CN116710564A - Oncolytic viruses enhance T cell response to effective TIL therapy - Google Patents
Oncolytic viruses enhance T cell response to effective TIL therapy Download PDFInfo
- Publication number
- CN116710564A CN116710564A CN202180073895.XA CN202180073895A CN116710564A CN 116710564 A CN116710564 A CN 116710564A CN 202180073895 A CN202180073895 A CN 202180073895A CN 116710564 A CN116710564 A CN 116710564A
- Authority
- CN
- China
- Prior art keywords
- ifn
- tumor
- til
- cells
- mem
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 244000309459 oncolytic virus Species 0.000 title claims description 70
- 230000005867 T cell response Effects 0.000 title description 15
- 238000002560 therapeutic procedure Methods 0.000 title description 9
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 141
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 claims abstract description 94
- 238000000034 method Methods 0.000 claims abstract description 59
- 201000011510 cancer Diseases 0.000 claims abstract description 50
- 102100032937 CD40 ligand Human genes 0.000 claims description 87
- 108010029697 CD40 Ligand Proteins 0.000 claims description 85
- 239000007924 injection Substances 0.000 claims description 34
- 238000002347 injection Methods 0.000 claims description 34
- 102000014150 Interferons Human genes 0.000 claims description 33
- 108010050904 Interferons Proteins 0.000 claims description 33
- 229940047124 interferons Drugs 0.000 claims description 29
- 230000003308 immunostimulating effect Effects 0.000 claims description 26
- -1 LIGHT Proteins 0.000 claims description 17
- 210000004881 tumor cell Anatomy 0.000 claims description 15
- 210000004698 lymphocyte Anatomy 0.000 claims description 14
- 210000000988 bone and bone Anatomy 0.000 claims description 13
- 108010082808 4-1BB Ligand Proteins 0.000 claims description 12
- 102100025221 CD70 antigen Human genes 0.000 claims description 12
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 claims description 12
- 101001063392 Homo sapiens Lymphocyte function-associated antigen 3 Proteins 0.000 claims description 12
- 102100030984 Lymphocyte function-associated antigen 3 Human genes 0.000 claims description 12
- 108010042215 OX40 Ligand Proteins 0.000 claims description 12
- 102100032101 Tumor necrosis factor ligand superfamily member 9 Human genes 0.000 claims description 12
- 210000000612 antigen-presenting cell Anatomy 0.000 claims description 10
- 230000002601 intratumoral effect Effects 0.000 claims description 10
- 238000012258 culturing Methods 0.000 claims description 7
- 239000002246 antineoplastic agent Substances 0.000 claims description 4
- 101000633786 Homo sapiens SLAM family member 6 Proteins 0.000 claims 3
- 102000015271 Intercellular Adhesion Molecule-1 Human genes 0.000 claims 3
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 claims 3
- 101000597780 Mus musculus Tumor necrosis factor ligand superfamily member 18 Proteins 0.000 claims 3
- 102100029197 SLAM family member 6 Human genes 0.000 claims 3
- 101710174757 T-cell immunoglobulin and mucin domain-containing protein 4 Proteins 0.000 claims 3
- 102100039367 T-cell immunoglobulin and mucin domain-containing protein 4 Human genes 0.000 claims 3
- 102100035283 Tumor necrosis factor ligand superfamily member 18 Human genes 0.000 claims 3
- 102100026890 Tumor necrosis factor ligand superfamily member 4 Human genes 0.000 claims 3
- 210000004027 cell Anatomy 0.000 description 95
- 239000000203 mixture Substances 0.000 description 53
- 241000699670 Mus sp. Species 0.000 description 46
- 230000000694 effects Effects 0.000 description 46
- 230000014509 gene expression Effects 0.000 description 34
- 210000004443 dendritic cell Anatomy 0.000 description 31
- 238000011282 treatment Methods 0.000 description 30
- 210000001744 T-lymphocyte Anatomy 0.000 description 28
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 28
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 26
- 229940090044 injection Drugs 0.000 description 26
- 101150013553 CD40 gene Proteins 0.000 description 24
- 101000868215 Homo sapiens CD40 ligand Proteins 0.000 description 24
- 101000959820 Homo sapiens Interferon alpha-1/13 Proteins 0.000 description 24
- 102100040019 Interferon alpha-1/13 Human genes 0.000 description 24
- 241000701161 unidentified adenovirus Species 0.000 description 24
- 241000699666 Mus <mouse, genus> Species 0.000 description 21
- 108090000623 proteins and genes Proteins 0.000 description 18
- 230000004913 activation Effects 0.000 description 17
- 239000003795 chemical substances by application Substances 0.000 description 17
- 201000010099 disease Diseases 0.000 description 16
- 210000002540 macrophage Anatomy 0.000 description 16
- 101000852870 Homo sapiens Interferon alpha/beta receptor 1 Proteins 0.000 description 15
- 241000700605 Viruses Species 0.000 description 15
- 150000007523 nucleic acids Chemical group 0.000 description 15
- 101001054334 Homo sapiens Interferon beta Proteins 0.000 description 14
- 102000005962 receptors Human genes 0.000 description 14
- 108020003175 receptors Proteins 0.000 description 14
- 230000002829 reductive effect Effects 0.000 description 14
- 230000001225 therapeutic effect Effects 0.000 description 14
- 230000004614 tumor growth Effects 0.000 description 14
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 13
- 102100036714 Interferon alpha/beta receptor 1 Human genes 0.000 description 13
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 13
- 101001054328 Mus musculus Interferon beta Proteins 0.000 description 13
- 239000003814 drug Substances 0.000 description 13
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 13
- 239000002953 phosphate buffered saline Substances 0.000 description 13
- 241000701806 Human papillomavirus Species 0.000 description 12
- 102100022469 Interferon kappa Human genes 0.000 description 12
- 208000035475 disorder Diseases 0.000 description 12
- 238000009472 formulation Methods 0.000 description 12
- 108010080375 interferon kappa Proteins 0.000 description 12
- RGLRXNKKBLIBQS-XNHQSDQCSA-N leuprolide acetate Chemical compound CC(O)=O.CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 RGLRXNKKBLIBQS-XNHQSDQCSA-N 0.000 description 12
- 108020004707 nucleic acids Proteins 0.000 description 12
- 102000039446 nucleic acids Human genes 0.000 description 12
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 11
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 11
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 11
- 239000003446 ligand Substances 0.000 description 11
- 201000001441 melanoma Diseases 0.000 description 11
- 230000004044 response Effects 0.000 description 11
- 230000007423 decrease Effects 0.000 description 10
- 239000003937 drug carrier Substances 0.000 description 10
- 238000000684 flow cytometry Methods 0.000 description 10
- 230000012010 growth Effects 0.000 description 10
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 10
- 230000010076 replication Effects 0.000 description 10
- 208000024891 symptom Diseases 0.000 description 10
- 108010000817 Leuprolide Proteins 0.000 description 9
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 9
- 102000004473 OX40 Ligand Human genes 0.000 description 9
- 230000000259 anti-tumor effect Effects 0.000 description 9
- 229960005243 carmustine Drugs 0.000 description 9
- 230000002401 inhibitory effect Effects 0.000 description 9
- 229960004338 leuprorelin Drugs 0.000 description 9
- 239000002502 liposome Substances 0.000 description 9
- 229960000485 methotrexate Drugs 0.000 description 9
- 239000008194 pharmaceutical composition Substances 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- 230000009885 systemic effect Effects 0.000 description 9
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 8
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 8
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 8
- 101150007193 IFNB1 gene Proteins 0.000 description 8
- 206010027476 Metastases Diseases 0.000 description 8
- 150000001413 amino acids Chemical class 0.000 description 8
- 239000000969 carrier Substances 0.000 description 8
- 230000006870 function Effects 0.000 description 8
- 239000000463 material Substances 0.000 description 8
- 230000009401 metastasis Effects 0.000 description 8
- 230000000174 oncolytic effect Effects 0.000 description 8
- 230000009467 reduction Effects 0.000 description 8
- 229960004641 rituximab Drugs 0.000 description 8
- 230000003612 virological effect Effects 0.000 description 8
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 8
- 238000011740 C57BL/6 mouse Methods 0.000 description 7
- 241000282465 Canis Species 0.000 description 7
- MWWSFMDVAYGXBV-RUELKSSGSA-N Doxorubicin hydrochloride Chemical compound Cl.O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 MWWSFMDVAYGXBV-RUELKSSGSA-N 0.000 description 7
- 241000282324 Felis Species 0.000 description 7
- 241000713666 Lentivirus Species 0.000 description 7
- 241000124008 Mammalia Species 0.000 description 7
- 241001529936 Murinae Species 0.000 description 7
- 241000283973 Oryctolagus cuniculus Species 0.000 description 7
- 241000700159 Rattus Species 0.000 description 7
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 7
- 238000000692 Student's t-test Methods 0.000 description 7
- 108700019146 Transgenes Proteins 0.000 description 7
- 239000000427 antigen Substances 0.000 description 7
- 108091007433 antigens Proteins 0.000 description 7
- 102000036639 antigens Human genes 0.000 description 7
- 229940079593 drug Drugs 0.000 description 7
- 229960001101 ifosfamide Drugs 0.000 description 7
- 208000015181 infectious disease Diseases 0.000 description 7
- 208000020816 lung neoplasm Diseases 0.000 description 7
- 235000018102 proteins Nutrition 0.000 description 7
- 102000004169 proteins and genes Human genes 0.000 description 7
- 230000011664 signaling Effects 0.000 description 7
- 238000007619 statistical method Methods 0.000 description 7
