion receptor has higher activation level while improving tumor trend, and can kill tumor more effectively.

Description

CXCR-based signal transduction receptor

Technical Field

The invention relates to the field of biotechnology, in particular to a signal conversion receptor and application thereof.

Background

In recent years, a plurality of reports on the negative regulation inhibitory signal channel of immune effector cells have been made on connecting the extracellular region of the corresponding receptor with the transmembrane region and the intracellular region of a positive co-stimulatory signal molecule, so that a novel fusion receptor is constructed, the fusion receptor plays a role of a signal converter after being expressed in the immune effector cells, and can convert an immune inhibitory signal in a tumor microenvironment into an immune activating signal, namely, the signal converting molecule extracellular polypeptide receives the immune inhibitory molecule signal on the surface of the tumor cells, the surface of the tumor stroma cells or the tumor microenvironment and transmits the immune inhibitory molecule signal to the cells, and the second signal of the immune cells is activated through the intracellular section of the co-stimulatory signal molecule, so that the proliferation and cytokine secretion functions of the immune effector cells are enhanced, and the survival time of the activated immune effector cells is prolonged.

Chronic inflammation in the long term is one of the hallmarks of tumorigenesis. Inflammatory responses to numerous cytokines in the tumor microenvironment play a critical role in promoting tumor growth, progression and immunosuppression. IL-8 (CXCL 8) is a class of chemokines belonging to the CXC family responsible for the recruitment and activation of granulocytes at the site of inflammation. Under physiological conditions, IL-8 secretion is essentially undetectable, and secretion is rapidly induced to rise in the presence of pro-inflammatory factors such as TNF- α, IL-1β. IL-8 exerts its biological functions by binding to its corresponding receptors CXCR1 and CXCR 2. The main effect of IL-8 binding to CXCR1 is to increase tumor cell proliferation, whereas binding to CXCR2 promotes angiogenesis in certain cancers (e.g. prostate cancer). High levels of IL-8 often indicate an increased risk of cancer and a poor prognosis for the disease. CXCR1 and CXCR2 are expressed on granulocytes, monocytes, megacells and certain NK cells.

In order to stimulate proliferation of immune effector cells and improve tumor immunity effect, the promotion effect of IL-8/CXCR1/2 signal axes on tumor growth and the inhibition of immune microenvironment are required to be reduced, and more means including signal converter molecules are still required to modify and activate the immune effector cells at present. It has been reported that the proportion of CXCR1 and CXCR2 positive cells in the TIL cell population with tumor tropism in the melanoma-derived TIL is significantly higher compared to the TIL cell population without tumor tropism. The tumor trend of CXCR 1-expressing TIL was still 23% higher than that of control TIL after over-electrotransformation of CXCR1 mRNA in TIL (Sapoznik S, ortenberg R, galore-Haskel G, kozlovski S, levy D, avivi C, et al CXCR1 as a novel target for directing reactive T cells toward melanoma: implications for adoptive cell transfer immunotherapeutic.cancer Immunol Immunother (2012) 61 (10): 1833-47). However, these are all directed CXCR1/2 expression in immune effector cells, and no signaling receptor based on the conversion of the chemokine receptor CXCR1/2 mediated inhibitory signal into an activating signal is currently known.

Disclosure of Invention

The present invention provides an isolated fusion protein which is a signal transduction receptor comprising: a CXCR region which is a CXCR or a fragment or mutant thereof comprising an extracellular region and a transmembrane region, and an intracellular region comprising an intracellular domain of a costimulatory signaling molecule or a functional fragment or mutant thereof which retains the costimulatory signaling molecule to deliver a costimulatory signal, activating a biological function of an immune cell. In one or more embodiments, the CXCR region is located N-terminal of the intracellular region.

In one or more embodiments, the CXCR is CXCR1 or CXCR2. The amino acid sequence of CXCR1 is SEQ ID NO. 4.

In some embodiments, the CXCR region and the intracellular region further have a linker therebetween. Preferably, the amino acid sequence of the linker is shown as SEQ ID NO. 14, 16, 18 or 20. More preferably, the amino acid sequence of the linker is shown in SEQ ID NO. 14, 16 or 20.

In one or more embodiments, the costimulatory signaling molecules include one or more of CD28, CD134 (OX 40), CD137 (4-1 BB), LCK, ICOS, DAP10, siglec-9, siglec-10, siglec-15, TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, IL-2R, IL-4R, IL-7R, IL-10R, IL-12R, IL-15R, IL-21R, CD27, and CD 40. In one or more embodiments, the costimulatory signaling molecules comprise CD28 and/or IL-7Ralpha.

In one or more embodiments, the fusion protein comprises CXCR1 or CXCR2 or a mutant thereof, and an intracellular region comprising one or more co-stimulatory signaling molecule intracellular domains selected from the group consisting of: CD28 intracellular region, IL-7Ralpha intracellular region, CD134 intracellular region, CD137 intracellular region, IL-2Rbeta intracellular region, IL-4Rbeta intracellular region, IL-7Ralpha intracellular region, IL-10Ralpha intracellular region, IL-12Rbeta intracellular region, IL-15Ralpha intracellular region, IL-21Ralpha intracellular region, CD27 intracellular region, CD40 intracellular region.

In one or more embodiments, the amino acid sequence of the CD28 intracellular region is shown in SEQ ID NO. 6.

In one or more embodiments, the amino acid sequence of the IL-7Ralpha intracellular domain is shown in SEQ ID NO. 8.

In one or more embodiments, the fusion protein further comprises a membrane surface tag. Preferably, the membrane surface tag is located at the N-terminus of the CXCR region.

In some embodiments, the CXCR region is further provided with a linker between the CXCR region and the membrane surface tag. In one or more embodiments, the membrane surface tag comprises a membrane surface functional domain that is a BCMA extracellular domain or variant thereof, or a claudin protein extracellular domain or fragment or variant thereof.

In one or more embodiments, the amino acid sequence of the BCMA extracellular domain is shown in SEQ ID No. 10; the nucleic acid sequence comprises the sequence shown in SEQ ID NO. 9.

In one or more embodiments, the claudin protein is claudin18, preferably claudin18.2. In one or more embodiments, the fragment of the extracellular domain of claudin protein is an extracellular epitope of claudin protein. In one or more embodiments, a fragment of the extracellular domain of claudin18.2 protein comprises the sequence shown in SEQ ID NO. 12; the nucleic acid sequence comprises the sequence shown in SEQ ID NO. 11.

In one or more embodiments, the membrane surface tag further comprises a linker or hinge region located at the N-terminus or C-terminus of the membrane surface functional domain. Preferably, the linker is as shown in SEQ ID NO 14, 16, 18 or 20. More preferably, the linker is as shown in SEQ ID NO. 14 or 18.

In one or more embodiments, the fusion protein is a protein encoded by any one of SEQ ID NOs 21-26.

The invention also provides a polynucleotide molecule selected from the group consisting of: a polynucleotide molecule or complementary sequence encoding a fusion protein according to any one of the embodiments of the invention.

In one or more embodiments, the fusion protein has a CXCR1 coding sequence as set forth in SEQ ID NO. 3.

In one or more embodiments, the intracellular domain of the costimulatory signaling molecule in the fusion protein is the CD28 intracellular region, the coding sequence of which is shown in SEQ ID NO. 5.

In one or more embodiments, the intracellular domain of the costimulatory signaling molecule in the fusion protein is the IL-7Ralpha intracellular region, the coding sequence of which is shown in SEQ ID NO. 7.

In one or more embodiments, the fusion protein comprises a membrane surface tag comprising a fragment encoding the extracellular domain of BCMA as set forth in SEQ ID No. 9 or encoding the extracellular domain of claudin18.2 protein as set forth in SEQ ID No. 11.

In one or more embodiments, the polynucleotide molecule is selected from any one of SEQ ID NOs 21-26, or is the complement of any one of the polynucleotide molecules shown.

The invention also provides a nucleic acid construct comprising a polynucleotide molecule according to any one of the embodiments of the invention.

In one or more embodiments, the nucleic acid construct is a vector.

In one or more embodiments, the vector is an expression vector or an integration vector; preferably a viral vector or a non-viral vector, more preferably a non-viral vector.

The invention also provides a genetically engineered cell expressing the fusion protein of any of the embodiments of the invention, and/or carrying the coding sequence of the fusion protein.

In one or more embodiments, the cell is an immune cell.

In one or more embodiments, the immune cells include T cells, NK cells, CAR-T, CAR-NK, TCR-T, CIK, NKT, and TIL.

In one or more embodiments, the cell also expresses a CAR, or carries a coding sequence for a CAR.

In one or more embodiments, the cell also expresses an exogenous TCR, or a coding sequence carrying an exogenous TCR.

The invention also provides a pharmaceutical composition comprising a pharmaceutically acceptable adjuvant or the fusion protein, polynucleotide molecule, nucleic acid construct and genetically engineered cell according to any embodiment of the invention. The pharmaceutical composition is used for treating or preventing cancer.

In one or more embodiments, the cancer is melanoma or prostate cancer.

The invention also provides the use of the fusion protein, the polynucleotide molecule, the nucleic acid construct and the genetically engineered cell according to any embodiment of the invention in preparing medicaments for treating or preventing cancers.

The invention has the advantages that:

the signal conversion receptor based on CXCR1/2 can effectively convert an IL-8 mediated immunosuppression signal into an activation signal, so that the tumor trend of immune effector cells expressing the signal conversion receptor is improved, and the tumor can be effectively killed.

Drawings

Fig. 1: RTCA kill curves of TIL-CXCR1-SCR4, TIL-CXCR1-SCR6 and TIL-CTRL against homologous melanoma primary tumor cells.

Fig. 2: PDX tumor inhibition curves of TIL-CXCR1-SCR6 and TIL-CTRL against syngeneic melanoma mice.

Detailed Description

It is understood that within the scope of the present invention, the above-described technical features of the present invention and technical features specifically described below (e.g., in the examples) may be combined with each other to constitute a preferred technical solution.

The CXCR1/2 is a seven-time transmembrane protein receptor, the intracellular co-stimulatory domain is further added on the structure of the CXCR1/2, the ligand of the CXCR1/2 with an immunosuppressive effect and the cytokine IL-8 mediated signal are converted into an activation signal, and the activation and proliferation level of immune effector cells are further improved under the condition of increasing the tumor chemotaxis of immune cells.

In the present invention, immune cells have the meaning well known in the art and refer to cells involved in or associated with an immune response, including lymphocytes, dendritic cells, monocytes/macrophages, granulocytes, mast cells, and the like. Lymphocytes include T lymphocytes, tumor-infiltrating lymphocytes, B lymphocytes, NK lymphocytes, and NKT cells. Immune cells suitable for use in the present invention include, inter alia, those typically used in adoptive cell therapy of tumors.

The immune cells of the invention express the signal transduction receptor of the invention and/or contain the coding sequence of the signal transduction receptor. The signal transduction receptors of the present invention are designed to bind inhibitory molecules but transmit a positive signal rather than an inhibitory signal. That is, these cells convert the "brake" signal to an "acceleration" signal to improve the anti-tumor effect of each immune cell.

Definition of the definition

The present invention uses the following terminology. For terms not specifically defined herein, they have meanings well known in the art.

The term "expression cassette" refers to the complete elements required for expression of a gene, including promoters, gene coding sequences, and PolyA tailing signal sequences.

The term "coding sequence" is defined herein as that portion of a nucleic acid sequence that directly determines the amino acid sequence of its protein product (e.g., signal transduction receptor, CAR). The boundaries of the coding sequence are typically determined by a ribosome binding site (for prokaryotic cells) immediately upstream of the open reading frame at the 5 'end of the mRNA and a transcription termination sequence immediately downstream of the open reading frame at the 3' end of the mRNA. Coding sequences may include, but are not limited to, DNA, cDNA, and recombinant nucleic acid sequences.