- KDQAABAKXDWYSZ-PNYVAJAMSA-N vinblastine sulfate Chemical compound OS(O)(=O)=O.C([C@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 KDQAABAKXDWYSZ-PNYVAJAMSA-N 0.000 description 7
- 241000283690 Bos taurus Species 0.000 description 6
- 108020004414 DNA Proteins 0.000 description 6
- 241000282412 Homo Species 0.000 description 6
- 241000282898 Sus scrofa Species 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 229960002918 doxorubicin hydrochloride Drugs 0.000 description 6
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 description 6
- 210000004072 lung Anatomy 0.000 description 6
- 208000037841 lung tumor Diseases 0.000 description 6
- 230000001575 pathological effect Effects 0.000 description 6
- 150000003839 salts Chemical class 0.000 description 6
- 230000028327 secretion Effects 0.000 description 6
- 210000000952 spleen Anatomy 0.000 description 6
- 238000012353 t test Methods 0.000 description 6
- 239000000454 talc Substances 0.000 description 6
- 229910052623 talc Inorganic materials 0.000 description 6
- 229940124597 therapeutic agent Drugs 0.000 description 6
- 238000013518 transcription Methods 0.000 description 6
- 230000035897 transcription Effects 0.000 description 6
- NAALWFYYHHJEFQ-ZASNTINBSA-N (2s,5r,6r)-6-[[(2r)-2-[[6-[4-[bis(2-hydroxyethyl)sulfamoyl]phenyl]-2-oxo-1h-pyridine-3-carbonyl]amino]-2-(4-hydroxyphenyl)acetyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid Chemical compound N([C@@H](C(=O)N[C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C=1C=CC(O)=CC=1)C(=O)C(C(N1)=O)=CC=C1C1=CC=C(S(=O)(=O)N(CCO)CCO)C=C1 NAALWFYYHHJEFQ-ZASNTINBSA-N 0.000 description 5
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 5
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 5
- 102100022338 Integrin alpha-M Human genes 0.000 description 5
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 5
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 5
- 229930012538 Paclitaxel Natural products 0.000 description 5
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 5
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 5
- 210000003719 b-lymphocyte Anatomy 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 229960004316 cisplatin Drugs 0.000 description 5
- 150000001875 compounds Chemical class 0.000 description 5
- 229960004397 cyclophosphamide Drugs 0.000 description 5
- 229960003109 daunorubicin hydrochloride Drugs 0.000 description 5
- 239000000839 emulsion Substances 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 5
- 210000002443 helper t lymphocyte Anatomy 0.000 description 5
- 239000007943 implant Substances 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 230000003902 lesion Effects 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 230000007246 mechanism Effects 0.000 description 5
- 206010061289 metastatic neoplasm Diseases 0.000 description 5
- 230000005012 migration Effects 0.000 description 5
- 238000013508 migration Methods 0.000 description 5
- 230000001617 migratory effect Effects 0.000 description 5
- 229960004857 mitomycin Drugs 0.000 description 5
- 229960003301 nivolumab Drugs 0.000 description 5
- 229960001592 paclitaxel Drugs 0.000 description 5
- 229960003359 palonosetron hydrochloride Drugs 0.000 description 5
- 230000001105 regulatory effect Effects 0.000 description 5
- 239000011780 sodium chloride Substances 0.000 description 5
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 5
- 239000000725 suspension Substances 0.000 description 5
- 230000008685 targeting Effects 0.000 description 5
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 5
- 230000032258 transport Effects 0.000 description 5
- 238000007492 two-way ANOVA Methods 0.000 description 5
- 229960005486 vaccine Drugs 0.000 description 5
- 229960004982 vinblastine sulfate Drugs 0.000 description 5
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 4
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 4
- 108010088751 Albumins Proteins 0.000 description 4
- 102000009027 Albumins Human genes 0.000 description 4
- 108010092160 Dactinomycin Proteins 0.000 description 4
- ZBNZXTGUTAYRHI-UHFFFAOYSA-N Dasatinib Chemical compound C=1C(N2CCN(CCO)CC2)=NC(C)=NC=1NC(S1)=NC=C1C(=O)NC1=C(C)C=CC=C1Cl ZBNZXTGUTAYRHI-UHFFFAOYSA-N 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 4
- 102100022297 Integrin alpha-X Human genes 0.000 description 4
- 239000002067 L01XE06 - Dasatinib Substances 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 108010008038 Synthetic Vaccines Proteins 0.000 description 4
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 4
- 239000012190 activator Substances 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- RITAVMQDGBJQJZ-FMIVXFBMSA-N axitinib Chemical compound CNC(=O)C1=CC=CC=C1SC1=CC=C(C(\C=C\C=2N=CC=CC=2)=NN2)C2=C1 RITAVMQDGBJQJZ-FMIVXFBMSA-N 0.000 description 4
- 229960002756 azacitidine Drugs 0.000 description 4
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 4
- BLMPQMFVWMYDKT-NZTKNTHTSA-N carfilzomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)[C@]1(C)OC1)NC(=O)CN1CCOCC1)CC1=CC=CC=C1 BLMPQMFVWMYDKT-NZTKNTHTSA-N 0.000 description 4
- 108010021331 carfilzomib Proteins 0.000 description 4
- 229960005395 cetuximab Drugs 0.000 description 4
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 4
- 229960000684 cytarabine Drugs 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 229960002949 fluorouracil Drugs 0.000 description 4
- 210000005260 human cell Anatomy 0.000 description 4
- 210000002865 immune cell Anatomy 0.000 description 4
- 229940079322 interferon Drugs 0.000 description 4
- 230000003834 intracellular effect Effects 0.000 description 4
- GURKHSYORGJETM-WAQYZQTGSA-N irinotecan hydrochloride (anhydrous) Chemical compound Cl.C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 GURKHSYORGJETM-WAQYZQTGSA-N 0.000 description 4
- GOTYRUGSSMKFNF-UHFFFAOYSA-N lenalidomide Chemical compound C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O GOTYRUGSSMKFNF-UHFFFAOYSA-N 0.000 description 4
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 4
- 239000002207 metabolite Substances 0.000 description 4
- 229960001756 oxaliplatin Drugs 0.000 description 4
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 4
- 230000037361 pathway Effects 0.000 description 4
- 229960002621 pembrolizumab Drugs 0.000 description 4
- 230000002265 prevention Effects 0.000 description 4
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 4
- 238000011002 quantification Methods 0.000 description 4
- OHRURASPPZQGQM-GCCNXGTGSA-N romidepsin Chemical compound O1C(=O)[C@H](C(C)C)NC(=O)C(=C/C)/NC(=O)[C@H]2CSSCC\C=C\[C@@H]1CC(=O)N[C@H](C(C)C)C(=O)N2 OHRURASPPZQGQM-GCCNXGTGSA-N 0.000 description 4
- OHRURASPPZQGQM-UHFFFAOYSA-N romidepsin Natural products O1C(=O)C(C(C)C)NC(=O)C(=CC)NC(=O)C2CSSCCC=CC1CC(=O)NC(C(C)C)C(=O)N2 OHRURASPPZQGQM-UHFFFAOYSA-N 0.000 description 4
- 108010091666 romidepsin Proteins 0.000 description 4
- 230000000638 stimulation Effects 0.000 description 4
- 230000000699 topical effect Effects 0.000 description 4
- 229960005267 tositumomab Drugs 0.000 description 4
- AUFUWRKPQLGTGF-FMKGYKFTSA-N uridine triacetate Chemical compound CC(=O)O[C@@H]1[C@H](OC(C)=O)[C@@H](COC(=O)C)O[C@H]1N1C(=O)NC(=O)C=C1 AUFUWRKPQLGTGF-FMKGYKFTSA-N 0.000 description 4
- 239000013598 vector Substances 0.000 description 4
- AQTQHPDCURKLKT-JKDPCDLQSA-N vincristine sulfate Chemical compound OS(O)(=O)=O.C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C=O)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 AQTQHPDCURKLKT-JKDPCDLQSA-N 0.000 description 4
- RWRDJVNMSZYMDV-SIUYXFDKSA-L (223)RaCl2 Chemical compound Cl[223Ra]Cl RWRDJVNMSZYMDV-SIUYXFDKSA-L 0.000 description 3
- MEAPRSDUXBHXGD-UHFFFAOYSA-N 3-chloro-n-(4-propan-2-ylphenyl)propanamide Chemical compound CC(C)C1=CC=C(NC(=O)CCCl)C=C1 MEAPRSDUXBHXGD-UHFFFAOYSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 208000010370 Adenoviridae Infections Diseases 0.000 description 3
- 206010060931 Adenovirus infection Diseases 0.000 description 3
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 3
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 3
- 206010009944 Colon cancer Diseases 0.000 description 3
- 108010062580 Concanavalin A Proteins 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 3
- 239000002136 L01XE07 - Lapatinib Substances 0.000 description 3
- 239000002145 L01XE14 - Bosutinib Substances 0.000 description 3
- XNRVGTHNYCNCFF-UHFFFAOYSA-N Lapatinib ditosylate monohydrate Chemical compound O.CC1=CC=C(S(O)(=O)=O)C=C1.CC1=CC=C(S(O)(=O)=O)C=C1.O1C(CNCCS(=O)(=O)C)=CC=C1C1=CC=C(N=CN=C2NC=3C=C(Cl)C(OCC=4C=C(F)C=CC=4)=CC=3)C2=C1 XNRVGTHNYCNCFF-UHFFFAOYSA-N 0.000 description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 3
- XOGTZOOQQBDUSI-UHFFFAOYSA-M Mesna Chemical compound [Na+].[O-]S(=O)(=O)CCS XOGTZOOQQBDUSI-UHFFFAOYSA-M 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- KWYUFKZDYYNOTN-UHFFFAOYSA-M Potassium hydroxide Chemical compound [OH-].[K+] KWYUFKZDYYNOTN-UHFFFAOYSA-M 0.000 description 3
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 3
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 3
- 241000711975 Vesicular stomatitis virus Species 0.000 description 3
- OUUYBRCCFUEMLH-YDALLXLXSA-N [(1s)-2-[4-[bis(2-chloroethyl)amino]phenyl]-1-carboxyethyl]azanium;chloride Chemical compound Cl.OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 OUUYBRCCFUEMLH-YDALLXLXSA-N 0.000 description 3
- RUGAHXUZHWYHNG-NLGNTGLNSA-N acetic acid;(4r,7s,10s,13r,16s,19r)-10-(4-aminobutyl)-n-[(2s,3r)-1-amino-3-hydroxy-1-oxobutan-2-yl]-19-[[(2r)-2-amino-3-naphthalen-2-ylpropanoyl]amino]-16-[(4-hydroxyphenyl)methyl]-13-(1h-indol-3-ylmethyl)-6,9,12,15,18-pentaoxo-7-propan-2-yl-1,2-dithia-5, Chemical compound CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.C([C@H]1C(=O)N[C@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(N[C@@H](CSSC[C@@H](C(=O)N1)NC(=O)[C@H](N)CC=1C=C2C=CC=CC2=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(N)=O)=O)C(C)C)C1=CC=C(O)C=C1.C([C@H]1C(=O)N[C@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(N[C@@H](CSSC[C@@H](C(=O)N1)NC(=O)[C@H](N)CC=1C=C2C=CC=CC2=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(N)=O)=O)C(C)C)C1=CC=C(O)C=C1 RUGAHXUZHWYHNG-NLGNTGLNSA-N 0.000 description 3
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin-C1 Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 3
- 230000003213 activating effect Effects 0.000 description 3
- 208000011589 adenoviridae infectious disease Diseases 0.000 description 3
- 150000001408 amides Chemical class 0.000 description 3
- 235000001014 amino acid Nutrition 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- 230000005809 anti-tumor immunity Effects 0.000 description 3
- GOLCXWYRSKYTSP-UHFFFAOYSA-N arsenic trioxide Inorganic materials O1[As]2O[As]1O2 GOLCXWYRSKYTSP-UHFFFAOYSA-N 0.000 description 3
- 229960003005 axitinib Drugs 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- 229960000397 bevacizumab Drugs 0.000 description 3
- 229960001467 bortezomib Drugs 0.000 description 3
- 229960003736 bosutinib Drugs 0.000 description 3
- UBPYILGKFZZVDX-UHFFFAOYSA-N bosutinib Chemical compound C1=C(Cl)C(OC)=CC(NC=2C3=CC(OC)=C(OCCCN4CCN(C)CC4)C=C3N=CC=2C#N)=C1Cl UBPYILGKFZZVDX-UHFFFAOYSA-N 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 229960002092 busulfan Drugs 0.000 description 3
- BMQGVNUXMIRLCK-OAGWZNDDSA-N cabazitaxel Chemical compound O([C@H]1[C@@H]2[C@]3(OC(C)=O)CO[C@@H]3C[C@@H]([C@]2(C(=O)[C@H](OC)C2=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=3C=CC=CC=3)C[C@]1(O)C2(C)C)C)OC)C(=O)C1=CC=CC=C1 BMQGVNUXMIRLCK-OAGWZNDDSA-N 0.000 description 3
- 229960001573 cabazitaxel Drugs 0.000 description 3
- 229960004562 carboplatin Drugs 0.000 description 3
- 229960002438 carfilzomib Drugs 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 229960002436 cladribine Drugs 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 229960000928 clofarabine Drugs 0.000 description 3
- WDDPHFBMKLOVOX-AYQXTPAHSA-N clofarabine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1F WDDPHFBMKLOVOX-AYQXTPAHSA-N 0.000 description 3
- 229940094488 cytarabine liposome Drugs 0.000 description 3
- 229960002448 dasatinib Drugs 0.000 description 3
- 238000006731 degradation reaction Methods 0.000 description 3
- 230000002939 deleterious effect Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 239000008121 dextrose Substances 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- WXCXUHSOUPDCQV-UHFFFAOYSA-N enzalutamide Chemical compound C1=C(F)C(C(=O)NC)=CC=C1N1C(C)(C)C(=O)N(C=2C=C(C(C#N)=CC=2)C(F)(F)F)C1=S WXCXUHSOUPDCQV-UHFFFAOYSA-N 0.000 description 3
- 210000002919 epithelial cell Anatomy 0.000 description 3
- QAMYWGZHLCQOOJ-WRNBYXCMSA-N eribulin mesylate Chemical compound CS(O)(=O)=O.C([C@H]1CC[C@@H]2O[C@@H]3[C@H]4O[C@@H]5C[C@](O[C@H]4[C@H]2O1)(O[C@@H]53)CC[C@@H]1O[C@H](C(C1)=C)CC1)C(=O)C[C@@H]2[C@@H](OC)[C@@H](C[C@H](O)CN)O[C@H]2C[C@@H]2C(=C)[C@H](C)C[C@H]1O2 QAMYWGZHLCQOOJ-WRNBYXCMSA-N 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- 229960005144 gemcitabine hydrochloride Drugs 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 238000003306 harvesting Methods 0.000 description 3
- 229960001438 immunostimulant agent Drugs 0.000 description 3
- 239000003022 immunostimulating agent Substances 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 238000011081 inoculation Methods 0.000 description 3
- FABUFPQFXZVHFB-PVYNADRNSA-N ixabepilone Chemical compound C/C([C@@H]1C[C@@H]2O[C@]2(C)CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)N1)O)C)=C\C1=CSC(C)=N1 FABUFPQFXZVHFB-PVYNADRNSA-N 0.000 description 3
- 108010021336 lanreotide Proteins 0.000 description 3
- 229960001739 lanreotide acetate Drugs 0.000 description 3
- 229960004891 lapatinib Drugs 0.000 description 3
- 229960004942 lenalidomide Drugs 0.000 description 3
- 229960003881 letrozole Drugs 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 201000005202 lung cancer Diseases 0.000 description 3
- 238000007726 management method Methods 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 229960002514 melphalan hydrochloride Drugs 0.000 description 3
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 3
- 229960001428 mercaptopurine Drugs 0.000 description 3
- 230000001394 metastastic effect Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 239000002105 nanoparticle Substances 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 229960000572 olaparib Drugs 0.000 description 3
- FAQDUNYVKQKNLD-UHFFFAOYSA-N olaparib Chemical compound FC1=CC=C(CC2=C3[CH]C=CC=C3C(=O)N=N2)C=C1C(=O)N(CC1)CCN1C(=O)C1CC1 FAQDUNYVKQKNLD-UHFFFAOYSA-N 0.000 description 3
- OLDRWYVIKMSFFB-SSPJITILSA-N palonosetron hydrochloride Chemical compound Cl.C1N(CC2)CCC2[C@@H]1N1C(=O)C(C=CC=C2CCC3)=C2[C@H]3C1 OLDRWYVIKMSFFB-SSPJITILSA-N 0.000 description 3
- 229960001972 panitumumab Drugs 0.000 description 3
- 238000007911 parenteral administration Methods 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 229960000688 pomalidomide Drugs 0.000 description 3
- UVSMNLNDYGZFPF-UHFFFAOYSA-N pomalidomide Chemical compound O=C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O UVSMNLNDYGZFPF-UHFFFAOYSA-N 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 108090000765 processed proteins & peptides Proteins 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 229960004604 propranolol hydrochloride Drugs 0.000 description 3
- AQHHHDLHHXJYJD-UHFFFAOYSA-N propranolol hydrochloride Natural products C1=CC=C2C(OCC(O)CNC(C)C)=CC=CC2=C1 AQHHHDLHHXJYJD-UHFFFAOYSA-N 0.000 description 3
- 229960002119 raloxifene hydrochloride Drugs 0.000 description 3
- BKXVVCILCIUCLG-UHFFFAOYSA-N raloxifene hydrochloride Chemical compound [H+].[Cl-].C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 BKXVVCILCIUCLG-UHFFFAOYSA-N 0.000 description 3
- 229960003452 romidepsin Drugs 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 239000007921 spray Substances 0.000 description 3
- 238000010186 staining Methods 0.000 description 3
- 239000007929 subcutaneous injection Substances 0.000 description 3
- 238000010254 subcutaneous injection Methods 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 230000002195 synergetic effect Effects 0.000 description 3
- 229960004964 temozolomide Drugs 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 229940031351 tetravalent vaccine Drugs 0.000 description 3
- 239000002562 thickening agent Substances 0.000 description 3
- 230000002103 transcriptional effect Effects 0.000 description 3
- 229960000575 trastuzumab Drugs 0.000 description 3
- 229960003498 uridine triacetate Drugs 0.000 description 3
- LFOHPKKMDYSRLY-UHFFFAOYSA-N uridine triacetate Natural products CC(=O)OCC1OC(CN2C=CC(=O)NC2=O)C(OC(=O)C)C1OC(=O)C LFOHPKKMDYSRLY-UHFFFAOYSA-N 0.000 description 3
- 229940034332 vincristine sulfate liposome Drugs 0.000 description 3
- QBADKJRRVGKRHP-JLXQGRKUSA-N (3as)-2-[(3s)-1-azabicyclo[2.2.2]octan-3-yl]-3a,4,5,6-tetrahydro-3h-benzo[de]isoquinolin-1-one;2-[3,5-bis(trifluoromethyl)phenyl]-n,2-dimethyl-n-[6-(4-methylpiperazin-1-yl)-4-[(3z)-penta-1,3-dien-3-yl]pyridin-3-yl]propanamide Chemical compound C1N(CC2)CCC2[C@@H]1N1C(=O)C(C=CC=C2CCC3)=C2[C@H]3C1.C\C=C(\C=C)C1=CC(N2CCN(C)CC2)=NC=C1N(C)C(=O)C(C)(C)C1=CC(C(F)(F)F)=CC(C(F)(F)F)=C1 QBADKJRRVGKRHP-JLXQGRKUSA-N 0.000 description 2
- IFGIYSGOEZJNBE-LHJYHSJWSA-N (3s,4r,4as,7ar,12bs)-3-(cyclopropylmethyl)-4a,9-dihydroxy-3-methyl-2,4,5,6,7a,13-hexahydro-1h-4,12-methanobenzofuro[3,2-e]isoquinoline-3-ium-7-one;bromide Chemical compound [Br-].C([N@@+]1(C)[C@@H]2CC=3C4=C(C(=CC=3)O)O[C@@H]3[C@]4([C@@]2(O)CCC3=O)CC1)C1CC1 IFGIYSGOEZJNBE-LHJYHSJWSA-N 0.000 description 2
- MWWSFMDVAYGXBV-FGBSZODSSA-N (7s,9s)-7-[(2r,4s,5r,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydron;chloride Chemical compound Cl.O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 MWWSFMDVAYGXBV-FGBSZODSSA-N 0.000 description 2
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 2
- LKJPYSCBVHEWIU-KRWDZBQOSA-N (R)-bicalutamide Chemical compound C([C@@](O)(C)C(=O)NC=1C=C(C(C#N)=CC=1)C(F)(F)F)S(=O)(=O)C1=CC=C(F)C=C1 LKJPYSCBVHEWIU-KRWDZBQOSA-N 0.000 description 2
- RTHCYVBBDHJXIQ-MRXNPFEDSA-N (R)-fluoxetine Chemical compound O([C@H](CCNC)C=1C=CC=CC=1)C1=CC=C(C(F)(F)F)C=C1 RTHCYVBBDHJXIQ-MRXNPFEDSA-N 0.000 description 2
- HJTAZXHBEBIQQX-UHFFFAOYSA-N 1,5-bis(chloromethyl)naphthalene Chemical compound C1=CC=C2C(CCl)=CC=CC2=C1CCl HJTAZXHBEBIQQX-UHFFFAOYSA-N 0.000 description 2
- PNDPGZBMCMUPRI-HVTJNCQCSA-N 10043-66-0 Chemical compound [131I][131I] PNDPGZBMCMUPRI-HVTJNCQCSA-N 0.000 description 2
- 238000011714 129 mouse Methods 0.000 description 2
- ZHSKUOZOLHMKEA-UHFFFAOYSA-N 4-[5-[bis(2-chloroethyl)amino]-1-methylbenzimidazol-2-yl]butanoic acid;hydron;chloride Chemical compound Cl.ClCCN(CCCl)C1=CC=C2N(C)C(CCCC(O)=O)=NC2=C1 ZHSKUOZOLHMKEA-UHFFFAOYSA-N 0.000 description 2
- XAUDJQYHKZQPEU-KVQBGUIXSA-N 5-aza-2'-deoxycytidine Chemical compound O=C1N=C(N)N=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 XAUDJQYHKZQPEU-KVQBGUIXSA-N 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- RHXHGRAEPCAFML-UHFFFAOYSA-N 7-cyclopentyl-n,n-dimethyl-2-[(5-piperazin-1-ylpyridin-2-yl)amino]pyrrolo[2,3-d]pyrimidine-6-carboxamide Chemical compound N1=C2N(C3CCCC3)C(C(=O)N(C)C)=CC2=CN=C1NC(N=C1)=CC=C1N1CCNCC1 RHXHGRAEPCAFML-UHFFFAOYSA-N 0.000 description 2
- 102000015790 Asparaginase Human genes 0.000 description 2
- 108010024976 Asparaginase Proteins 0.000 description 2
- 241000711404 Avian avulavirus 1 Species 0.000 description 2
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 2
- 108010006303 Carboxypeptidases Proteins 0.000 description 2
- 102000005367 Carboxypeptidases Human genes 0.000 description 2
- 238000011510 Elispot assay Methods 0.000 description 2
- HKVAMNSJSFKALM-GKUWKFKPSA-N Everolimus Chemical compound C1C[C@@H](OCCO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 HKVAMNSJSFKALM-GKUWKFKPSA-N 0.000 description 2