The term "costimulatory signaling molecule" refers to a molecule that is present on the surface of an antigen-presenting cell and that is capable of binding to a costimulatory signaling molecule receptor on a Th cell to produce a costimulatory signal. It can activate the second signal of immune cell, strengthen the proliferation capacity of immune cell and the secretion function of cell factor, and prolong the survival time of activated immune cell. Proliferation of lymphocytes requires not only antigen binding but also signal of the co-stimulatory molecule. The co-stimulatory signal is transmitted to the T cell primarily through the co-stimulatory molecule CD80, CD86 expressed on the surface of the antigen presenting cell binding to the CD28 molecule on the surface of the T cell. B cells receive costimulatory signals through common pathogen components such as LPS, or through complement components, or through activated antigen-specific CD40L on Th cell surfaces.

The term "linker" or hinge is a polypeptide fragment that connects between different proteins or polypeptides in order to maintain the connected proteins or polypeptides in their respective spatial conformations in order to maintain the function or activity of the protein or polypeptide. Exemplary linkers include linkers comprising G and/or S, and for example Furin 2A peptides.

The term "pharmaceutically acceptable excipients" refers to carriers and/or excipients that are pharmacologically and/or physiologically compatible with the subject and active ingredient, which are well known in the art (see, e.g., remington's pharmaceutical sciences, improved by Gennaro AR,19th ed.Pennsylvania:Mack Publishing Company,1995), and include, but are not limited to: pH adjusters, surfactants, adjuvants, ionic strength enhancers. For example, pH modifiers include, but are not limited to, phosphate buffers; surfactants include, but are not limited to, cationic, anionic or nonionic surfactants, such as Tween-80; ionic strength enhancers include, but are not limited to, sodium chloride.

The term "effective amount" refers to the amount that achieves treatment, prevention, alleviation and/or relief of a disease or condition of the present invention in a subject.

The term "disease and/or disorder" refers to a physical state of the subject that is associated with the disease and/or disorder of the present invention.

The term "subject" may refer to a patient or other animal, particularly a mammal, such as a human, dog, monkey, cow, horse, etc., receiving a pharmaceutical composition of the invention to treat, prevent, ameliorate and/or alleviate a disease or disorder described herein.

The term "extracellular region" refers to the region of a membrane protein that is located outside of a cell.

The term "domain" refers to a region of a protein having a specific structure and independent function, the number of amino acid residues of a common domain being between 100 and 400, the smallest domain being only 40 to 50 amino acid residues, and the large domain being more than 400 amino acid residues.

Signal transduction receptor

The signal transduction receptor of the present invention is a fusion protein, which is a signal transduction receptor, comprising a CXCR region fused to an intracellular domain (also referred to as "intracellular region") of an immunostimulatory molecule (also referred to as "costimulatory signaling molecule"). The CXCR region may be CXCR (CXC chemokine receptor) itself or a fragment thereof, so long as the fragment comprises the extracellular and transmembrane regions of CXCR. More specifically, the signal transduction receptor of the present invention comprises at least two parts: CXCR or fragments or mutants thereof containing an extracellular region and a transmembrane region, and an intracellular domain which is a costimulatory signal molecule for the intracellular region.

In the fusion proteins herein, the extracellular region of CXCR is used to interact with IL-8, through the transmembrane region of which signals are transmitted to the intracellular region of the signal transduction receptor, thereby effecting downstream signal recognition. One or more CXCR or fragments thereof containing an extracellular region and a transmembrane region, or mutants retaining extracellular biological function of CXCR, can be used to construct the signaling receptor of the invention. Exemplary CXCR is CXCR1 or CXCR2. Preferably, CXCR1 has the amino acid sequence of SEQ ID NO. 4 and the coding sequence of SEQ ID NO. 3.

Co-stimulatory signaling molecules in the present invention include CD28, CD134 (OX 40), CD137 (4-1 BB), LCK, ICOS, DAP, siglec-9, siglec-10, siglec-15, TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, IL-2R, IL-4R, IL-7R, IL-10R, IL-12R, IL-15R, IL-21R, CD27, and CD40. One or more of these intracellular domains (intracellular regions) or functional fragments thereof of costimulatory signaling molecules or mutants that retain the costimulatory signaling molecules to deliver costimulatory signaling, activate the biological function of immune cells can be used to construct the signaling receptors of the invention. An exemplary IL-7R may be IL-7Ralpha, the exemplary amino acid sequence of which and the corresponding coding sequence of which are shown in SEQ ID NOs 8 and 7, respectively. The amino acid sequence of the intracellular region of exemplary CD28 and the corresponding coding sequence can be shown in SEQ ID NOS.6 and 5, respectively. The intracellular domain of the costimulatory signaling molecule may also be that described in WO2021244486, which is incorporated herein by reference in its entirety.

In the present invention, the CXCR of a signaling receptor is linked to an intracellular region (e.g., the intracellular domain of a costimulatory signaling molecule or other CXCR intracellular region) by a linker or hinge region. Exemplary linkers include the sequences shown in SEQ ID NO. 14 (linker 1), 16 (linker 2), 18 (linker 3) or 20 (linker 2), the nucleic acid sequences of which are shown in SEQ ID NO. 13, 15, 17 or 18, respectively. The hinge region includes one or more selected from the group consisting of: an extracellular hinge region of CD8, an IgG1 Fc CH2CH3 hinge region, an IgD hinge region, a CD28 extracellular hinge region, an IgG4 Fc CH2CH3 hinge region, and an extracellular hinge region of CD 4.

It is understood that "functional fragment" as used herein refers to a fragment that retains the desired biological function. For example, a functional fragment of an intracellular domain as described herein refers to a fragment that retains the biological function of the costimulatory signaling molecule to deliver a costimulatory signal, activating an immune cell. Functional fragments of each extracellular domain suitable for use in the present invention can be readily determined by one of skill in the art in combination with prior art means in the art.

The signal transduction receptor of the present invention may also have a membrane surface tag extracellular. Thus, in some embodiments, the signal transduction receptor described herein further comprises a membrane surface tag at the N-terminus of the CXCR. The membrane surface tag may function as an immune braking element, recognition element, linker, element that induces ADCC, ADCP and/or CDC effects. The membrane surface tag comprises a membrane surface functional domain.

The membrane surface functional domain may be a BCMA extracellular domain or a fragment thereof. Preferably, the BCMA ectodomain comprises the sequence shown in SEQ ID No. 10; the nucleic acid sequence comprises the sequence shown in SEQ ID NO. 9.

The membrane surface functional domain may also be the extracellular domain of claudin protein or a fragment thereof. The claudin protein is preferably claudin18, e.g. claudin18.2. Fragments of the extracellular domain are primarily referred to as extracellular epitopes of the corresponding protein. Thus, a fragment of the extracellular domain of claudin protein is an extracellular epitope of claudin protein. Preferably, the fragment of the extracellular domain of claudin18.2 protein (i.e. the extracellular epitope of claudin18.2 protein) comprises the sequence shown in SEQ ID NO. 12; the nucleic acid sequence comprises the sequence shown in SEQ ID NO. 11.

The membrane surface tag may also have a linker fragment at the N-terminus or C-terminus of the membrane surface functional domain for linking to other polypeptides or polypeptide portions. The connecting segments are typically hinge regions or linkers. Exemplary linkers include the sequences shown as SEQ ID NOs 14, 16, 18 or 20, with the nucleic acid sequences shown as SEQ ID NOs 13, 15, 17 or 19, respectively. The hinge region includes one or more selected from the group consisting of: an extracellular hinge region of CD8, an IgG1 Fc CH2CH3 hinge region, an IgD hinge region, a CD28 extracellular hinge region, an IgG4 Fc CH2CH3 hinge region, and an extracellular hinge region of CD 4.

In some embodiments, the BCMA extracellular domain is directly linked to the N-terminus of CXCR1 or CXCR2 or a fragment thereof. In some embodiments, the BCMA extracellular domain is linked to the N-terminus of CXCR1 shown in SEQ ID NO. 4 by a linker as shown in SEQ ID NO. 14.

In some embodiments, the claudin18.2 protein extracellular epitope is directly linked to the N-terminus of CXCR1 or CXCR2 or a fragment thereof. In some embodiments, the extracellular epitope of claudin18.2 protein is linked to the N-terminus of CXCR1 shown in SEQ ID NO. 4 by a linker as shown in SEQ ID NO. 14 or 18.

The term "mutant" as used herein includes mutants of each domain, provided that the mutant retains the respective biological functions of the CXCR, membrane surface tag, and intracellular domain. For example, mutants of antibodies suitable for use in the present invention include mutants having at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% sequence identity to the antibody used as a control; mutants suitable for use in the transmembrane region of the invention include mutants having at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% sequence identity to the transmembrane region as a comparison; mutants of the intracellular domains suitable for use in the present invention include mutants having at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% sequence identity to the intracellular domain to be compared. Alternatively, the mutants of the present invention have one or more (e.g., 20 or less, 15 or less, 10 or less, 8 or less, 5 or less, or 3 or less, e.g., 1-20, 1-10, etc.) amino acid residues inserted, substituted or deleted as compared to the sequences used as a comparison. For example, conservative substitutions with amino acids that are similar or analogous in nature typically do not alter the function of the protein or polypeptide. "similar or analogous amino acids" include, for example, families of amino acid residues with similar side chains, including amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).

The invention also includes mutants of the signal transduction receptor described above, such as mutants having at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% sequence identity to the signal transduction receptor. More specifically, the present invention includes mutants having one or more (e.g., 20 or less, 15 or less, 10 or less, 8 or less, 5 or less, or 3 or less, e.g., 1-20, 1-10, etc.) amino acid residues inserted, substituted or deleted as compared to the signal transduction receptor described above. Such mutants retain the biological functions of the signal transduction receptor of the present invention, including but not limited to the function of converting a signal recognizing IL-8 into a stimulatory signal that enhances immune cell proliferation. Mutations can occur in any, any two, or all three of the extracellular domains, transmembrane regions, and intracellular domains described herein.

The polypeptides described herein may be modified polypeptides. Modified (typically without altering the primary structure) forms include: chemically derivatized forms of polypeptides such as acetylation or carboxylation, in vivo or in vitro. Modifications also include glycosylation, such as those resulting from glycosylation modifications during synthesis and processing of the polypeptide or during further processing steps. Such modification may be accomplished by exposing the polypeptide to an enzyme that performs glycosylation (e.g., mammalian glycosylase or deglycosylase). Modified forms also include sequences having phosphorylated amino acid residues (e.g., phosphotyrosine, phosphoserine, phosphothreonine). Also included are polypeptides modified to improve their proteolytic resistance or to optimize solubility.