- VWUXBMIQPBEWFH-WCCTWKNTSA-N Fulvestrant Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3[C@H](CCCCCCCCCS(=O)CCCC(F)(F)C(F)(F)F)CC2=C1 VWUXBMIQPBEWFH-WCCTWKNTSA-N 0.000 description 2
- 101000585728 Homo sapiens Protein O-GlcNAcase Proteins 0.000 description 2
- 241000598171 Human adenovirus sp. Species 0.000 description 2
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 2
- 108010078049 Interferon alpha-2 Proteins 0.000 description 2
- 102100026688 Interferon epsilon Human genes 0.000 description 2
- 101710147309 Interferon epsilon Proteins 0.000 description 2
- 108090000467 Interferon-beta Proteins 0.000 description 2
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 2
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 2
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 229930192392 Mitomycin Natural products 0.000 description 2
- 101000868216 Mus musculus CD40 ligand Proteins 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- 229940044665 STING agonist Drugs 0.000 description 2
- 206010070834 Sensitisation Diseases 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 2
- 230000006044 T cell activation Effects 0.000 description 2
- 230000006052 T cell proliferation Effects 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- CBPNZQVSJQDFBE-FUXHJELOSA-N Temsirolimus Chemical compound C1C[C@@H](OC(=O)C(C)(CO)CO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 CBPNZQVSJQDFBE-FUXHJELOSA-N 0.000 description 2
- 101710165474 Tumor necrosis factor receptor superfamily member 5 Proteins 0.000 description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 2
- 241000700618 Vaccinia virus Species 0.000 description 2
- 108020005202 Viral DNA Proteins 0.000 description 2
- 229950001573 abemaciclib Drugs 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 229930183665 actinomycin Natural products 0.000 description 2
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 230000002411 adverse Effects 0.000 description 2
- 239000000556 agonist Substances 0.000 description 2
- 230000001270 agonistic effect Effects 0.000 description 2
- 229960000548 alemtuzumab Drugs 0.000 description 2
- 230000001668 ameliorated effect Effects 0.000 description 2
- 239000004599 antimicrobial Substances 0.000 description 2
- 230000005975 antitumor immune response Effects 0.000 description 2
- 229960003272 asparaginase Drugs 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 2
- 229960003094 belinostat Drugs 0.000 description 2
- NCNRHFGMJRPRSK-MDZDMXLPSA-N belinostat Chemical compound ONC(=O)\C=C\C1=CC=CC(S(=O)(=O)NC=2C=CC=CC=2)=C1 NCNRHFGMJRPRSK-MDZDMXLPSA-N 0.000 description 2
- 229960001215 bendamustine hydrochloride Drugs 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 229960000997 bicalutamide Drugs 0.000 description 2
- 229940031416 bivalent vaccine Drugs 0.000 description 2
- KVUAALJSMIVURS-ZEDZUCNESA-L calcium folinate Chemical compound [Ca+2].C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC([O-])=O)C([O-])=O)C=C1 KVUAALJSMIVURS-ZEDZUCNESA-L 0.000 description 2
- 235000008207 calcium folinate Nutrition 0.000 description 2
- 239000011687 calcium folinate Substances 0.000 description 2
- 238000002619 cancer immunotherapy Methods 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 230000001276 controlling effect Effects 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 229960003901 dacarbazine Drugs 0.000 description 2
- 229960000975 daunorubicin Drugs 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 229960003603 decitabine Drugs 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 108010017271 denileukin diftitox Proteins 0.000 description 2
- 229960004102 dexrazoxane hydrochloride Drugs 0.000 description 2
- BIFMNMPSIYHKDN-FJXQXJEOSA-N dexrazoxane hydrochloride Chemical compound [H+].[Cl-].C([C@H](C)N1CC(=O)NC(=O)C1)N1CC(=O)NC(=O)C1 BIFMNMPSIYHKDN-FJXQXJEOSA-N 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- ADEBPBSSDYVVLD-UHFFFAOYSA-N donepezil Chemical compound O=C1C=2C=C(OC)C(OC)=CC=2CC1CC(CC1)CCN1CC1=CC=CC=C1 ADEBPBSSDYVVLD-UHFFFAOYSA-N 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 229950009791 durvalumab Drugs 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 229960004671 enzalutamide Drugs 0.000 description 2
- 229960003265 epirubicin hydrochloride Drugs 0.000 description 2
- 229960000439 eribulin mesylate Drugs 0.000 description 2
- 229960005420 etoposide Drugs 0.000 description 2
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 2
- 229960005167 everolimus Drugs 0.000 description 2
- 229960005304 fludarabine phosphate Drugs 0.000 description 2
- 229940081995 fluorouracil injection Drugs 0.000 description 2
- 229960002464 fluoxetine Drugs 0.000 description 2
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 2
- 229960002258 fulvestrant Drugs 0.000 description 2
- 229960002584 gefitinib Drugs 0.000 description 2
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 2
- 229960005277 gemcitabine Drugs 0.000 description 2
- 229960000578 gemtuzumab Drugs 0.000 description 2
- 229960003297 gemtuzumab ozogamicin Drugs 0.000 description 2
- 201000010536 head and neck cancer Diseases 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- HYFHYPWGAURHIV-UHFFFAOYSA-N homoharringtonine Natural products C1=C2CCN3CCCC43C=C(OC)C(OC(=O)C(O)(CCCC(C)(C)O)CC(=O)OC)C4C2=CC2=C1OCO2 HYFHYPWGAURHIV-UHFFFAOYSA-N 0.000 description 2
- 102000054261 human IFNAR1 Human genes 0.000 description 2
- 102000046319 human OGA Human genes 0.000 description 2
- 229940101556 human hyaluronidase Drugs 0.000 description 2
- 229960001330 hydroxycarbamide Drugs 0.000 description 2
- 229960001176 idarubicin hydrochloride Drugs 0.000 description 2
- 229940090411 ifex Drugs 0.000 description 2
- 229960003685 imatinib mesylate Drugs 0.000 description 2
- YLMAHDNUQAMNNX-UHFFFAOYSA-N imatinib methanesulfonate Chemical compound CS(O)(=O)=O.C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 YLMAHDNUQAMNNX-UHFFFAOYSA-N 0.000 description 2
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 2
- 229960002751 imiquimod Drugs 0.000 description 2
- 230000005746 immune checkpoint blockade Effects 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 230000008595 infiltration Effects 0.000 description 2
- 238000001764 infiltration Methods 0.000 description 2
- 229950004101 inotuzumab ozogamicin Drugs 0.000 description 2
- 239000007927 intramuscular injection Substances 0.000 description 2
- 238000010255 intramuscular injection Methods 0.000 description 2
- 239000007928 intraperitoneal injection Substances 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 229960004768 irinotecan Drugs 0.000 description 2
- 229960000779 irinotecan hydrochloride Drugs 0.000 description 2
- 229940048117 irinotecan hydrochloride liposome Drugs 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 229960002014 ixabepilone Drugs 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 229940087857 lupron Drugs 0.000 description 2
- 229940049920 malate Drugs 0.000 description 2
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 2
- BJEPYKJPYRNKOW-UHFFFAOYSA-N malic acid Chemical compound OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 2
- 230000010534 mechanism of action Effects 0.000 description 2
- 229960004961 mechlorethamine Drugs 0.000 description 2
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical class ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 2
- 229960004635 mesna Drugs 0.000 description 2
- 229960002834 methylnaltrexone bromide Drugs 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 229950010895 midostaurin Drugs 0.000 description 2
- BMGQWWVMWDBQGC-IIFHNQTCSA-N midostaurin Chemical compound CN([C@H]1[C@H]([C@]2(C)O[C@@H](N3C4=CC=CC=C4C4=C5C(=O)NCC5=C5C6=CC=CC=C6N2C5=C43)C1)OC)C(=O)C1=CC=CC=C1 BMGQWWVMWDBQGC-IIFHNQTCSA-N 0.000 description 2
- 210000001616 monocyte Anatomy 0.000 description 2
- 150000004682 monohydrates Chemical class 0.000 description 2
- UZWDCWONPYILKI-UHFFFAOYSA-N n-[5-[(4-ethylpiperazin-1-yl)methyl]pyridin-2-yl]-5-fluoro-4-(7-fluoro-2-methyl-3-propan-2-ylbenzimidazol-5-yl)pyrimidin-2-amine Chemical compound C1CN(CC)CCN1CC(C=N1)=CC=C1NC1=NC=C(F)C(C=2C=C3N(C(C)C)C(C)=NC3=C(F)C=2)=N1 UZWDCWONPYILKI-UHFFFAOYSA-N 0.000 description 2
- 210000000822 natural killer cell Anatomy 0.000 description 2
- 210000000440 neutrophil Anatomy 0.000 description 2
- NQDJXKOVJZTUJA-UHFFFAOYSA-N nevirapine Chemical compound C12=NC=CC=C2C(=O)NC=2C(C)=CC=NC=2N1C1CC1 NQDJXKOVJZTUJA-UHFFFAOYSA-N 0.000 description 2
- 239000012457 nonaqueous media Substances 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 229960002230 omacetaxine mepesuccinate Drugs 0.000 description 2
- HYFHYPWGAURHIV-JFIAXGOJSA-N omacetaxine mepesuccinate Chemical compound C1=C2CCN3CCC[C@]43C=C(OC)[C@@H](OC(=O)[C@@](O)(CCCC(C)(C)O)CC(=O)OC)[C@H]4C2=CC2=C1OCO2 HYFHYPWGAURHIV-JFIAXGOJSA-N 0.000 description 2
- 201000002528 pancreatic cancer Diseases 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- 229960005184 panobinostat Drugs 0.000 description 2
- FPOHNWQLNRZRFC-ZHACJKMWSA-N panobinostat Chemical compound CC=1NC2=CC=CC=C2C=1CCNCC1=CC=C(\C=C\C(=O)NO)C=C1 FPOHNWQLNRZRFC-ZHACJKMWSA-N 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 229960005492 pazopanib hydrochloride Drugs 0.000 description 2
- MQHIQUBXFFAOMK-UHFFFAOYSA-N pazopanib hydrochloride Chemical compound Cl.C1=CC2=C(C)N(C)N=C2C=C1N(C)C(N=1)=CC=NC=1NC1=CC=C(C)C(S(N)(=O)=O)=C1 MQHIQUBXFFAOMK-UHFFFAOYSA-N 0.000 description 2
- 210000005259 peripheral blood Anatomy 0.000 description 2
- 239000011886 peripheral blood Substances 0.000 description 2
- 229960002087 pertuzumab Drugs 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 229960004618 prednisone Drugs 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 229940021993 prophylactic vaccine Drugs 0.000 description 2
- 229950010131 puromycin Drugs 0.000 description 2
- 230000005855 radiation Effects 0.000 description 2
- 229940092814 radium (223ra) dichloride Drugs 0.000 description 2