Exemplary signaling receptors of the invention include, but are not limited to, signaling receptors comprising or consisting of the membrane surface tag, CXCR region and intracellular domain shown in each row of table 1 below:

TABLE 1 Signal transduction receptors (N-terminal to C-terminal)

Film surface label	CXCR region	Intracellular domains
			Without any means for	CXCR1	CD28 intracellular domain
Without any means for	CXCR1	IL-7Ralpha intracellular domain
			Claudin18.2 epitope	CXCR1	CD28 intracellular domain
BCMA extracellular domain	CXCR1	IL-7Ralpha intracellular domain
			BCMA extracellular domain	CXCR1	CD28 intracellular domain
Without any means for	CXCR2	CD28 intracellular domain
			Without any means for	CXCR2	IL-7Ralpha intracellular domain
Claudin18.2 epitope	CXCR2	CD28 intracellular domain
			BCMA extracellular domain	CXCR2	IL-7Ralpha intracellular domain
BCMA extracellular domain	CXCR2	CD28 intracellular domain

Still further, exemplary signal transduction receptors of the invention include, but are not limited to, those comprising or consisting of the membrane surface tag, linker A, CXCR region, linker B and intracellular domain shown in each row of table 2 below:

TABLE 2 Signal transduction receptors (N-terminal to C-terminal)

In some embodiments, the signal transduction receptor comprises, in order from the N-terminus to the C-terminus: the BCMA extracellular domain shown in SEQ ID NO. 10 or Claudin18.2 epitope shown in SEQ ID NO. 12, and the linker shown in SEQ ID NO. 14, 16, 18 or 20, and the CXCR region shown in SEQ ID NO. 4, and the linker shown in SEQ ID NO. 14, 16, 18 or 20, and the CD28 intracellular domain shown in SEQ ID NO. 6 or the IL-7Ralpha intracellular domain shown in SEQ ID NO. 8.

In some embodiments, the signal transduction receptors described herein further comprise a signal peptide. Preferably, the signal peptide is located at the N-terminus of the signal transduction receptor. The signal peptide may be any signal peptide capable of directing the polypeptide out of the core as is conventional in the art, including but not limited to CD8, CD4, CD28, CD137, EGFR, TGFBRI, TGFBRII, TGFBRIII and light chain signal peptides. In some embodiments, the signal peptide comprises the amino acid sequence set forth in SEQ ID NO. 2, the coding sequence of which is set forth in SEQ ID NO. 1.

It will be appreciated that the extracellular domains and transmembrane regions, and/or the transmembrane regions and intracellular domains described herein may be linked by a linker sequence, as desired. Linker sequences known in the art, such as those containing G and S, such as (GSSS) n or (GSSSs) n, where n is an integer from 1 to 8, may be used.

Preferably, the coding sequence of the signal transduction receptor of the present invention is shown in SEQ ID NOS.21-26.

CAR-T

The immune cells of the invention may further express a CAR, or contain a coding sequence for a CAR. The CARs of the present invention may be a variety of CARs well known in the art.

The CAR may in turn comprise a polypeptide that binds to a tumor cell membrane antigen (e.g., scFv), a hinge region, a transmembrane region, and an intracellular signaling region. The CARs of the invention can be constructed using hinge, transmembrane and intracellular signal regions well known in the art for constructing CARs. In general, polypeptides that bind tumor cell membrane antigens are capable of binding with moderate affinity to membrane antigens that are widely expressed by tumor cells, and are typically inserted with an epitope at a position selected from any 1, 2 or 3 of the following 3 positions: the N-terminus of the polypeptide, between the polypeptide and the hinge region, and within the polypeptide. The polypeptide combined with the tumor cell membrane antigen is a natural polypeptide or an artificial synthetic polypeptide; preferably, the synthetic polypeptide is a single chain antibody or Fab fragment.

The chimeric antigen receptor of the invention may be directed against one or more of the following antigens: CD19, CD20, CEA, GD2 (also known as B4GALNT 1), FR (also known as Flavin reductase), PSMA (also known as prostate specific membrane antigen), PMEL pre-melanosome protein), CA9 (carbonic anhydrase IX), CD171/L1-CAM, IL-13RL1, MART-1 (also known as mucin-A), ERBB2, NY-ESO-1 (also known as CTAG1B, cancer/testis antigen 1B), MAGE (melanoma associated antigen E1) family proteins, BAGE (B melanoma antigen family) family proteins, GAGE (growth hormone releasing factor) family proteins, AFP, MUC1 (also known as mycin 1), CD22, CD23, CD30, CD33, CD44v7/8, CD70, VEGFR1, VEGFR2, IL-11R/, EGP-2, EGP-40, FBP, GD3 (also known as SIA 1), PSCA (prostate stem cell antigen), KLA (PSA 9), GAGE (also known as GRGE protein) family proteins, GAGE (growth hormone releasing factor) family proteins, AFP, MUC1 (also known as MUC 1), CD22, CD23, CD30, CD33, CD44v7/8, CD70, VEGFR1, VEGFR2, IL-11R/, EGP-2, EGP-40, GD3 (also known as FBST 8SIA 1), PSCA (prostate stem cell antigen), PSCA (PSA 9), PSA 3, GAGE 3, GRBB 3 (Grave 3, GRCA 3, and GLP 3 (Grave 3) type 3, GRCA 1).

A single cell may express multiple CARs, including CARs targeting different tumor antigens.

T Cell Receptor (TCR) -T

The immune cells of the invention may further express an exogenous TCR or contain a coding sequence that expresses an exogenous TCR gene. The TCRs of the present invention may be any known in the art, for example, HLA-matched TCRs, known in sequence and structure, and known in combination with antigen peptide sequences.

The exogenous TCRs described herein include αβ double chains that can form complete TCR complexes with double-stranded structures of γε, δε, and ζζ expressed endogenously by immune effector cells such as T cells. The exogenous gene encoding the exogenous TCR of the invention includes an alpha beta double-stranded gene, and the alpha chain and beta chain coding sequences are covalently linked by a linker sequence that can be cleaved in vivo, such as the coding DNA sequence of P2A, T A or F2A sequences, or by a DNA fragment encoding an IRES sequence. In addition to the αβ duplex encoding the exogenous TCR, the gene encoding the exogenous TCR of the present invention may comprise a tag protein gene, such as EGFP, RFP, YFP gene, or the like, expressed in fusion with the αβ gene. The tag protein gene may be covalently linked to the αβ double stranded gene by a linker sequence that can be cleaved in vivo, such as a 2A sequence, e.g., a DNA sequence encoding P2A, T2A or F2A, or by a DNA sequence encoding an IRES sequence. The tag protein, such as EGFP, RFP, YFP gene, which is expressed together with TCR alpha beta double chain, can be used as identification index for detecting exogenous TCR expression.

The TCR-T of the invention may be directed against one or more of the following antigens: CD19, CD20, CEA, GD2 (also known as B4GALNT 1), FR (also known as Flavin reductase), PSMA (also known as prostate specific membrane antigen), PMEL pre-melanosome protein), CA9 (carbonic anhydrase IX), CD171/L1-CAM, IL-13RL1, MART-1 (also known as mucin-A), ERBB2, NY-ESO-1 (also known as CTAG1B, cancer/testis antigen 1B), MAGE (melanoma associated antigen E1) family proteins, BAGE (B melanoma antigen family) family proteins, GAGE (growth hormone releasing factor) family proteins, AFP, MUC1 (also known as mycin 1), CD22, CD23, CD30, CD33, CD44v7/8, CD70, VEGFR1, VEGFR2, IL-11R/, EGP-2, EGP-40, FBP, GD3 (also known as GD 8SIA 1), PSCA (prostate stem cell antigen), KLA (FSK 9), GAGE (also known as GAGE) family proteins, GAGE (growth hormone releasing factor) family proteins, AFP, MUC1 (also known as MUC 1), CD22, CD23, CD30, CD44v7/8, CD70, VEGFR1, VEGFR2, IL-11R/, EGFR2, EGP-40, FBP, GD3 (also known as GL 8SIA 1), PSCA (precursor 1), KLA (F3), GRCA 3 (Grave 3), GRCA 3, GRCA 1) and GRCA 1 (Grave 3, GRCA 1).

A single cell may express multiple exogenous TCRs, including exogenous TCRs targeting different tumor antigens.

Tumor Infiltrating Lymphocytes (TIL)

The immune effector cell of the present application may be TIL. The TIL of the present application may be a TIL against any solid tumor, including but not limited to breast, prostate, lung and colon cancer or epithelial cancer, such as breast cancer, colon cancer, prostate cancer, head and neck cancer, skin cancer, melanoma; genitourinary tract cancers, such as ovarian cancer, endometrial cancer, cervical cancer, endometrial stromal sarcoma, pelvic poorly differentiated adenocarcinoma, kidney cancer, bladder cancer, prostate cancer; lung cancer, gastric cancer, gastrointestinal stromal tumor, small intestine cancer, liver cancer, pancreatic cancer, gallbladder cancer, bile duct cancer, esophageal cancer, salivary gland cancer, thyroid cancer, osteosarcoma.

The TIL of the present application may be one obtained by any conventional culture method in the art. Preferably, TIL obtained by the culture method described in WO2022111571A1 is used. WO2022111571A1 is incorporated by reference in its entirety.

Polynucleotide molecules

The present application provides polynucleotide molecules encoding the signal transduction receptors described herein. The application also provides the complementary sequence of the coding sequence of the signal transduction receptor. The polynucleotide molecule may be a recombinant nucleic acid molecule or may be synthetic; it may comprise DNA, RNA and PNA (peptide nucleic acid) and may be a hybrid thereof.

Also provided is an expression cassette for a signal transduction receptor of the present invention, which is a nucleic acid construct comprising a promoter, a signal transduction receptor coding sequence, and a PolyA tailing signal sequence. Other elements required for expression may also be included in the nucleic acid construct, including but not limited to enhancers and the like.

Also provided is a vector comprising a polynucleotide molecule, expression cassette or nucleic acid construct described herein. Vectors may be plasmids, cosmids, viruses, and phages. The vector may be a cloning vector or an expression vector. The expression vector may be a transposon vector. In certain embodiments, the expression vector is one or more selected from the group consisting of: piggybac, sleep reliability, frog priority, tn5 and Ty. In addition to the polynucleotide molecules of the invention, the expression vectors will typically contain other elements typically contained in vectors, such as multiple cloning sites, resistance genes, replication initiation sites, and the like. In certain embodiments, the recombinant expression vector employs pUC18, pUC19, pMD18-T, pMD19-T, pGM-T, pUC57, pMAX or pDC315 series vectors as the backbone. In other embodiments, the recombinant expression vector employs a pCDNA3 series vector, a pCDNA4 series vector, a pCDNA5 series vector, a pCDNA6 series vector, a pRL series vector, a pUC57 vector, a pMAX vector, or a pDC315 series vector as a backbone. In certain embodiments, the invention uses the pNB vector constructed by CN105154473 a. In certain embodiments, the invention uses the pKB20 vector described in WO2022078310 A1.

The CARs of the invention may also be expressed in the immune cells of the invention by conventional vectors. The vector may be a conventional CAR-expressing vector, including but not limited to the various transposon vectors and recombinant expression vectors described previously.

In some embodiments, the same vector encodes both the signaling receptor and CAR of the invention. The vector may be a bicistronic. The coding sequence of the CAR may be disposed 5 'or 3' to the signal transduction receptor coding sequence. Expression of the CAR and signaling receptor may be under the direction of the same or different regulatory sequences.

Where the polynucleotide sequence is known, each polynucleotide molecule may be prepared by methods conventional in the art and the corresponding vector constructed. Recombinant vectors can be constructed using methods well known to those skilled in the art, see, for example, sambrook et al (2001,Molecular Cloning:A Laboratory Manual,Cold Spring Harbor Laboratory), ausubel et al (1989,Short Protocols in Molecular Biology,Wiley), or other techniques described in standard textbooks. Alternatively, the nucleic acid molecules and vectors can be reconstituted into liposomes for delivery to target cells. Vectors containing the nucleic acid molecules of the invention may be transferred into host cells by well known methods, which vary depending on the type of cellular host. For example, calcium chloride transfection is commonly used for prokaryotic cells, whereas calcium phosphate treatment or electrotransfection may be used for other cellular hosts, see Sambrook et al (supra).