- 229960004622 raloxifene Drugs 0.000 description 2
- GZUITABIAKMVPG-UHFFFAOYSA-N raloxifene Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 GZUITABIAKMVPG-UHFFFAOYSA-N 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 229950003687 ribociclib Drugs 0.000 description 2
- 230000008313 sensitization Effects 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- IVDHYUQIDRJSTI-UHFFFAOYSA-N sorafenib tosylate Chemical compound [H+].CC1=CC=C(S([O-])(=O)=O)C=C1.C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 IVDHYUQIDRJSTI-UHFFFAOYSA-N 0.000 description 2
- 229960000487 sorafenib tosylate Drugs 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 229960001796 sunitinib Drugs 0.000 description 2
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000012730 sustained-release form Substances 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 229940044655 toll-like receptor 9 agonist Drugs 0.000 description 2
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 2
- 229960002190 topotecan hydrochloride Drugs 0.000 description 2
- XFCLJVABOIYOMF-QPLCGJKRSA-N toremifene Chemical compound C1=CC(OCCN(C)C)=CC=C1C(\C=1C=CC=CC=1)=C(\CCCl)C1=CC=CC=C1 XFCLJVABOIYOMF-QPLCGJKRSA-N 0.000 description 2
- 229960005026 toremifene Drugs 0.000 description 2
- LIRYPHYGHXZJBZ-UHFFFAOYSA-N trametinib Chemical compound CC(=O)NC1=CC=CC(N2C(N(C3CC3)C(=O)C3=C(NC=4C(=CC(I)=CC=4)F)N(C)C(=O)C(C)=C32)=O)=C1 LIRYPHYGHXZJBZ-UHFFFAOYSA-N 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- 238000011269 treatment regimen Methods 0.000 description 2
- 241001529453 unidentified herpesvirus Species 0.000 description 2
- LQBVNQSMGBZMKD-UHFFFAOYSA-N venetoclax Chemical compound C=1C=C(Cl)C=CC=1C=1CC(C)(C)CCC=1CN(CC1)CCN1C(C=C1OC=2C=C3C=CNC3=NC=2)=CC=C1C(=O)NS(=O)(=O)C(C=C1[N+]([O-])=O)=CC=C1NCC1CCOCC1 LQBVNQSMGBZMKD-UHFFFAOYSA-N 0.000 description 2
- 229960001183 venetoclax Drugs 0.000 description 2
- 229960002166 vinorelbine tartrate Drugs 0.000 description 2
- GBABOYUKABKIAF-IWWDSPBFSA-N vinorelbinetartrate Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC(C23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-IWWDSPBFSA-N 0.000 description 2
- 230000029812 viral genome replication Effects 0.000 description 2
- BMKDZUISNHGIBY-ZETCQYMHSA-N (+)-dexrazoxane Chemical compound C([C@H](C)N1CC(=O)NC(=O)C1)N1CC(=O)NC(=O)C1 BMKDZUISNHGIBY-ZETCQYMHSA-N 0.000 description 1
- BOVGTQGAOIONJV-BETUJISGSA-N 1-[(3ar,6as)-3,3a,4,5,6,6a-hexahydro-1h-cyclopenta[c]pyrrol-2-yl]-3-(4-methylphenyl)sulfonylurea Chemical compound C1=CC(C)=CC=C1S(=O)(=O)NC(=O)NN1C[C@H]2CCC[C@H]2C1 BOVGTQGAOIONJV-BETUJISGSA-N 0.000 description 1
- JBSWLQWGIZUKCI-UHFFFAOYSA-N 1-benzyl-1-methylhydrazine;hydrochloride Chemical compound Cl.CN(N)CC1=CC=CC=C1 JBSWLQWGIZUKCI-UHFFFAOYSA-N 0.000 description 1
- HDCUSMZVZWLDRZ-UHFFFAOYSA-N 1-benzyl-2-methylhydrazine Chemical compound CNNCC1=CC=CC=C1 HDCUSMZVZWLDRZ-UHFFFAOYSA-N 0.000 description 1
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- RFHAOTPXVQNOHP-UHFFFAOYSA-O 2-(2,4-difluorophenyl)-1-(1h-1,2,4-triazol-2-ium-2-yl)-3-(1,2,4-triazol-1-yl)propan-2-ol Chemical compound C([C@](O)(C[N+]=1NC=NC=1)C=1C(=CC(F)=CC=1)F)N1C=NC=N1 RFHAOTPXVQNOHP-UHFFFAOYSA-O 0.000 description 1
- RTQWWZBSTRGEAV-PKHIMPSTSA-N 2-[[(2s)-2-[bis(carboxymethyl)amino]-3-[4-(methylcarbamoylamino)phenyl]propyl]-[2-[bis(carboxymethyl)amino]propyl]amino]acetic acid Chemical compound CNC(=O)NC1=CC=C(C[C@@H](CN(CC(C)N(CC(O)=O)CC(O)=O)CC(O)=O)N(CC(O)=O)CC(O)=O)C=C1 RTQWWZBSTRGEAV-PKHIMPSTSA-N 0.000 description 1
- VOXBZHOHGGBLCQ-UHFFFAOYSA-N 2-amino-3,7-dihydropurine-6-thione;hydrate Chemical compound O.N1C(N)=NC(=S)C2=C1N=CN2.N1C(N)=NC(=S)C2=C1N=CN2 VOXBZHOHGGBLCQ-UHFFFAOYSA-N 0.000 description 1
- KZMAWJRXKGLWGS-UHFFFAOYSA-N 2-chloro-n-[4-(4-methoxyphenyl)-1,3-thiazol-2-yl]-n-(3-methoxypropyl)acetamide Chemical compound S1C(N(C(=O)CCl)CCCOC)=NC(C=2C=CC(OC)=CC=2)=C1 KZMAWJRXKGLWGS-UHFFFAOYSA-N 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- ZGXJTSGNIOSYLO-UHFFFAOYSA-N 88755TAZ87 Chemical compound NCC(=O)CCC(O)=O ZGXJTSGNIOSYLO-UHFFFAOYSA-N 0.000 description 1
- 239000005660 Abamectin Substances 0.000 description 1
- 241001075517 Abelmoschus Species 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 102100034540 Adenomatous polyposis coli protein Human genes 0.000 description 1
- 108010012934 Albumin-Bound Paclitaxel Proteins 0.000 description 1
- 241000710929 Alphavirus Species 0.000 description 1
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 1
- BFYIZQONLCFLEV-DAELLWKTSA-N Aromasine Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC(=C)C2=C1 BFYIZQONLCFLEV-DAELLWKTSA-N 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 102100023013 Basic leucine zipper transcriptional factor ATF-like 3 Human genes 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 101000738343 Bos taurus CD40 ligand Proteins 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 102100036301 C-C chemokine receptor type 7 Human genes 0.000 description 1
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 1
- 102000008203 CTLA-4 Antigen Human genes 0.000 description 1
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 102000005853 Clathrin Human genes 0.000 description 1
- 108010019874 Clathrin Proteins 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 229910001006 Constantan Inorganic materials 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 241000376561 Coryda Species 0.000 description 1
- 241000709687 Coxsackievirus Species 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 230000004543 DNA replication Effects 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- QXNVGIXVLWOKEQ-UHFFFAOYSA-N Disodium Chemical compound [Na][Na] QXNVGIXVLWOKEQ-UHFFFAOYSA-N 0.000 description 1
- XIQVNETUBQGFHX-UHFFFAOYSA-N Ditropan Chemical compound C=1C=CC=CC=1C(O)(C(=O)OCC#CCN(CC)CC)C1CCCCC1 XIQVNETUBQGFHX-UHFFFAOYSA-N 0.000 description 1
- XXPXYPLPSDPERN-UHFFFAOYSA-N Ecteinascidin 743 Natural products COc1cc2C(NCCc2cc1O)C(=O)OCC3N4C(O)C5Cc6cc(C)c(OC)c(O)c6C(C4C(S)c7c(OC(=O)C)c(C)c8OCOc8c37)N5C XXPXYPLPSDPERN-UHFFFAOYSA-N 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 241000709661 Enterovirus Species 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 241001379910 Ephemera danica Species 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- ULGZDMOVFRHVEP-RWJQBGPGSA-N Erythromycin Natural products O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ULGZDMOVFRHVEP-RWJQBGPGSA-N 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- 208000001382 Experimental Melanoma Diseases 0.000 description 1
- PMVSDNDAUGGCCE-TYYBGVCCSA-L Ferrous fumarate Chemical compound [Fe+2].[O-]C(=O)\C=C\C([O-])=O PMVSDNDAUGGCCE-TYYBGVCCSA-L 0.000 description 1
- 229940032072 GVAX vaccine Drugs 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- 102000050627 Glucocorticoid-Induced TNFR-Related Human genes 0.000 description 1
- 108010069236 Goserelin Proteins 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000924577 Homo sapiens Adenomatous polyposis coli protein Proteins 0.000 description 1
- 101000903609 Homo sapiens Basic leucine zipper transcriptional factor ATF-like 3 Proteins 0.000 description 1
- 101000716065 Homo sapiens C-C chemokine receptor type 7 Proteins 0.000 description 1
- 101100059511 Homo sapiens CD40LG gene Proteins 0.000 description 1
- 241001135569 Human adenovirus 5 Species 0.000 description 1
- 108010003272 Hyaluronate lyase Proteins 0.000 description 1
- 102000009066 Hyaluronoglucosaminidase Human genes 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 108010014726 Interferon Type I Proteins 0.000 description 1
- 102000002227 Interferon Type I Human genes 0.000 description 1
- 102100040018 Interferon alpha-2 Human genes 0.000 description 1
- 102100026720 Interferon beta Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010079944 Interferon-alpha2b Proteins 0.000 description 1
- 102000003996 Interferon-beta Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 102000014158 Interleukin-12 Subunit p40 Human genes 0.000 description 1
- 108010011429 Interleukin-12 Subunit p40 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 238000010824 Kaplan-Meier survival analysis Methods 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 239000005536 L01XE08 - Nilotinib Substances 0.000 description 1
- 239000003798 L01XE11 - Pazopanib Substances 0.000 description 1
- 239000002118 L01XE12 - Vandetanib Substances 0.000 description 1
- 239000002146 L01XE16 - Crizotinib Substances 0.000 description 1
- 239000002137 L01XE24 - Ponatinib Substances 0.000 description 1
- 239000002177 L01XE27 - Ibrutinib Substances 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- 241000940612 Medina Species 0.000 description 1
- 206010027458 Metastases to lung Diseases 0.000 description 1
- 206010027480 Metastatic malignant melanoma Diseases 0.000 description 1
- 101100018862 Mus musculus Ifnar1 gene Proteins 0.000 description 1
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 239000012270 PD-1 inhibitor Substances 0.000 description 1
- 239000012668 PD-1-inhibitor Substances 0.000 description 1
- 241000709664 Picornaviridae Species 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 241000125945 Protoparvovirus Species 0.000 description 1
- 238000003559 RNA-seq method Methods 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 239000008156 Ringer's lactate solution Substances 0.000 description 1
- 241000837158 Senecavirus A Species 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 206010042971 T-cell lymphoma Diseases 0.000 description 1
- NAVMQTYZDKMPEU-UHFFFAOYSA-N Targretin Chemical compound CC1=CC(C(CCC2(C)C)(C)C)=C2C=C1C(=C)C1=CC=C(C(O)=O)C=C1 NAVMQTYZDKMPEU-UHFFFAOYSA-N 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- ZMZDMBWJUHKJPS-UHFFFAOYSA-M Thiocyanate anion Chemical compound [S-]C#N ZMZDMBWJUHKJPS-UHFFFAOYSA-M 0.000 description 1