Host cells

Herein, when expressing a heterologous nucleic acid sequence, "host cell" refers to a eukaryotic cell that is capable of replicating the vector and/or expressing the heterologous gene encoded by the vector. Host cells can be used as acceptors for vectors. The host cell may be "transfected" or "transformed," which refers to the process by which exogenous nucleic acid is transfected or transduced into the host cell. Transformed cells include primary subject cells and their progeny. The terms "engineered" and "recombinant" cells or host cells as used herein often refer to cells into which exogenous nucleic acid sequences, such as vectors, have been introduced. Thus, recombinant cells can be distinguished from naturally occurring cells that do not contain the introduced recombinant nucleic acid.

Herein, host cells include cells carrying the polynucleotide molecules and/or polypeptides described herein. In particular, the invention provides cells carrying the signal transduction receptor and/or the coding sequence thereof of the invention. The cells of the invention are preferably immune cells and can be used for adoptive cell therapy of tumors. Such cells of the invention are also referred to as cells modified by the signal transduction receptor of the invention.

More specifically, the cells of the invention are preferably immune effector cells, including T cells, such as cytotoxic T cells (also known as TC, cytotoxic T lymphocytes, CTLs, T killer cells, cytolytic T cells, cd8+ T cells, or killer T cells), NK cells, NKT cells, CAR-T, CAR-NK, TCR-T, CIK, TIL; and other immune cells that can elicit effector functions.

Herein, cells may be autologous cells, syngeneic cells, allogeneic cells, and even in some cases xenograft cells, relative to the individual receiving them.

The nucleic acid construct/recombinant expression vector of the invention may be transferred into a cell of interest. Methods of transfer are conventional in the art and include, but are not limited to: viral transduction, microinjection, particle bombardment, gene gun transformation, electrotransformation, and the like. In certain embodiments, the nucleic acid construct or recombinant expression vector is electrotransferred.

In addition to carrying the signal transduction receptor and/or coding sequences thereof of the present invention, the cells of the present invention may have one or more additional properties useful in cellular immunotherapy (e.g., adoptive cell therapy for tumors). Such other properties may be inherent to the cell or may be part of the cell after genetic manipulation by a human. For example, the cells of the invention may carry chimeric antigen receptors, αβ T cell receptors, and/or antigen-specific receptors, such as tumor-specific receptors, or coding sequences thereof.

Pharmaceutical composition

Herein, "pharmaceutical composition" refers to a composition for administration to an individual and encompasses a composition of cells for immunotherapy. The pharmaceutical compositions of the invention may also comprise a pharmaceutically acceptable carrier. Examples of suitable pharmaceutical carriers are known in the art and include phosphate buffered saline solutions, water, emulsions, such as oil/water emulsions, various types of wetting agents, sterile solutions, and the like. Compositions comprising such carriers can be formulated by well-known conventional methods. These pharmaceutical compositions may be administered to a subject in a suitable dosage.

The dosage regimen will be determined by the attending physician and clinical factors. As is well known in the medical arts, the dosage for any one patient depends on a variety of factors including the patient's size, body surface area, age, the particular compound to be administered, sex, time and route of administration, general health, and other drugs administered simultaneously.

The compositions of the present invention may be administered locally or systemically. In certain embodiments, the compositions provided herein (e.g., cells expressing the signaling receptors described herein) may be administered parenterally, e.g., intravenously, intraarterially, intrathecally, subcutaneously, or intramuscularly. In certain other embodiments, DNA encoding the constructs provided herein may be administered directly to a target site, for example, delivered to an internal or external target site by a gene gun or to an intra-arterial site by a catheter. In a preferred embodiment, the pharmaceutical composition is administered subcutaneously, and in a more preferred embodiment, intravenously. Parenteral formulations include sterile aqueous or nonaqueous solutions, suspensions and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous vehicles include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral carriers include sodium chloride solution, lin Geyou dextrose, dextrose and sodium chloride, ringer's lactate solution or fixed oils. Intravenous vehicles include liquid and nutritional supplements, electrolyte supplements (such as those based on Yu Linge dextrose), and the like. Preservatives and other additives may also be present, such as, for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like. Furthermore, the pharmaceutical composition of the invention may comprise a proteinaceous carrier, such as serum albumin or an immunoglobulin, preferably of human origin. In addition to the proteinaceous chimeric cytokine receptor construct or nucleic acid molecule or vector encoding the same, it is contemplated that the pharmaceutical composition of the invention may also comprise a biologically active agent, depending on the intended use of the pharmaceutical composition.

Compositions for parenteral (e.g., intravenous) administration of the cells described herein may also be stored in lyophilized form or in solution (e.g., lyophilized formulations). The lyophilized formulation may be stored in a ready-to-use form or in a form that is further formulated prior to administration. The cryopreservation formulation can withstand long distance transport without damaging the cells. In addition to the cells themselves, cryopreservation formulations typically include components such as cell cryopreservation solution, human Serum Albumin (HSA), and the like. Prior to administration (e.g., intravenous infusion), the cryopreserved pharmaceutical composition is stored (e.g., in liquid nitrogen). The frozen preparation can be directly infused into a patient or formulated as an infusion composition after thawing. The composition and concentration of conventional frozen stock solutions are known to those skilled in the art. For example, the frozen stock solution or infusion composition may further comprise dimethylsulfoxide, sodium chloride, glucose, sodium acetate, potassium chloride, magnesium chloride, or the like, the concentration of which may be determined by one of skill in the art (e.g., an experienced physician) depending on the condition of the cell, disease, patient, or the like.

Method and application

The signal conversion receptor, the polynucleotide molecule, the vector, the host cell and the pharmaceutical composition containing the same can be used for preventing, treating or relieving cancers, especially cancers with corresponding tumor antigens expressed on the surfaces of cancer cells, or used for preparing medicines for preventing, treating or relieving cancers.

As used herein, "treatment" or "treatment" includes any beneficial or desired effect on the symptoms or lesions of a disease or pathological condition, and may include even a small reduction in one or more measurable markers of the disease or condition under treatment (e.g., cancer). Treatment may optionally include a reduction or alleviation of symptoms of the disease or disorder, or a delay in the progression of the disease or disorder. "treating" does not necessarily mean complete eradication or cure of a disease or disorder or associated symptoms thereof.

"preventing" as used herein refers to a method for preventing, inhibiting, or reducing the likelihood of occurrence or recurrence of a disease or disorder (e.g., cancer). It also refers to delaying the onset or recurrence of a disease or disorder or delaying the onset or recurrence of symptoms of a disease or disorder. As used herein, "preventing" also includes reducing the intensity, impact, symptoms and/or burden of a disease or disorder before it occurs or recurs.

The invention includes the administration of cells, polynucleotide molecules and vectors, alone or in any combination, using standard vectors and/or gene delivery systems, optionally together with pharmaceutically acceptable carriers or excipients. In certain embodiments, the polynucleotide molecule or vector may be stably integrated into the genome of the subject following administration.

In particular embodiments, viral vectors that are specific for certain cells or tissues and persist in the cells may be used. Suitable pharmaceutical carriers and excipients are well known in the art. The compositions prepared according to the invention may be used to prevent or treat or delay the diseases identified above.

Furthermore, the present invention provides a method for preventing, treating or alleviating cancer, comprising the steps of: administering to a subject in need thereof an effective amount of a cell carrying a signaling receptor, polynucleotide molecule, and/or vector described herein and/or produced by a method described herein.

The methods herein can be used to prevent, treat, or ameliorate a variety of cancers, including various solid and hematological tumors, including but not limited to lung cancer (e.g., non-small cell lung cancer), colon cancer, cervical cancer, liver cancer, fibrosarcoma, erythroleukemia, prostate cancer, breast cancer, pancreatic cancer, ovarian cancer, melanoma, and glioma, among others. More specifically, cancers herein include, but are not limited to, breast, prostate, lung, and colon cancer or epithelial cancers, such as breast cancer, colon cancer, prostate cancer, head and neck cancer, skin cancer, melanoma; genitourinary tract cancers, such as ovarian cancer, endometrial cancer, cervical cancer, endometrial stromal sarcoma, pelvic poorly differentiated adenocarcinoma, kidney cancer, bladder cancer, prostate cancer; lung cancer, gastric cancer, gastrointestinal stromal tumor, small intestine cancer, liver cancer, pancreatic cancer, gallbladder cancer, bile duct cancer, esophageal cancer, salivary gland cancer, thyroid cancer, osteosarcoma, etc. Administration of the compositions of the invention may be useful for all stages and types of cancer, including for example, minimal residual disease, early stage cancer, advanced cancer, and/or metastatic cancer, and/or cancer that is refractory to treatment.

By way of example, a cancer patient or a patient susceptible to cancer or a patient suspected of having cancer is treated as follows. The modified cells as described herein may be administered to an individual and left for an extended period of time. The individual may receive one or more administrations of cells, and the interval between administrations may be days, weeks, months or years. In particular embodiments, multiple administrations may occur over weeks or months, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more weeks or months. In some embodiments, the genetically modified cells are encapsulated to inhibit immune recognition and are located at a tumor site. In the case where cells are provided to an individual after tumor recurrence following initial treatment with cells of the invention, the cells may be altered to recognize different target tumor antigens. For example, where an initial round includes cells carrying a signaling receptor of the invention and another receptor specific for a particular antigen, the receptor for a different particular antigen may be used after a subsequent round (including after tumor recurrence).

In some embodiments, an effective amount of therapeutic cells carrying or expressing the signaling receptor of any of the embodiments of the invention and optionally a CAR or exogenous transgenic TCR is provided to an individual in need thereof. These cells may be delivered simultaneously or non-simultaneously with one or more other cancer treatments. These cells and other cancer therapeutic agents may be delivered in the same or separate formulations. Cells and other cancer therapeutic agents may be provided to an individual by separate delivery routes. Cells and/or other cancer therapeutic agents may be delivered by injection or intravenous or oral administration, for example, at a tumor site. Conventional delivery routes for such compositions are known in the art.

The number of cells employed will depend on a variety of circumstances, such as the purpose of the introduction, the lifetime of the cells, the regimen to be used, the number of administrations, the ability of the cells to reproduce, the stability of the recombinant construct, etc.

Cells may be administered as desired. In some embodiments, a variety of schemes may be used to adjust the scheme parameters. In particular embodiments, the route or number or timing of administration, the lifetime of the cells, and/or the number of cells present may vary. The number of administrations may depend, for example, at least in part, on the factors described above.

Kit for detecting a substance in a sample

Any of the compositions described herein may be included in a kit. In one non-limiting example, cells expressing a signaling receptor according to any of the embodiments of the invention and/or agents producing one or more cells for use in cell therapy comprising a recombinant expression vector may be included in a kit for use in cell therapy. The kit components are provided in a suitable container format.

Some of the components of these kits may be packaged in an aqueous matrix or in lyophilized form. The container means of these kits typically comprise at least one vial, test tube, flask, bottle, syringe or other container means in which the component may be placed and preferably appropriately dispensed. In the case where more than one component is present in the kit, the kit will typically also contain a second, third or other container in which the other components may be separately placed. However, various combinations of components may be included in the vial. The kits of the invention will typically also comprise means for containing the components in a commercially available closed constraint format. Such containers may include injection molded or blow molded plastic containers, wherein the desired vials are retained.

When the components of the kit are provided in one and/or more liquid solutions, the liquid solutions are aqueous solutions, particularly preferably sterile aqueous solutions. In some cases, the container means may itself be a syringe, pipette, and/or other such device.

The components of the kit may also be provided in dry powder form. When the reagents and/or components are provided as dry powders, the powders may be reconstituted by the addition of a suitable solvent. Thus, the kit may further comprise a second container means comprising a sterile, pharmaceutically acceptable buffer and/or other diluent.