- GLNADSQYFUSGOU-GPTZEZBUSA-J Trypan blue Chemical compound [Na+].[Na+].[Na+].[Na+].C1=C(S([O-])(=O)=O)C=C2C=C(S([O-])(=O)=O)C(/N=N/C3=CC=C(C=C3C)C=3C=C(C(=CC=3)\N=N\C=3C(=CC4=CC(=CC(N)=C4C=3O)S([O-])(=O)=O)S([O-])(=O)=O)C)=C(O)C2=C1N GLNADSQYFUSGOU-GPTZEZBUSA-J 0.000 description 1
- 238000010162 Tukey test Methods 0.000 description 1
- 102000015098 Tumor Suppressor Protein p53 Human genes 0.000 description 1
- 108010078814 Tumor Suppressor Protein p53 Proteins 0.000 description 1
- 101710187882 Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- XTXRWKRVRITETP-UHFFFAOYSA-N Vinyl acetate Chemical compound CC(=O)OC=C XTXRWKRVRITETP-UHFFFAOYSA-N 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 229930003270 Vitamin B Natural products 0.000 description 1
- ZZXDRXVIRVJQBT-UHFFFAOYSA-M Xylenesulfonate Chemical compound CC1=CC=CC(S([O-])(=O)=O)=C1C ZZXDRXVIRVJQBT-UHFFFAOYSA-M 0.000 description 1
- ZSTCHQOKNUXHLZ-PIRIXANTSA-L [(1r,2r)-2-azanidylcyclohexyl]azanide;oxalate;pentyl n-[1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-methyloxolan-2-yl]-5-fluoro-2-oxopyrimidin-4-yl]carbamate;platinum(4+) Chemical compound [Pt+4].[O-]C(=O)C([O-])=O.[NH-][C@@H]1CCCC[C@H]1[NH-].C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 ZSTCHQOKNUXHLZ-PIRIXANTSA-L 0.000 description 1
- JNWFIPVDEINBAI-UHFFFAOYSA-N [5-hydroxy-4-[4-(1-methylindol-5-yl)-5-oxo-1H-1,2,4-triazol-3-yl]-2-propan-2-ylphenyl] dihydrogen phosphate Chemical compound C1=C(OP(O)(O)=O)C(C(C)C)=CC(C=2N(C(=O)NN=2)C=2C=C3C=CN(C)C3=CC=2)=C1O JNWFIPVDEINBAI-UHFFFAOYSA-N 0.000 description 1
- UVIQSJCZCSLXRZ-UBUQANBQSA-N abiraterone acetate Chemical compound C([C@@H]1[C@]2(C)CC[C@@H]3[C@@]4(C)CC[C@@H](CC4=CC[C@H]31)OC(=O)C)C=C2C1=CC=CN=C1 UVIQSJCZCSLXRZ-UBUQANBQSA-N 0.000 description 1
- 229960004103 abiraterone acetate Drugs 0.000 description 1
- 108010052004 acetyl-2-naphthylalanyl-3-chlorophenylalanyl-1-oxohexadecyl-seryl-4-aminophenylalanyl(hydroorotyl)-4-aminophenylalanyl(carbamoyl)-leucyl-ILys-prolyl-alaninamide Proteins 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 230000003044 adaptive effect Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 108010081667 aflibercept Proteins 0.000 description 1
- 108700025316 aldesleukin Proteins 0.000 description 1
- 229960005310 aldesleukin Drugs 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 229960001097 amifostine Drugs 0.000 description 1
- JKOQGQFVAUAYPM-UHFFFAOYSA-N amifostine Chemical compound NCCCNCCSP(O)(O)=O JKOQGQFVAUAYPM-UHFFFAOYSA-N 0.000 description 1
- 229960002749 aminolevulinic acid Drugs 0.000 description 1
- 239000000908 ammonium hydroxide Substances 0.000 description 1
- 229940035674 anesthetics Drugs 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 230000006023 anti-tumor response Effects 0.000 description 1
- 238000011319 anticancer therapy Methods 0.000 description 1
- 230000014102 antigen processing and presentation of exogenous peptide antigen via MHC class I Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- ATALOFNDEOCMKK-OITMNORJSA-N aprepitant Chemical compound O([C@@H]([C@@H]1C=2C=CC(F)=CC=2)O[C@H](C)C=2C=C(C=C(C=2)C(F)(F)F)C(F)(F)F)CCN1CC1=NNC(=O)N1 ATALOFNDEOCMKK-OITMNORJSA-N 0.000 description 1
- 229960001372 aprepitant Drugs 0.000 description 1
- 239000008365 aqueous carrier Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 150000004982 aromatic amines Chemical class 0.000 description 1
- 229940120638 avastin Drugs 0.000 description 1
- 229950002916 avelumab Drugs 0.000 description 1
- RRZXIRBKKLTSOM-XPNPUAGNSA-N avermectin B1a Chemical compound C1=C[C@H](C)[C@@H]([C@@H](C)CC)O[C@]11O[C@H](C\C=C(C)\[C@@H](O[C@@H]2O[C@@H](C)[C@H](O[C@@H]3O[C@@H](C)[C@H](O)[C@@H](OC)C3)[C@@H](OC)C2)[C@@H](C)\C=C\C=C/2[C@]3([C@H](C(=O)O4)C=C(C)[C@@H](O)[C@H]3OC\2)O)C[C@H]4C1 RRZXIRBKKLTSOM-XPNPUAGNSA-N 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- FUKOGSUFTZDYOI-BMANNDLBSA-O beacopp protocol Chemical compound ClCCN(CCCl)P1(=O)NCCCO1.CNNCC1=CC=C(C(=O)NC(C)C)C=C1.O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1.O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1.COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3C(O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1.C([C@H](C[C@]1(C(=O)OC)C=2C(=C3C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C=O)=CC=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21.N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)C(O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C FUKOGSUFTZDYOI-BMANNDLBSA-O 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 229960002707 bendamustine Drugs 0.000 description 1
- YTKUWDBFDASYHO-UHFFFAOYSA-N bendamustine Chemical compound ClCCN(CCCl)C1=CC=C2N(C)C(CCCC(O)=O)=NC2=C1 YTKUWDBFDASYHO-UHFFFAOYSA-N 0.000 description 1
- MMIMIFULGMZVPO-UHFFFAOYSA-N benzyl 3-bromo-2,6-dinitro-5-phenylmethoxybenzoate Chemical compound [O-][N+](=O)C1=C(C(=O)OCC=2C=CC=CC=2)C([N+](=O)[O-])=C(Br)C=C1OCC1=CC=CC=C1 MMIMIFULGMZVPO-UHFFFAOYSA-N 0.000 description 1
- 229960002938 bexarotene Drugs 0.000 description 1
- 229940108502 bicnu Drugs 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 210000002798 bone marrow cell Anatomy 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- KQNZDYYTLMIZCT-KQPMLPITSA-N brefeldin A Chemical compound O[C@@H]1\C=C\C(=O)O[C@@H](C)CCC\C=C\[C@@H]2C[C@H](O)C[C@H]21 KQNZDYYTLMIZCT-KQPMLPITSA-N 0.000 description 1
- JUMGSHROWPPKFX-UHFFFAOYSA-N brefeldin-A Natural products CC1CCCC=CC2(C)CC(O)CC2(C)C(O)C=CC(=O)O1 JUMGSHROWPPKFX-UHFFFAOYSA-N 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- PGMBSCDPACPRSG-SCSDYSBLSA-N capiri Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1.C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 PGMBSCDPACPRSG-SCSDYSBLSA-N 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- IQXIUTMSTALSFW-VJFOLWCZSA-N carboplatin paclitaxel Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1.O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 IQXIUTMSTALSFW-VJFOLWCZSA-N 0.000 description 1
- 230000001364 causal effect Effects 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000009134 cell regulation Effects 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 230000007969 cellular immunity Effects 0.000 description 1
- 230000007248 cellular mechanism Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 229960001602 ceritinib Drugs 0.000 description 1
- WRXDGGCKOUEOPW-UHFFFAOYSA-N ceritinib Chemical compound CC=1C=C(NC=2N=C(NC=3C(=CC=CC=3)NS(=O)(=O)C(C)C)C(Cl)=CN=2)C(OC(C)C)=CC=1C1CCNCC1 WRXDGGCKOUEOPW-UHFFFAOYSA-N 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- DERZBLKQOCDDDZ-JLHYYAGUSA-N cinnarizine Chemical compound C1CN(C(C=2C=CC=CC=2)C=2C=CC=CC=2)CCN1C\C=C\C1=CC=CC=C1 DERZBLKQOCDDDZ-JLHYYAGUSA-N 0.000 description 1
- 229930193282 clathrin Natural products 0.000 description 1
- 210000002806 clathrin-coated vesicle Anatomy 0.000 description 1
- 238000003501 co-culture Methods 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 239000012059 conventional drug carrier Substances 0.000 description 1
- 229940088547 cosmegen Drugs 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 229960005061 crizotinib Drugs 0.000 description 1
- KTEIFNKAUNYNJU-GFCCVEGCSA-N crizotinib Chemical compound O([C@H](C)C=1C(=C(F)C=CC=1Cl)Cl)C(C(=NC=1)N)=CC=1C(=C1)C=NN1C1CCNCC1 KTEIFNKAUNYNJU-GFCCVEGCSA-N 0.000 description 1
- 230000037029 cross reaction Effects 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- IMBXRZKCLVBLBH-OGYJWPHRSA-N cvp protocol Chemical compound ClCCN(CCCl)P1(=O)NCCCO1.O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1.C([C@H](C[C@]1(C(=O)OC)C=2C(=C3C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C=O)=CC=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 IMBXRZKCLVBLBH-OGYJWPHRSA-N 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 229960002465 dabrafenib Drugs 0.000 description 1
- BFSMGDJOXZAERB-UHFFFAOYSA-N dabrafenib Chemical compound S1C(C(C)(C)C)=NC(C=2C(=C(NS(=O)(=O)C=3C(=CC=CC=3F)F)C=CC=2)F)=C1C1=CC=NC(N)=N1 BFSMGDJOXZAERB-UHFFFAOYSA-N 0.000 description 1
- 229940034085 dacarbazine injection Drugs 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- 229960002204 daratumumab Drugs 0.000 description 1
- 229940094732 darzalex Drugs 0.000 description 1
- 229940076705 defibrotide sodium Drugs 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 229940076711 defitelio Drugs 0.000 description 1
- 229960002272 degarelix Drugs 0.000 description 1
- MEUCPCLKGZSHTA-XYAYPHGZSA-N degarelix Chemical compound C([C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCNC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@H](C)C(N)=O)NC(=O)[C@H](CC=1C=CC(NC(=O)[C@H]2NC(=O)NC(=O)C2)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](CC=1C=NC=CC=1)NC(=O)[C@@H](CC=1C=CC(Cl)=CC=1)NC(=O)[C@@H](CC=1C=C2C=CC=CC2=CC=1)NC(C)=O)C1=CC=C(NC(N)=O)C=C1 MEUCPCLKGZSHTA-XYAYPHGZSA-N 0.000 description 1
- 239000007857 degradation product Substances 0.000 description 1
- 229960002923 denileukin diftitox Drugs 0.000 description 1
- 229960001251 denosumab Drugs 0.000 description 1
- 229940070968 depocyt Drugs 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 229960000605 dexrazoxane Drugs 0.000 description 1
- 125000003963 dichloro group Chemical group Cl* 0.000 description 1
- 235000015872 dietary supplement Nutrition 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 229960004497 dinutuximab Drugs 0.000 description 1
- NYDXNILOWQXUOF-UHFFFAOYSA-L disodium;2-[[4-[2-(2-amino-4-oxo-1,7-dihydropyrrolo[2,3-d]pyrimidin-5-yl)ethyl]benzoyl]amino]pentanedioate Chemical compound [Na+].[Na+].C=1NC=2NC(N)=NC(=O)C=2C=1CCC1=CC=C(C(=O)NC(CCC([O-])=O)C([O-])=O)C=C1 NYDXNILOWQXUOF-UHFFFAOYSA-L 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 229960003530 donepezil Drugs 0.000 description 1
- 229960003722 doxycycline Drugs 0.000 description 1