The components of the kit may also be provided in the form of a cryopreservation formulation (e.g., a cryopreservation solution). The frozen preparation can be directly infused into a patient or formulated as an infusion composition after thawing. Thus, the kit may also comprise a cell cryopreservation bag, a cell cryopreservation tube, a temperature holding means (e.g. a container comprising liquid nitrogen), a thawing means, etc.

In a specific embodiment of the invention, the cells to be used in the cell therapies described herein are provided in a kit. In some embodiments, the cell is essentially the only component of the kit. The kit may contain reagents and materials for preparing the desired cells. In particular embodiments, the reagents and materials comprise primers, nucleotides, suitable buffers or buffer reagents, salts, and the like for amplifying the desired sequence, and in some cases, the reagents comprise DNA and/or vectors encoding the signal transduction receptor and/or regulatory elements thereof described in any of the embodiments herein.

Embodiments of the present invention will be described in detail below with reference to examples. It will be appreciated by those skilled in the art that the following examples are illustrative of the present invention and should not be construed as limiting the scope of the invention. The specific techniques or conditions are not noted in the examples, and are carried out according to techniques or conditions described in the literature in the art (for example, refer to J. Sam Brookfield et al, guidelines for molecular cloning experiments, third edition, scientific Press, et al), corresponding references, or according to the specifications of the product. The reagents or apparatus used were conventional products commercially available without the manufacturer's attention.

Examples

Example 1: construction of Signal conversion receptor expression vectors

The pKB20 vector was constructed according to the method described in example 1 on page 21 of the specification of PCT application WO2022078310A 1. According to the method for constructing pKB20-EGFP described in this example, a pKB20 vector containing an expression cassette for an exogenous gene was constructed. Specifically, the sequence shown in SEQ ID NO. 21-26 was obtained by the entrusting company, the 2-terminal of the sequence shown in SEQ ID NO. 21-26 was ligated with a linker containing a corresponding cleavage site, and then cloned into the prepared pKB20 vector according to the method described in example 1 on page 21 of WO2022078310A1, designated pKB20-CXCR1-SCR1 to pKB20-CXCR1-SCR6, respectively, as shown in Table 3 below. The recombinant plasmids obtained above were transformed into E.coli (DH 5 c), and after sequencing was correct, plasmids were extracted and purified using the plasmid purification kit from Qiagen, to obtain high-quality plasmids for each recombinant expression vector.

TABLE 3CXCR1-SCR series signal transduction receptor structure

Example 2: isolated culture of melanoma tissue-derived TIL cells

Freshly excised melanoma specimens were collected and immediately treated under sterile conditions. The melanoma tissue of this example was treated and cultured to obtain TIL according to the medium described in example 1 of WO2022111571A1 and the tumor sample treatment method and TIL culture method described in example 2. WO2022111571A1 is incorporated by reference in its entirety.

The method comprises the following steps:

1) Preparing physiological saline containing 100U/mL penicillin, 100 mug/mL streptomycin and 50 mug/mL gentamicin for later use;

2) Placing the obtained tumor tissue sample of the freshly isolated tumor patient in a 10cm culture dish added with 30mL of the physiological saline prepared in the step 1) in a sterile environment in a secondary biosafety cabinet for washing, transferring the tumor tissue sample to a new 10cm dish added with 30mL of the physiological saline prepared in the step 1) for washing, and repeating the washing for 3 times;

3) Removing fat tissue and necrotic tissue with a sterile scalpel, cutting tumor tissue becomes a diameter of 3X 3mm ³ 2G-REX 100 culture tanks (available from Wilsonwolf), 42 randomly selected tumor tissue pieces were placed in each G-REX100 culture tank, seed cell culture medium was added to the culture tank, and the seed culture medium had the following composition: 3000IU/mL IL-2, 20ng/mL IL-7, 20ng/mL IL-15, 500U/mL GM-CSF, 1000IU/mL IFN-gamma, 3 μg/mL anti-CD 137mAb, 3 μg/mL anti-CD 28 mAb, 3 μg/mL anti-PD-1 mAb, 10ng/mL TNF-alpha, 5% v/v human AB serum, 1 XPS diabody, and a final volume of X-VIVO 15 basal medium; the redundant tumor tissue blocks are frozen and stored by a cryo-Stor 10 (purchased from BioLifeSolons) frozen solution through a program cooling instrument liquid nitrogen;

4) 3) adding 1L of the seed cell culture medium into a G-REX100 culture tank containing tumor tissue blocks, and adding 5% CO at 37 ℃ to the tumor tissue blocks ₂ Culturing at intervals of 4Removing half of the old seed cell culture medium in day, supplementing half of the fresh seed cell culture medium, and counting the total number and the activity rate of cells after centrifuging and harvesting TIL seed cells in day 12;

5) Taking the seed cells harvested in 4), re-suspending to 5.0X10 s with an expanding medium containing 500IU/mL IL-2, 7ng/mL IL-7, 30ng/mL IL-15, 5% v/v human AB serum, 1 XPS diabody and a final volume of X-VIVO 15 basal medium ⁵ Per mL, in a cell culture vessel pretreated with anti-CD 3 mAb, anti-CD 28 mAb and anti-CD 137 mAb coating, 37℃5% CO ₂ After 2 days of activation, the activated cells were collected by centrifugation and inoculated into a G-REX500M culture tank to which an expansion medium which had been preheated in advance was added, and the expansion medium in the G-REX500M culture tank was identical to the expansion medium described above. The volume of the expansion medium in each G-REX500M was 5L. Activated seed cells were grown according to 2.5X10 ⁵ /cm ² Inoculation density inoculation of (C) 37℃ 5% CO ₂ Culturing, removing half volume of old expansion medium after cell count every 4 days, and supplementing half volume of fresh expansion medium until total cell count in each G-REX500M tank reaches 1.0X10 ¹⁰ Afterwards, the flasks were separated at a ratio of 1:2, and each flask was supplemented with fresh expansion medium to 5L and then continued to culture. Cells were harvested after a total of 12 days of culture in an enlarged medium of a G-REX500M culture tank before and after culturing to obtain TIL.

Example 3: genetic modification and proliferation of TIL

1) The X-VIVO 15 medium was previously added to a 12-well plate for a total of 7 wells, 2mL per well, and then transferred to a cell incubator at 37℃with 5% CO ₂ Preheating for 1 hour;

2) The ratio of the electrotransport liquid with single dosage per hole is carried out according to the following table:

	100μL Nucleocuvette ^TM Strip(μL)
		Nucleofector ^TM volume of solution	82
Electrolysis supplementary solution	18

Preparing an experimental group electrotransformation system 6 group and a control group 1 group according to plasmids pKB20-CXCR1-SCR1 to pKB20-CXCR1-SCR6 and a control empty plasmid pKB20 to be tested;

3) The TIL obtained in example 2 was taken into 7 EP pipes, each of which was filled with 5X 10 ⁶ Centrifuging at 1200rpm for 5min, discarding supernatant, subsequently re-suspending cells with 500 μl physiological saline, and repeating the centrifugation step to wash cell pellet;

4) Respectively adding plasmids pKB20-CXCR1-SCR1 to pKB20-CXCR1-SCR6 and control empty plasmid pKB20 mug into the electrotransfer solution of each different experimental group and control group prepared in the step 2), and standing at room temperature for less than 30 min;

5) Resuspension of all tubes with plasmid-containing electrotransfer solution prepared in 4), 100. Mu.L of each tube, carefully pipetting the cell resuspension into a LONZA 100. Mu.L electrotransfer cup, placing the electrotransfer cup into LONZA Nucleofector ^TM 2b, starting an electric transfer program in the electric transfer groove, wherein the electric transfer program selects X001;

6) After completion of electrotransfer, carefully remove the electrotransfer cup, transfer the cell suspension to EP tube, add 200. Mu.L of pre-warmed X-VIVO 15 medium per tube, then transfer to 1) wells containing pre-warmed X-VIVO 15 medium in 12-well plates, 37℃C, 5% CO ₂ Culturing; after 5 days of culture, TIL cells overexpressing CXCR1-SCR1 to CXCR1-SCR6 and TIL cells of the control group, designated TIL-CXCR1-SCR1 to TIL-CXCR1-SCR6 and TIL-CTRL, respectively, were obtained.

Example 4: electrotransport CXCR1-SCR series signal transduction receptor TIL phenotype detection

1. Cell viability and positivity of the electrotransport CXCR1-SCR series signal transduction receptor TIL

Cell viability was measured for each group by trypan blue staining and cell counter counting. The results show that the cell viability of TIL-CXCR1-SCR 1-CXCR 1-SCR6 and TIL-CTRL prepared in example 3 is above 95%.

Fluorescence labeling is carried out by an indirect labeling method, the cell ratio of the CXCR1-SCR signal conversion receptor gene expression positive is detected by a flow cytometer, and the method comprises the following steps:

1) Collection of TIL-CXCR1-SCR1-TIL-CXCR1-SCR6 and TIL-CTRL groups of cells, 1X 10 cell counts per group ⁶ 800g, centrifuging for 3min;

2) Discarding the supernatant, adding physiological saline into each cell sample to re-suspend the cells, and centrifuging for 3min, wherein 800 g;

3) The supernatant was discarded, and 100. Mu.L of physiological saline was added to each cell sample to resuspend the cells, and 2. Mu.L of biotin-conjugated IL-8 factor (available from Biolegend; cargo number: 514704 Incubation for 30 minutes at room temperature; 800g, centrifuging for 3min, and washing twice;

4) The supernatant was discarded, 100. Mu.L of physiological saline was added to each tube of pellet, and the cells were resuspended, and 2. Mu.L of PE-Streptavidin (PE strepitavidins, available from BDbiosciences; cargo number: 554061 30 min, 800g, centrifuging for 3min, washing twice, and discarding the supernatant;

5) Resuspension with 400 μl of physiological saline, and detection by up-flow cytometry.

Meanwhile, for the TIL (TIL-CXCR 1-SCR4 and TIL-CXCR1-SCR 6) expressing the CXCR1-SCR signal conversion receptor containing the BCMA extracellular domain, the BCMA extracellular domain is used as a label, and the ratio of BCMA positive cells is detected by a flow cytometer by a direct labeling method, wherein the method comprises the following steps:

1) Collection of TIL-CXCR1-SCR4 and TIL-CXCR1-SCR6 cells, 1X 10 per cell population ⁶ 800g, centrifuging for 3min;

2) Discarding the supernatant, adding physiological saline to resuspend cells, and centrifuging for 3min at 800 g;

3) The supernatant was discarded and 100 μl of saline was added to resuspend cells, 2 μl of BCMA flow antibody per tube (ex bioleged cat: 357504 Incubation for 30 minutes at room temperature;

4) Adding proper amount of physiological saline, 800g, centrifuging for 3min, washing twice, and discarding supernatant;

The results show that the cell positive rates of each group are shown in table 4 below:

TABLE 4CXCR1-SCR signal transduction receptor expression positive cell fraction

As a result, as shown in Table 3, in the control cells TIL-CTRL, the ratio of BCMA positive cells was approximately 0, and the ratio of positive cells detected by the IL-8-biotin indirect labeling method was less than about 2%, indicating that in the prepared native TIL, there were substantially no cells positive for BCMA expression, and less than about 2% of the cells expressed a receptor such as CXCR1 capable of binding IL-8. In both TIL-CXCR1-SCR4 and TIL-CXCR1-SCR6, the proportion of positive obtained by the indirect labeling assay is higher than that obtained by the direct labeling assay, and the higher part may be that the wild type TIL itself expresses a receptor capable of binding IL-8 such as CXCR1 (which may be considered as a small false positive in the proportion of CXCR1 signaling receptor expressing positive cells).

2. Lymphocyte phenotype and cytokine secretion levels of the electrotransport CXCR1-SCR signaling receptor TIL

(1) Lymphocyte phenotype of the electrotransport CXCR1-SCR signal transduction receptor TIL

The associated lymphocyte phenotype of each set of cells is shown in Table 5

TABLE 5TIL-CXCR1-SCR1-TIL-CXCR1-SCR6 cell phenotype

Sample name	CD45+(％)	CD3+(％)	CD4+(％)	CD8+(％)
					TIL-CXCR1-SCR1	100	99.98	51.7	47.5
TIL-CXCR1-SCR2	100	99.62	42.1	55.3
					TIL-CXCR1-SCR3	99.95	98.97	49.2	48.9
TIL-CXCR1-SCR4	100	99.03	45.9	52.1
					TIL-CXCR1-SCR5	99.57	98.99	42.5	53.7
TIL-CXCR1-SCR6	100	99.15	42.8	51.9
					TIL-CTRL	99.83	99.53	52.3	46.8

(2) Secretion of the cytokine IFN-gamma for the electrotransport CXCR1-SCR signal transduction receptor TIL

a. Secretion levels of IFN-gamma without IL-8 incubation

Directly taking the cell supernatants of TIL-CXCR1-SCR 1-CXCR 1-SCR6 and TIL-CTRL prepared in example 3, and detecting the IFN-gamma concentration in the cell supernatants of each group according to the method described in the specification by using a CBA detection kit (Human IFN-gamma Flex Set, BDbiosciences, cat# 558269);

b. secretion levels of IFN-gamma after IL-8 incubation

Each well of a 12-well plate was charged with the mixture prepared in example 3 and containing 5X 10 ⁵ 1mL of cell suspension of individual/mL TIL-CXCR1-SCR1-TIL-CXCR1-SCR6 and TIL-CTRL; IL-8 factor (Biotechne, cat. No. 208-IL-050/CF) was prepared as a 5. Mu.g/mL stock solution with PBS and added to the above cell suspension to a final concentration of 100ng/mL,37℃and 5% CO ₂ The culture was incubated overnight in an incubator, centrifuged, and the supernatant of each sample was collected and assayed for IFN-. Gamma.concentration using a CBA assay kit (Human IFN-. Gamma.Flex Set, BDbiosciences, cat# 558269) according to the protocol described in the specification.

The results are shown in Table 6 below:

TABLE 6TIL-CXCR1-SCR1-TIL-CXCR1-SCR6 IFN-gamma secretion levels

The IFN-gamma secretion level of TIL-CXCR1-SCR 1-CXCR 1-SCR6 without IL-8 incubation was not significantly different from that of the control cells TIL-CTRL; after incubation, the IFN-gamma secretion level of TIL-CXCR1-SCR1-TIL-CXCR1-SCR6 is obviously improved compared with that of the non-incubated TIL-CTRL, and the IFN-gamma secretion level of TIL-CTRL is not obviously changed after IL-8 incubation compared with that of the non-incubated TIL-CXCR1-SCR 6.

The results show that the IL-8 factor can stimulate the activation level of the CXCR1-SCR signal conversion receptor-expressing TIL to be improved after the IL-8 factor is incubated for the TIL which is electrically transformed with the CXCR1-SCR signal conversion receptor.

Example 5: killing effect of TIL cells overexpressing CXCR1-SCR signaling receptor on homologous tumor cells

The fresh melanoma tissue of example 2 was cut into pieces of 3X 3mm size, and the pieces were mixed as homogeneously as possible and then mixed according to Robert Suriano et al.Ex Vivo Derived Primary Melanoma Cells: implications for Immunotherapeutic Vaccines J Cancer 2013;4 (5) Primary melanoma cells were obtained by culturing according to the method described in section 371-382.Materials and Methods. Taking 1.0X10 ⁵ Primary melanoma cells were placed in 12-well wells and incubated overnight with 2mL of medium (5% V/V human AB serum, AIM-V basal medium). The supernatant was taken after tumor primary cell adhesion and assayed for IL-8 concentration according to the instructions of IL-8ELISA kit (Invitrogen IL-8Human ELISA Kit Cat.No: KHC 0081). The results showed that the IL-8 concentration in the culture supernatant was 342.5ng/mL.

The in vitro killing activity of TIL-CXCR1-SCR1 to TIL-CXCR1-SCR6 and TIL-CTRL cells obtained in example 3 on their cognate melanoma primary cells was examined using a real-time label-free cell function analyzer (RTCA) from the company Aisen, and the specific steps were as follows:

(1) Zeroing: adding 50 mu L of DMEM culture solution into each hole, placing into an instrument, selecting the step 1, and zeroing;

(2) Target cell plating: black obtained by culturingPrimary cells of melanoma per well 10 ⁴ Spreading individual cells/50 mu L in a plate containing a detection electrode, standing for several minutes, putting the cells into an instrument after the cells are stable, and starting the step 2 to culture the cells;

(3) Adding effector cells: after the target cells are cultured for 18-24 h, observing cell indexes, when the cell indexes are 0.8-1, respectively adding effector cells TIL-CXCR1-SCR1-TIL-CXCR1-SCR6, wherein the effective target ratio is 2:1, starting step 3, and after the co-culture is performed for more than 90h, observing cell proliferation curves and killing levels, and calculating the target cell killing rate. The target cell killing rate was calculated as follows:

Where A is the cell index of the group to which no effector cells have been added and only target cells (i.e., tumor cells) are present, and B is the cell index of each group to which effector cells have been added.

The results are shown in FIG. 1 and Table 7. FIG. 1 is an exemplary RTCA kill curve of TIL-CXCR1-SCR4, TIL-CXCR1-SCR6 and TIL-CTRL against a target cell; table 7 shows target cell killing rates of TIL-CXCR1-SCR1-TIL-CXCR1-SCR6 and TIL-CTRL in RTCA killing assays.

TABLE 6 expression of killing Rate of CXCR1-SCR Signal transduction receptor TIL on target cells

Sample name	Target cell killing Rate (%)
		TIL-CXCR1-SCR1	58.77
TIL-CXCR1-SCR2	55.62
		TIL-CXCR1-SCR3	61.49
TIL-CXCR1-SCR4	68.75
		TIL-CXCR1-SCR5	51.38
TIL-CXCR1-SCR6	75.33
		TIL-CTRL	31.25

The results in FIG. 1 show that both TIL-CXCR1-SCR4 and TIL-CXCR1-SCR6 have significantly greater killing effect on homologous melanoma primary tumor cells than TIL-CTRL. Table 7 shows that TIL-CXCR1-SCR1-TIL-CXCR1-SCR6 all had significantly higher killing rates for homologous melanoma primary tumor target cells than TIL-CTRL.

Example 6: killing of tumor graft (PDX) tumor tissue by TIL cells expressing CXCR1-SCR signaling receptor

Immunodeficient B-NDG mice (purchased from Baioerskin) were used as PDX model to construct experimental animals.

Experimental design and grouping: as shown in Table 8 below

Table 8 mice dosing regimen and groupings

The TILs used in groups 2 and 3 were TIL-CTRL and TIL-CXCR1-SCR6 of the TILs prepared in example 3. Before tail vein injection, cells are centrifugally resuspended in PBS to prepareThe density of the osteoblast is 1 multiplied by 10 ⁸ /mL PBS cell suspension.

Animal feeding

After purchasing the required amount of B-NDG mice, the mice are fed into SPF-class experimental animal houses for 7-10 days.

Environment: the mice will be housed in a clear resin plastic cage in an animal house. The mouse cage padding is the sawdust and corncob padding which are subjected to high-pressure sterilization and is replaced periodically. The animal room is equipped with a high efficiency air filter and the temperature will be maintained between 20-26 c (68-79F) with a relative humidity of 40-70%. Temperature and humidity were continuously observed and recorded. The lighting conditions were 12 hours of fluorescent light illumination and 12 hours of no illumination per day.

Food and drinking water: the experimental mice can obtain special mouse grains (sterilized by irradiation, shanghai Laike laboratory animal liability Co., ltd., china) in an unlimited amount, and can be used for approaching sterilized clean drinking water at any time without obstacle.

Construction of PDX model

1) Patient tumor tissue sample treatment: taking a part of melanoma tissue in example 2, removing necrotic part tissue, adipose tissue, connective tissue, etc. under aseptic conditions, after washing, the tissue is divided into a plurality of 5X 5mm by using a surgical knife ³ The tissue block is placed in a tumor-containing sample transportation preservation solution UW, and B-NDG mice are prepared to be inoculated with the tumor block;

2) Tumor tissue sample inoculation: several B-NDG mice were taken, the mice were fixed with a mouse subcutaneous tumor inoculation fixator after the shoulder blade portion was prepared, the iodophor was sterilized, and the tumor mass in 1) was inoculated to the right inguinal portion with a PDX model tumor mass inoculation trocar after local anesthesia of lidocaine. Inoculation when the astronomical is P0, tumor is measured 2 times per week, and the calculation formula of tumor volume is V=0.5×a×b ² Wherein a and b are the long and short diameters of the tumor, respectively;

3) PDX tissue passaging: observing the growth condition of tumor tissue of each inoculated mouse until the tumor tissue volume is over 300mm ³ After the mice were anesthetized, the tumor mass was removed and cut into 5X 5mm pieces with a scalpel under aseptic conditions ³ Repeating the step 2) after tissue mass, inoculating to the inguinal part of the right side of a new mouse, and waiting for the next generation growth of PDX tumor;

4) Repeating step 3), continuing to subculture for 2-3 generations, taking part of the in-vivo PDX tissue of the mice for histologic pathological analysis, determining that the PDX tissue is still human tissue (but not murine tissue), continuing to inoculate the mice with the PDX tissue (namely, inoculating 45 mice with a PDX tissue block) according to 1.5 times of the number of the mice used in the experimental design of the table 7, observing the tumor formation condition of the mice, measuring the tumor number 2 times per week, and waiting for the tumor formation.

Grouping and administration of animals

Tumor volume of equal PDX inoculated mice reaches 50mm ³ About, 30 animals of appropriate tumor volume were selected from 45 animals, randomly grouped by tumor volume, n=10, ensuring comparability of all groups at baseline. Grouping when the diary was D0, dosing was performed according to the protocol of table 7. Animal body weight and tumor volume were measured 3 times a week during the experiment, and animals were observed daily for clinical symptoms. Mm for tumor volume ³ The tumor measurement formula is the same as that described above.

Results

The experimental results are shown in FIG. 2. One-way analysis of variance (one-way ANOVA analysis) was performed on the tumor volume differences between the different groups, followed by post hoc examination (Bonferroni post hoc test) using the Bonferroni method to see if there were significant differences between the different groups. * : p <0.05; * P <0.01. Figure 2 shows that tumor volume increase was very significantly inhibited in the TIL-CTRL dosed mice compared to PBS-injected control tumor-bearing mice by day 40 post-dosing. The tumor volume of tumor-bearing mice in the TIL-CXCR1-SCR6 dosing group was further significantly or very significantly reduced compared to the TIL-CTRL dosing group. The result shows that the unmodified TIL-CTRL has obvious inhibition effect on the homologous paired PDX tumor tissues, and the inhibition effect of the TIL on the homologous PDX tumor tissues is improved more obviously on the basis after the transgenic modification of the CXCR1-SCR6 signal conversion receptor, so that the CXCR1-SCR6 signal conversion receptor can obviously activate immune effector cells and improve the tumor killing capacity of the immune effector cells.

Although specific embodiments of the invention have been described in detail, those skilled in the art will appreciate. Numerous modifications and substitutions of details are possible in light of all the teachings disclosed, and such modifications are contemplated as falling within the scope of the present invention. The full scope of the invention is given by the appended claims and any equivalents thereof.