- XQTWDDCIUJNLTR-CVHRZJFOSA-N doxycycline monohydrate Chemical compound O.O=C1C2=C(O)C=CC=C2[C@H](C)[C@@H]2C1=C(O)[C@]1(O)C(=O)C(C(N)=O)=C(O)[C@@H](N(C)C)[C@@H]1[C@H]2O XQTWDDCIUJNLTR-CVHRZJFOSA-N 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 229940126534 drug product Drugs 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 229960004137 elotuzumab Drugs 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000002121 endocytic effect Effects 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 238000010201 enrichment analysis Methods 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- 229940082789 erbitux Drugs 0.000 description 1
- GTTBEUCJPZQMDZ-UHFFFAOYSA-N erlotinib hydrochloride Chemical compound [H+].[Cl-].C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 GTTBEUCJPZQMDZ-UHFFFAOYSA-N 0.000 description 1
- 229960005073 erlotinib hydrochloride Drugs 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 150000002169 ethanolamines Chemical class 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- LIQODXNTTZAGID-OCBXBXKTSA-N etoposide phosphate Chemical compound COC1=C(OP(O)(O)=O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 LIQODXNTTZAGID-OCBXBXKTSA-N 0.000 description 1
- 229960000752 etoposide phosphate Drugs 0.000 description 1
- 229960000255 exemestane Drugs 0.000 description 1
- 229940087476 femara Drugs 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000010408 film Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 229960000304 folic acid Drugs 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000011087 fumaric acid Nutrition 0.000 description 1
- 150000002238 fumaric acids Chemical class 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000010437 gem Substances 0.000 description 1
- 229910001751 gemstone Inorganic materials 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 239000003193 general anesthetic agent Substances 0.000 description 1
- 231100000734 genotoxic potential Toxicity 0.000 description 1
- 239000003365 glass fiber Substances 0.000 description 1
- 229960000346 gliclazide Drugs 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 108010049491 glucarpidase Proteins 0.000 description 1
- 229960003690 goserelin acetate Drugs 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 229940118951 halaven Drugs 0.000 description 1
- 201000000459 head and neck squamous cell carcinoma Diseases 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 229940022353 herceptin Drugs 0.000 description 1
- 229960002773 hyaluronidase Drugs 0.000 description 1
- ZMZDMBWJUHKJPS-UHFFFAOYSA-N hydrogen thiocyanate Natural products SC#N ZMZDMBWJUHKJPS-UHFFFAOYSA-N 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 229960001001 ibritumomab tiuxetan Drugs 0.000 description 1
- 229960001507 ibrutinib Drugs 0.000 description 1
- XYFPWWZEPKGCCK-GOSISDBHSA-N ibrutinib Chemical compound C1=2C(N)=NC=NC=2N([C@H]2CN(CCC2)C(=O)C=C)N=C1C(C=C1)=CC=C1OC1=CC=CC=C1 XYFPWWZEPKGCCK-GOSISDBHSA-N 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- 229940091204 imlygic Drugs 0.000 description 1
- 230000005934 immune activation Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 238000011532 immunohistochemical staining Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000005414 inactive ingredient Substances 0.000 description 1
- 239000011261 inert gas Substances 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 229940005319 inlyta Drugs 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 108010045648 interferon omega 1 Proteins 0.000 description 1
- 108700027921 interferon tau Proteins 0.000 description 1
- 229960001388 interferon-beta Drugs 0.000 description 1
- 230000006662 intracellular pathway Effects 0.000 description 1
- VBUWHHLIZKOSMS-RIWXPGAOSA-N invicorp Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)C(C)C)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 VBUWHHLIZKOSMS-RIWXPGAOSA-N 0.000 description 1
- PNDPGZBMCMUPRI-UHFFFAOYSA-N iodine Chemical compound II PNDPGZBMCMUPRI-UHFFFAOYSA-N 0.000 description 1
- 229960005386 ipilimumab Drugs 0.000 description 1
- KLEAIHJJLUAXIQ-JDRGBKBRSA-N irinotecan hydrochloride hydrate Chemical compound O.O.O.Cl.C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 KLEAIHJJLUAXIQ-JDRGBKBRSA-N 0.000 description 1
- 229940011083 istodax Drugs 0.000 description 1
- 229940111707 ixempra Drugs 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 229940045426 kymriah Drugs 0.000 description 1
- 229940000764 kyprolis Drugs 0.000 description 1
- 229960003784 lenvatinib Drugs 0.000 description 1
- WOSKHXYHFSIKNG-UHFFFAOYSA-N lenvatinib Chemical compound C=12C=C(C(N)=O)C(OC)=CC2=NC=CC=1OC(C=C1Cl)=CC=C1NC(=O)NC1CC1 WOSKHXYHFSIKNG-UHFFFAOYSA-N 0.000 description 1
- 229960001429 lenvatinib mesylate Drugs 0.000 description 1
- HWLFIUUAYLEFCT-UHFFFAOYSA-N lenvatinib mesylate Chemical compound CS(O)(=O)=O.C=12C=C(C(N)=O)C(OC)=CC2=NC=CC=1OC(C=C1Cl)=CC=C1NC(=O)NC1CC1 HWLFIUUAYLEFCT-UHFFFAOYSA-N 0.000 description 1
- 229960002293 leucovorin calcium Drugs 0.000 description 1
- 229940063725 leukeran Drugs 0.000 description 1
- AIHDCSAXVMAMJH-GFBKWZILSA-N levan Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)OC[C@@H]1[C@@H](O)[C@H](O)[C@](CO)(CO[C@@H]2[C@H]([C@H](O)[C@@](O)(CO)O2)O)O1 AIHDCSAXVMAMJH-GFBKWZILSA-N 0.000 description 1
- 108020001756 ligand binding domains Proteins 0.000 description 1
- TYZROVQLWOKYKF-ZDUSSCGKSA-N linezolid Chemical compound O=C1O[C@@H](CNC(=O)C)CN1C(C=C1F)=CC=C1N1CCOCC1 TYZROVQLWOKYKF-ZDUSSCGKSA-N 0.000 description 1
- 229960003907 linezolid Drugs 0.000 description 1
- 229940103064 lipodox Drugs 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 150000002689 maleic acids Chemical class 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 150000002691 malonic acids Chemical class 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- QZIQJVCYUQZDIR-UHFFFAOYSA-N mechlorethamine hydrochloride Chemical compound Cl.ClCCN(C)CCCl QZIQJVCYUQZDIR-UHFFFAOYSA-N 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 229960004296 megestrol acetate Drugs 0.000 description 1
- RQZAXGRLVPAYTJ-GQFGMJRRSA-N megestrol acetate Chemical compound C1=C(C)C2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)C)[C@@]1(C)CC2 RQZAXGRLVPAYTJ-GQFGMJRRSA-N 0.000 description 1
- 229940083118 mekinist Drugs 0.000 description 1
- YSRVJVDFHZYRPA-UHFFFAOYSA-N melem Chemical compound NC1=NC(N23)=NC(N)=NC2=NC(N)=NC3=N1 YSRVJVDFHZYRPA-UHFFFAOYSA-N 0.000 description 1
- 229940101533 mesnex Drugs 0.000 description 1
- 208000021039 metastatic melanoma Diseases 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- ZAHQPTJLOCWVPG-UHFFFAOYSA-N mitoxantrone dihydrochloride Chemical compound Cl.Cl.O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO ZAHQPTJLOCWVPG-UHFFFAOYSA-N 0.000 description 1
- 229960004169 mitoxantrone hydrochloride Drugs 0.000 description 1
- 230000009456 molecular mechanism Effects 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 229940074923 mozobil Drugs 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 201000005962 mycosis fungoides Diseases 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- BLCLNMBMMGCOAS-UHFFFAOYSA-N n-[1-[[1-[[1-[[1-[[1-[[1-[[1-[2-[(carbamoylamino)carbamoyl]pyrrolidin-1-yl]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-[(2-methylpropan-2-yl)oxy]-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amin Chemical compound C1CCC(C(=O)NNC(N)=O)N1C(=O)C(CCCN=C(N)N)NC(=O)C(CC(C)C)NC(=O)C(COC(C)(C)C)NC(=O)C(NC(=O)C(CO)NC(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C(CC=1NC=NC=1)NC(=O)C1NC(=O)CC1)CC1=CC=C(O)C=C1 BLCLNMBMMGCOAS-UHFFFAOYSA-N 0.000 description 1
- LBWFXVZLPYTWQI-IPOVEDGCSA-N n-[2-(diethylamino)ethyl]-5-[(z)-(5-fluoro-2-oxo-1h-indol-3-ylidene)methyl]-2,4-dimethyl-1h-pyrrole-3-carboxamide;(2s)-2-hydroxybutanedioic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O.CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C LBWFXVZLPYTWQI-IPOVEDGCSA-N 0.000 description 1
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 description 1
- 238000002663 nebulization Methods 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 230000017066 negative regulation of growth Effects 0.000 description 1
- 229960000801 nelarabine Drugs 0.000 description 1
- IXOXBSCIXZEQEQ-UHTZMRCNSA-N nelarabine Chemical compound C1=NC=2C(OC)=NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O IXOXBSCIXZEQEQ-UHTZMRCNSA-N 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 229960005163 netupitant Drugs 0.000 description 1
- WAXQNWCZJDTGBU-UHFFFAOYSA-N netupitant Chemical compound C=1N=C(N2CCN(C)CC2)C=C(C=2C(=CC=CC=2)C)C=1N(C)C(=O)C(C)(C)C1=CC(C(F)(F)F)=CC(C(F)(F)F)=C1 WAXQNWCZJDTGBU-UHFFFAOYSA-N 0.000 description 1
- 229960000689 nevirapine Drugs 0.000 description 1
- 229940080607 nexavar Drugs 0.000 description 1
- 229960001346 nilotinib Drugs 0.000 description 1
- HHZIURLSWUIHRB-UHFFFAOYSA-N nilotinib Chemical compound C1=NC(C)=CN1C1=CC(NC(=O)C=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)=CC(C(F)(F)F)=C1 HHZIURLSWUIHRB-UHFFFAOYSA-N 0.000 description 1
- 229960002653 nilutamide Drugs 0.000 description 1
- XWXYUMMDTVBTOU-UHFFFAOYSA-N nilutamide Chemical compound O=C1C(C)(C)NC(=O)N1C1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 XWXYUMMDTVBTOU-UHFFFAOYSA-N 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 235000021231 nutrient uptake Nutrition 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 229960003347 obinutuzumab Drugs 0.000 description 1
- 229940024847 odomzo Drugs 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 229950008516 olaratumab Drugs 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 229940048191 onivyde Drugs 0.000 description 1
- 229940100027 ontak Drugs 0.000 description 1
- 208000010655 oral cavity squamous cell carcinoma Diseases 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 150000002913 oxalic acids Chemical class 0.000 description 1
- ATYBXHSAIOKLMG-UHFFFAOYSA-N oxepin Chemical compound O1C=CC=CC=C1 ATYBXHSAIOKLMG-UHFFFAOYSA-N 0.000 description 1
- 229960005434 oxybutynin Drugs 0.000 description 1
- 229960004390 palbociclib Drugs 0.000 description 1
- AHJRHEGDXFFMBM-UHFFFAOYSA-N palbociclib Chemical compound N1=C2N(C3CCCC3)C(=O)C(C(=O)C)=C(C)C2=CN=C1NC(N=C1)=CC=C1N1CCNCC1 AHJRHEGDXFFMBM-UHFFFAOYSA-N 0.000 description 1