Sequences herein

CD8 signal peptide:

SEQ ID NO:1

atggccttaccagtgaccgccttgctcctgccgctggccttgctgctccacgccgccaggccg

SEQ ID NO:2

MALPVTALLLPLALLLHAARP

CXCR1：

SEQ ID NO:3

atgtcaaatattacagatccacagatgtgggattttgatgatctaaatttcactggcatgccacctgcagatgaagattacagcccctgtatgctagaaactgagacactcaacaagtatgttgtgatcatcgcctatgccctagtgttcctgctgagcctgctgggaaactccctggtgatgctggtcatcttatacagcagggtcggccgctccgtcactgatgtctacctgctgaacctggccttggccgacctactctttgccctgaccttgcccatctgggccgcctccaaggtgaatggctggatttttggcacattcctgtgcaaggtggtctcactcctgaaggaagtcaacttctacagtggcatcctgctgttggcctgcatcagtgtggaccgttacctggccattgtccatgccacacgcacactgacccagaagcgtcacttggtcaagtttgtttgtcttggctgctggggactgtctatgaatctgtccctgcccttcttccttttccgccaggcttaccatccaaacaattccagtccagtttgctatgaggtcctgggaaatgacacagcaaaatggcggatggtgttgcggatcctgcctcacacctttggcttcatcgtgccgctgtttgtcatgctgttctgctatggattcaccctgcgtacactgtttaaggcccacatggggcagaagcaccgagccatgagggtcatctttgctgtcgtcctcatcttcctgctttgctggctgccctacaacctggtcctgctggcagacaccctcatgaggacccaggtgatccaggagagctgtgagcgccgcaacaacatcggccgggccctggatgccactgagattctgggatttctccatagctgcctcaaccccatcatctacgccttcatcggccaaaattttcgccatggattcctcaagatcctggctatgcatggcctggtcagcaaggagttcttggcacgtcatcgtgttacctcctacacttcttcgtctgtcaatgtctcttccaacctc

SEQ ID NO:4

MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL

CD28 intracellular domain:

SEQ ID NO:5

aggagtaagaggagcaggctcctgcacagtgactacatgaacatgactcctagaagacctggacctaccagaaagcattaccagccctatgccccaccacgcgacttcgcagcctatcgctcctga

SEQ ID NO:6

RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

IL-7Ra intracellular domain:

SEQ ID NO:7

aaaaagaggattaagcctatcgtatggcccagtctccccgatcataagaagactctggaacatctttgtaagaaaccaagaaaaaatttaaatgtgagtttcaatcctgaaagtttcctggactgccagattcatagggtggatgacattcaagctagagatgaagtggaaggttttctgcaagatacgtttcctcagcaactagaagaatctgagaagcagaggcttggaggggatgtgcagagccccaactgcccatctgaggatgtagtcgtcactccagaaagctttggaagagattcatccctcacatgcctggctgggaatgtcagtgcatgtgacgcccctattctctcctcttccaggtccctagactgcagggagagtggcaagaatgggcctcatgtgtaccaggacctcctgcttagccttgggactacaaacagcacgctgccccctccattttctctccaatctggaatcctgacattgaacccagttgctcagggtcagcccattcttacttccctgggatcaaatcaagaagaagcatatgtcaccatgtccagcttctaccaaaaccag

SEQ ID NO:8

KKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ

BCMA extracellular domain:

SEQ ID NO:9

atgttgcagatggctgggcagtgctcccaaaatgaatattttgacagtttgttgcatgcttgcataccttgtcaacttcgatgttcttctaatactcctcctctaacatgtcagcgttattgtaatgcaagtgtgaccaattcagtgaaaggaacgaatgcg

SEQ ID NO:10

mlqmagqsqneyfdlhacipcqlrcstppltcqrycnsvtnsvkgtnaclaudenin18.2 epitope:

SEQ ID NO:11

atggaccagtggagcacccaagacttgtacaacaaccccgtaacagctgttttcaactaccag

SEQ ID NO:12

MDQWSTQDLYNNPVTAVFNYQ

joint 1:

SEQ ID NO:13

agagctgatgccgctcct

SEQ ID NO:14

RADAAP

joint 2:

SEQ ID NO:15

agcgccaagaccacaccc

SEQ ID NO:16

SAKTTP

joint 3

SEQ ID NO:17

ggtggcgga

SEQ ID NO:18

GGG

Joint 4:

SEQ ID NO:19

ggcggaggaggcagcggaggaggagga

SEQ ID NO:20

GGGGSGGGG

CXCR1-SCR1：

SEQ ID NO:21

atggccttaccagtgaccgccttgctcctgccgctggccttgctgctccacgccgccaggccgatgtcaaatattacagatccacagatgtgggattttgatgatctaaatttcactggcatgccacctgcagatgaagattacagcccctgtatgctagaaactgagacactcaacaagtatgttgtgatcatcgcctatgccctagtgttcctgctgagcctgctgggaaactccctggtgatgctggtcatcttatacagcagggtcggccgctccgtcactgatgtctacctgctgaacctggccttggccgacctactctttgccctgaccttgcccatctgggccgcctccaaggtgaatggctggatttttggcacattcctgtgcaaggtggtctcactcctgaaggaagtcaacttctacagtggcatcctgctgttggcctgcatcagtgtggaccgttacctggccattgtccatgccacacgcacactgacccagaagcgtcacttggtcaagtttgtttgtcttggctgctggggactgtctatgaatctgtccctgcccttcttccttttccgccaggcttaccatccaaacaattccagtccagtttgctatgaggtcctgggaaatgacacagcaaaatggcggatggtgttgcggatcctgcctcacacctttggcttcatcgtgccgctgtttgtcatgctgttctgctatggattcaccctgcgtacactgtttaaggcccacatggggcagaagcaccgagccatgagggtcatctttgctgtcgtcctcatcttcctgctttgctggctgccctacaacctggtcctgctggcagacaccctcatgaggacccaggtgatccaggagagctgtgagcgccgcaacaacatcggccgggccctggatgccactgagattctgggatttctccatagctgcctcaaccccatcatctacgccttcatcggccaaaattttcgccatggattcctcaagatcctggctatgcatggcctggtcagcaaggagttcttggcacgtcatcgtgttacctcctacacttcttcgtctgtcaatgtctcttccaacctcagcgccaagaccacacccaggagtaagaggagcaggctcctgcacagtgactacatgaacatgactcctagaagacctggacctaccagaaagcattaccagccctatgccccaccacgcgacttcgcagcctatcgctcctgaCXCR1-SCR2：

SEQ ID NO:22

atggccttaccagtgaccgccttgctcctgccgctggccttgctgctccacgccgccaggccgatgtcaaatattacagatccacagatgtgggattttgatgatctaaatttcactggcatgccacctgcagatgaagattacagcccctgtatgctagaaactgagacactcaacaagtatgttgtgatcatcgcctatgccctagtgttcctgctgagcctgctgggaaactccctggtgatgctggtcatcttatacagcagggtcggccgctccgtcactgatgtctacctgctgaacctggccttggccgacctactctttgccctgaccttgcccatctgggccgcctccaaggtgaatggctggatttttggcacattcctgtgcaaggtggtctcactcctgaaggaagtcaacttctacagtggcatcctgctgttggcctgcatcagtgtggaccgttacctggccattgtccatgccacacgcacactgacccagaagcgtcacttggtcaagtttgtttgtcttggctgctggggactgtctatgaatctgtccctgcccttcttccttttccgccaggcttaccatccaaacaattccagtccagtttgctatgaggtcctgggaaatgacacagcaaaatggcggatggtgttgcggatcctgcctcacacctttggcttcatcgtgccgctgtttgtcatgctgttctgctatggattcaccctgcgtacactgtttaaggcccacatggggcagaagcaccgagccatgagggtcatctttgctgtcgtcc

223280Z 1CNCN

tcatcttcctgctttgctggctgccctacaacctggtcctgctggcagacaccctcatgaggacccaggtgatccaggagagctgtgagcgccgcaacaacatcggccgggcc

ctggatgccactgagattctgggatttctccatagctgcctcaaccccatcatctacgccttcatcggccaaaattttcgccatggattcctcaagatcctggctatgcatggcct

ggtcagcaaggagttcttggcacgtcatcgtgttacctcctacacttcttcgtctgtcaatgtctcttccaacctcagagctgatgccgctcctaaaaagaggattaagcctatcg

tatggcccagtctccccgatcataagaagactctggaacatctttgtaagaaaccaagaaaaaatttaaatgtgagtttcaatcctgaaagtttcctggactgccagattcata

gggtggatgacattcaagctagagatgaagtggaaggttttctgcaagatacgtttcctcagcaactagaagaatctgagaagcagaggcttggaggggatgtgcagagcc

ccaactgcccatctgaggatgtagtcgtcactccagaaagctttggaagagattcatccctcacatgcctggctgggaatgtcagtgcatgtgacgcccctattctctcctcttc

caggtccctagactgcagggagagtggcaagaatgggcctcatgtgtaccaggacctcctgcttagccttgggactacaaacagcacgctgccccctccattttctctccaatc

tggaatcctgacattgaacccagttgctcagggtcagcccattcttacttccctgggatcaaatcaagaagaagcatatgtcaccatgtccagcttctaccaaaaccagtgaCXCR1-SCR3：

SEQ ID NO:23

atggccttaccagtgaccgccttgctcctgccgctggccttgctgctccacgccgccaggccgatggaccagtggagcacccaagacttgtacaacaaccccgtaacagctgt

tttcaactaccagagagctgatgccgctcctatgtcaaatattacagatccacagatgtgggattttgatgatctaaatttcactggcatgccacctgcagatgaagattacag

cccctgtatgctagaaactgagacactcaacaagtatgttgtgatcatcgcctatgccctagtgttcctgctgagcctgctgggaaactccctggtgatgctggtcatcttatac

agcagggtcggccgctccgtcactgatgtctacctgctgaacctggccttggccgacctactctttgccctgaccttgcccatctgggccgcctccaaggtgaatggctggatttt

tggcacattcctgtgcaaggtggtctcactcctgaaggaagtcaacttctacagtggcatcctgctgttggcctgcatcagtgtggaccgttacctggccattgtccatgccaca

cgcacactgacccagaagcgtcacttggtcaagtttgtttgtcttggctgctggggactgtctatgaatctgtccctgcccttcttccttttccgccaggcttaccatccaaacaat

tccagtccagtttgctatgaggtcctgggaaatgacacagcaaaatggcggatggtgttgcggatcctgcctcacacctttggcttcatcgtgccgctgtttgtcatgctgttctg

ctatggattcaccctgcgtacactgtttaaggcccacatggggcagaagcaccgagccatgagggtcatctttgctgtcgtcctcatcttcctgctttgctggctgccctacaacc

tggtcctgctggcagacaccctcatgaggacccaggtgatccaggagagctgtgagcgccgcaacaacatcggccgggccctggatgccactgagattctgggatttctccat

agctgcctcaaccccatcatctacgccttcatcggccaaaattttcgccatggattcctcaagatcctggctatgcatggcctggtcagcaaggagttcttggcacgtcatcgtg

ttacctcctacacttcttcgtctgtcaatgtctcttccaacctc

agcgccaagaccacacccaggagtaagaggagcaggctcctgcacagtgactacatgaacatgactcctagaagacctggacctaccagaaagcattaccagccctatgc

cccaccacgcgacttcgcagcctatcgctcctga

CXCR1-SCR4：

SEQ ID NO:24

atggccttaccagtgaccgccttgctcctgccgctggccttgctgctccacgccgccaggccgatgttgcagatggctgggcagtgctcccaaaatgaatattttgacagtttgt

tgcatgcttgcataccttgtcaacttcgatgttcttctaatactcctcctctaacatgtcagcgttattgtaatgcaagtgtgaccaattcagtgaaaggaacgaatgcg

agagctgatgccgctcctatgtcaaatattacagatccacagatgtgggattttgatgatctaaatttcactggcatgccacctgcagatgaagattacagcccctgtatgctag

aaactgagacactcaacaagtatgttgtgatcatcgcctatgccctagtgttcctgctgagcctgctgggaaactccctggtgatgctggtcatcttatacagcagggtcggcc

gctccgtcactgatgtctacctgctgaacctggccttggccgacctactctttgccctgaccttgcccatctgggccgcctccaaggtgaatggctggatttttggcacattcctgt

gcaaggtggtctcactcctgaaggaagtcaacttctacagtggcatcctgctgttggcctgcatcagtgtggaccgttacctggccattgtccatgccacacgcacactgaccc

agaagcgtcacttggtcaagtttgtttgtcttggctgctggggactgtctatgaatctgtccctgcccttcttccttttccgccaggcttaccatccaaacaattccagtccagtttg

ctatgaggtcctgggaaatgacacagcaaaatggcggatggtgttgcggatcctgcctcacacctttggcttcatcgtgccgctgtttgtcatgctgttctgctatggattcaccc

tgcgtacactgtttaaggcccacatggggcagaagcaccgagccatgagggtcatctttgctgtcgtcctcatcttcctgctttgctggctgccctacaacctggtcctgctggc

agacaccctcatgaggacccaggtgatccaggagagctgtgagcgccgcaacaacatcggccgggccctggatgccactgagattctgggatttctccatagctgcctcaac

cccatcatctacgccttcatcggccaaaattttcgccatggattcctcaagatcctggctatgcatggcctggtcagcaaggagttcttggcacgtcatcgtgttacctcctacac

ttcttcgtctgtcaatgtctcttccaacctcagcgccaagaccacacccaaaaagaggattaagcctatcgtatggcccagtctccccgatcataagaagactctggaacatct

ttgtaagaaaccaagaaaaaatttaaatgtgagtttcaatcctgaaagtttcctggactgccagattcatagggtggatgacattcaagctagagatgaagtggaaggttttct

gcaagatacgtttcctcagcaactagaagaatctgagaagcagaggcttggaggggatgtgcagagccccaactgcccatctgaggatgtagtcgtcactccagaaagcttt

ggaagagattcatccctcacatgcctggctgggaatgtcagtgcatgtgacgcccctattctctcctcttccaggtccctagactgcagggagagtggcaagaatgggcctcat

gtgtaccaggacctcctgcttagccttgggactacaaacagcacgctgccccctccattttctctccaatctggaatcctgacattgaacccagttgctcagggtcagcccattct

tacttccctgggatcaaatcaagaagaagcatatgtcaccatgtccagcttctaccaaaaccagtga

CXCR1-SCR5：

SEQ ID NO:25

tttcaactaccagggtggcggaatgtcaaatattacagatccacagatgtgggattttgatgatctaaatttcactggcatgccacctgcagatgaagattacagcccctgtat

gctagaaactgagacactcaacaagtatgttgtgatcatcgcctatgccctagtgttcctgctgagcctgctgggaaactccctggtgatgctggtcatcttatacagcagggtc

ggccgctccgtcactgatgtctacctgctgaacctggccttggccgacctactctttgccctgaccttgcccatctgggccgcctccaaggtgaatggctggatttttggcacatt

cctgtgcaaggtggtctcactcctgaaggaagtcaacttctacagtggcatcctgctgttggcctgcatcagtgtggaccgttacctggccattgtccatgccacacgcacactg

acccagaagcgtcacttggtcaagtttgtttgtcttggctgctggggactgtctatgaatctgtccctgcccttcttccttttccgccaggcttaccatccaaacaattccagtcca

gtttgctatgaggtcctgggaaatgacacagcaaaatggcggatggtgttgcggatcctgcctcacacctttggcttcatcgtgccgctgtttgtcatgctgttctgctatggatt

caccctgcgtacactgtttaaggcccacatggggcagaagcaccgagccatgagggtcatctttgctgtcgtcctcatcttcctgctttgctggctgccctacaacctggtcctgc

tggcagacaccctcatgaggacccaggtgatccaggagagctgtgagcgccgcaacaacatcggccgggccctggatgccactgagattctgggatttctccatagctgcct

caaccccatcatctacgccttcatcggccaaaattttcgccatggattcctcaagatcctggctatgcatggcctggtcagcaaggagttcttggcacgtcatcgtgttacctcct

acacttcttcgtctgtcaatgtctcttccaacctcggcggaggaggcagcggaggaggaggaaggagtaagaggagcaggctcctgcacagtgactacatgaacatgactcc

tagaagacctggacctaccagaaagcattaccagccctatgccccaccacgcgacttcgcagcctatcgctcctga

CXCR1-SCR6：

SEQ ID NO:26

tgcatgcttgcataccttgtcaacttcgatgttcttctaatactcctcctctaacatgtcagcgttattgtaatgcaagtgtgaccaattcagtgaaaggaacgaatgcgagagct

gatgccgctcctatgtcaaatattacagatccacagatgtgggattttgatgatctaaatttcactggcatgccacctgcagatgaagattacagcccctgtatgctagaaactg

agacactcaacaagtatgttgtgatcatcgcctatgccctagtgttcctgctgagcctgctgggaaactccctggtgatgctggtcatcttatacagcagggtcggccgctccgt

223280Z 1CNCN

cactgatgtctacctgctgaacctggccttggccgacctactctttgccctgaccttgcccatctgggccgcctccaaggtgaatggctggatttttggcacattcctgtgcaagg

tggtctcactcctgaaggaagtcaacttctacagtggcatcctgctgttggcctgcatcagtgtggaccgttacctggccattgtccatgccacacgcacactgacccagaagc

gtcacttggtcaagtttgtttgtcttggctgctggggactgtctatgaatctgtccctgcccttcttccttttccgccaggcttaccatccaaacaattccagtccagtttgctatga

ggtcctgggaaatgacacagcaaaatggcggatggtgttgcggatcctgcctcacacctttggcttcatcgtgccgctgtttgtcatgctgttctgctatggattcaccctgcgta

cactgtttaaggcccacatggggcagaagcaccgagccatgagggtcatctttgctgtcgtcctcatcttcctgctttgctggctgccctacaacctggtcctgctggcagacac

cctcatgaggacccaggtgatccaggagagctgtgagcgccgcaacaacatcggccgggccctggatgccactgagattctgggatttctccatagctgcctcaaccccatca

tctacgccttcatcggccaaaattttcgccatggattcctcaagatcctggctatgcatggcctggtcagcaaggagttcttggcacgtcatcgtgttacctcctacacttcttcgt

ctgtcaatgtctcttccaacctcagcgccaagaccacacccaggagtaagaggagcaggctcctgcacagtgactacatgaacatgactcctagaagacctggacctaccag

aaagcattaccagccctatgccccaccacgcgacttcgcagcctatcgctcctgatga

Claims

1. an isolated fusion protein that is a signal transduction receptor comprising: (1) A CXCR region and (2) an intracellular region,

the CXCR region is CXCR or a fragment or mutant thereof comprising an extracellular region and a transmembrane region,

the intracellular region comprises an intracellular domain of a costimulatory signaling molecule or a functional fragment or mutant thereof that retains the costimulatory signaling molecule to deliver a costimulatory signal, activate a biological function of an immune cell.

2. The fusion protein of claim 1, wherein the CXCR region is located in the N-terminal direction of the intracellular region and/or wherein there is a linker between the CXCR region and the intracellular region,

Preferably, the CXCR is CXCR1 or CXCR2.

3. The fusion protein of claim 1, wherein the costimulatory signaling molecule comprises one or more of CD28, CD134 (OX 40), CD137 (4-1 BB), LCK, ICOS, DAP, siglec-9, siglec-10, siglec-15, TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, IL-2R, IL-4R, IL-7R, IL-10R, IL-12R, IL-15R, IL-21R, CD27 and CD 40; preferably, the costimulatory signaling molecule comprises CD28 and/or IL-7Ralpha.

4. The fusion protein of claim 1, further comprising a membrane surface tag at the N-terminus of the CXCR region, said membrane surface tag comprising a membrane surface functional domain that is a BCMA extracellular domain or variant thereof, or a claudin protein extracellular domain or fragment or variant thereof,

preferably, the membrane surface tag further comprises a linker or hinge region located at the N-or C-terminus of the membrane surface functional domain,

preferably, the fragment of the extracellular domain of claudin protein is an extracellular epitope of claudin protein; more preferably, the claudin protein is claudin18.2.

5. The fusion protein of any one of claim 1 to 4,

The amino acid sequence of CXCR1 is SEQ ID NO. 4, and/or

The amino acid sequence of the CD28 intracellular region is shown as SEQ ID NO. 6, and/or

The amino acid sequence of the IL-7Ralpha intracellular region is shown as SEQ ID NO. 8, and/or

The amino acid sequence of the BCMA extracellular domain comprises the sequence shown in SEQ ID NO. 10, and/or

The claudin18.2 protein extracellular domain fragment comprises the sequence shown in SEQ ID NO. 12, and/or

The fusion protein is the protein encoded by any one of SEQ ID NO. 21-26.

6. A polynucleotide molecule selected from the group consisting of: a polynucleotide molecule or complementary sequence encoding a fusion protein according to any one of claims 1 to 5,

preferably, the method comprises the steps of,

in the fusion protein, the coding sequence of CXCR1 is shown as SEQ ID NO. 3, and/or

In the fusion protein, the intracellular domain of the costimulatory signal molecule is a CD28 intracellular region, the coding sequence of which is shown as SEQ ID NO. 5, and/or

In the fusion protein, the intracellular domain of the costimulatory signal molecule is the IL-7Ralpha intracellular region, the coding sequence of which is shown as SEQ ID NO. 7, and/or

The fusion protein comprises a membrane surface tag, the membrane surface tag comprises a BCMA extracellular domain with a coding sequence shown as SEQ ID NO. 9 or a fragment of claudin18.2 protein extracellular domain with a coding sequence shown as SEQ ID NO. 11,

More preferably, the process is carried out,

the polynucleotide molecule is selected from any one of SEQ ID NO. 21-26 or is the complementary sequence of any one of the polynucleotide molecules shown.

7. A nucleic acid construct comprising the polynucleotide molecule of claim 6,

preferably, the nucleic acid construct is a vector, such as an expression vector or an integration vector,

more preferably, the vector is a non-viral vector.

8. A genetically engineered cell expressing the fusion protein according to claim 1 to 5 and/or carrying the coding sequence of the fusion protein,

preferably, the method comprises the steps of,

the cells are immune cells; more preferably, the immune cells include T cells, NK cells, CAR-T, CAR-NK, TCR-T, CIK, NKT and TIL, and/or

The cells also express a CAR, or carry a coding sequence for a CAR, and/or

The cells also express an exogenous TCR, or a coding sequence carrying an exogenous TCR.

9. A pharmaceutical composition comprising any one or more of a pharmaceutically acceptable adjuvant or fusion protein of any one of claims 1-5, a polynucleotide molecule of claim 6, a nucleic acid construct of claim 7, and a genetically engineered cell of claim 8.

10. Use of any one or more of the fusion protein of any one of claims 1-5, the polynucleotide molecule of claim 6, the nucleic acid construct of claim 7 and the genetically engineered cell of claim 8 in the manufacture of a medicament for the treatment or prevention of cancer.