- 238000002638 palliative care Methods 0.000 description 1
- WRUUGTRCQOWXEG-UHFFFAOYSA-N pamidronate Chemical compound NCCC(O)(P(O)(O)=O)P(O)(O)=O WRUUGTRCQOWXEG-UHFFFAOYSA-N 0.000 description 1
- 229960003978 pamidronic acid Drugs 0.000 description 1
- 229940096717 pamine Drugs 0.000 description 1
- 229960000639 pazopanib Drugs 0.000 description 1
- CUIHSIWYWATEQL-UHFFFAOYSA-N pazopanib Chemical compound C1=CC2=C(C)N(C)N=C2C=C1N(C)C(N=1)=CC=NC=1NC1=CC=C(C)C(S(N)(=O)=O)=C1 CUIHSIWYWATEQL-UHFFFAOYSA-N 0.000 description 1
- 229940121655 pd-1 inhibitor Drugs 0.000 description 1
- HQQSBEDKMRHYME-UHFFFAOYSA-N pefloxacin mesylate Chemical compound [H+].CS([O-])(=O)=O.C1=C2N(CC)C=C(C(O)=O)C(=O)C2=CC(F)=C1N1CCN(C)CC1 HQQSBEDKMRHYME-UHFFFAOYSA-N 0.000 description 1
- 229960001373 pegfilgrastim Drugs 0.000 description 1
- 108010044644 pegfilgrastim Proteins 0.000 description 1
- 229960003349 pemetrexed disodium Drugs 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 235000011007 phosphoric acid Nutrition 0.000 description 1
- 150000003016 phosphoric acids Chemical class 0.000 description 1
- YIQPUIGJQJDJOS-UHFFFAOYSA-N plerixafor Chemical compound C=1C=C(CN2CCNCCCNCCNCCC2)C=CC=1CN1CCCNCCNCCCNCC1 YIQPUIGJQJDJOS-UHFFFAOYSA-N 0.000 description 1
- 229920000371 poly(diallyldimethylammonium chloride) polymer Polymers 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- PHXJVRSECIGDHY-UHFFFAOYSA-N ponatinib Chemical compound C1CN(C)CCN1CC(C(=C1)C(F)(F)F)=CC=C1NC(=O)C1=CC=C(C)C(C#CC=2N3N=CC=CC3=NC=2)=C1 PHXJVRSECIGDHY-UHFFFAOYSA-N 0.000 description 1
- 229960001131 ponatinib Drugs 0.000 description 1
- BWTNNZPNKQIADY-UHFFFAOYSA-N ponatinib hydrochloride Chemical compound Cl.C1CN(C)CCN1CC(C(=C1)C(F)(F)F)=CC=C1NC(=O)C1=CC=C(C)C(C#CC=2N3N=CC=CC3=NC=2)=C1 BWTNNZPNKQIADY-UHFFFAOYSA-N 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000027317 positive regulation of immune response Effects 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000009290 primary effect Effects 0.000 description 1
- 229960001586 procarbazine hydrochloride Drugs 0.000 description 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 150000004717 pyruvic acids Chemical class 0.000 description 1
- 229960002633 ramucirumab Drugs 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 230000010837 receptor-mediated endocytosis Effects 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- FNHKPVJBJVTLMP-UHFFFAOYSA-N regorafenib Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=C(F)C(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 FNHKPVJBJVTLMP-UHFFFAOYSA-N 0.000 description 1
- 210000003289 regulatory T cell Anatomy 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 208000023504 respiratory system disease Diseases 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 229940120975 revlimid Drugs 0.000 description 1
- 229940061969 rheumatrex Drugs 0.000 description 1
- CXYRUNPLKGGUJF-RAFJPFSSSA-M scopolamine methobromide Chemical compound [Br-].C1([C@@H](CO)C(=O)O[C@H]2C[C@@H]3[N+]([C@H](C2)[C@@H]2[C@H]3O2)(C)C)=CC=CC=C1 CXYRUNPLKGGUJF-RAFJPFSSSA-M 0.000 description 1
- 231100000933 sensitization response Toxicity 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 229960003323 siltuximab Drugs 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- RWIVSVMMGFFZIJ-VWDRLOGHSA-N sonidegib phosphate Chemical compound OP(O)(O)=O.OP(O)(O)=O.C1[C@@H](C)O[C@@H](C)CN1C(N=C1)=CC=C1NC(=O)C1=CC=CC(C=2C=CC(OC(F)(F)F)=CC=2)=C1C RWIVSVMMGFFZIJ-VWDRLOGHSA-N 0.000 description 1
- 229960003787 sorafenib Drugs 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 229940068117 sprycel Drugs 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 229940090374 stivarga Drugs 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 150000003444 succinic acids Chemical class 0.000 description 1
- 229960002812 sunitinib malate Drugs 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000001502 supplementing effect Effects 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 231100000057 systemic toxicity Toxicity 0.000 description 1
- 229950008461 talimogene laherparepvec Drugs 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 229960003454 tamoxifen citrate Drugs 0.000 description 1
- FQZYTYWMLGAPFJ-OQKDUQJOSA-N tamoxifen citrate Chemical compound [H+].[H+].[H+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O.C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 FQZYTYWMLGAPFJ-OQKDUQJOSA-N 0.000 description 1
- 229960000235 temsirolimus Drugs 0.000 description 1
- QFJCIRLUMZQUOT-UHFFFAOYSA-N temsirolimus Natural products C1CC(O)C(OC)CC1CC(C)C1OC(=O)C2CCCCN2C(=O)C(=O)C(O)(O2)C(C)CCC2CC(OC)C(C)=CC=CC=CC(C)CC(C)C(=O)C(OC)C(O)C(C)=CC(C)C(=O)C1 QFJCIRLUMZQUOT-UHFFFAOYSA-N 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 230000004797 therapeutic response Effects 0.000 description 1
- 229940021747 therapeutic vaccine Drugs 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- 108010078373 tisagenlecleucel Proteins 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 229940100411 torisel Drugs 0.000 description 1
- 238000011247 total mesorectal excision Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000027 toxicology Toxicity 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 229960000977 trabectedin Drugs 0.000 description 1
- PKVRCIRHQMSYJX-AIFWHQITSA-N trabectedin Chemical compound C([C@@]1(C(OC2)=O)NCCC3=C1C=C(C(=C3)O)OC)S[C@@H]1C3=C(OC(C)=O)C(C)=C4OCOC4=C3[C@H]2N2[C@@H](O)[C@H](CC=3C4=C(O)C(OC)=C(C)C=3)N(C)[C@H]4[C@@H]21 PKVRCIRHQMSYJX-AIFWHQITSA-N 0.000 description 1
- 239000011573 trace mineral Substances 0.000 description 1
- 235000013619 trace mineral Nutrition 0.000 description 1
- 229960004066 trametinib Drugs 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 208000037956 transmissible mink encephalopathy Diseases 0.000 description 1
- 229940086984 trisenox Drugs 0.000 description 1
- 230000005851 tumor immunogenicity Effects 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 229940022919 unituxin Drugs 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 210000002229 urogenital system Anatomy 0.000 description 1
- ATCJTYORYKLVIA-SRXJVYAUSA-N vamp regimen Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1.C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1.O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1.C([C@H](C[C@]1(C(=O)OC)C=2C(=CC3=C(C45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C=O)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 ATCJTYORYKLVIA-SRXJVYAUSA-N 0.000 description 1
- 229960000241 vandetanib Drugs 0.000 description 1
- UHTHHESEBZOYNR-UHFFFAOYSA-N vandetanib Chemical compound COC1=CC(C(/N=CN2)=N/C=3C(=CC(Br)=CC=3)F)=C2C=C1OCC1CCN(C)CC1 UHTHHESEBZOYNR-UHFFFAOYSA-N 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 229940099039 velcade Drugs 0.000 description 1
- 229960003862 vemurafenib Drugs 0.000 description 1
- GPXBXXGIAQBQNI-UHFFFAOYSA-N vemurafenib Chemical compound CCCS(=O)(=O)NC1=CC=C(F)C(C(=O)C=2C3=CC(=CN=C3NC=2)C=2C=CC(Cl)=CC=2)=C1F GPXBXXGIAQBQNI-UHFFFAOYSA-N 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 229960002110 vincristine sulfate Drugs 0.000 description 1
- 230000006490 viral transcription Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
- 229940054221 vistogard Drugs 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- 235000019156 vitamin B Nutrition 0.000 description 1
- 239000011720 vitamin B Substances 0.000 description 1
- 150000003722 vitamin derivatives Chemical class 0.000 description 1
- 229940110059 voraxaze Drugs 0.000 description 1
- 229960000237 vorinostat Drugs 0.000 description 1
- WAEXFXRVDQXREF-UHFFFAOYSA-N vorinostat Chemical compound ONC(=O)CCCCCCC(=O)NC1=CC=CC=C1 WAEXFXRVDQXREF-UHFFFAOYSA-N 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 229940014556 xgeva Drugs 0.000 description 1
- 229940066799 xofigo Drugs 0.000 description 1
- 229940085728 xtandi Drugs 0.000 description 1
- 229940071104 xylenesulfonate Drugs 0.000 description 1
- 229940036061 zaltrap Drugs 0.000 description 1
- 229960004276 zoledronic acid Drugs 0.000 description 1
- XRASPMIURGNCCH-UHFFFAOYSA-N zoledronic acid Chemical compound OP(=O)(O)C(P(O)(O)=O)(O)CN1C=CN=C1 XRASPMIURGNCCH-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
- C12N5/0638—Cytotoxic T lymphocytes [CTL] or lymphokine activated killer cells [LAK]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/76—Viruses; Subviral particles; Bacteriophages
- A61K35/761—Adenovirus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/10011—Adenoviridae
- C12N2710/10311—Mastadenovirus, e.g. human or simian adenoviruses
- C12N2710/10341—Use of virus, viral particle or viral elements as a vector
- C12N2710/10343—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Virology (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Biochemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Medicinal Chemistry (AREA)
- Cell Biology (AREA)
- Plant Pathology (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Physics & Mathematics (AREA)
- Mycology (AREA)
- Hematology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Methods of amplifying a tumor-infiltrating lymphocyte (TIL) population and methods of treating cancer using the amplified TIL population are disclosed.
Description
Technical Field
The present application claims the benefit of U.S. provisional application No. 63/106,215, the entire contents of which are incorporated herein by reference.
Background
Recent advances in cancer immunotherapy have drastically altered the treatment pattern. However, many cancer patients benefit little or no from available treatments, including Immune Checkpoint Inhibitors (ICI). Numerous clinical studies have shown that pre-existing tumor-reactive T cells are critical to achieving the benefit from checkpoint inhibitors. Thus, new methods to increase the number and function of tumor-reactive T cells are needed.
Disclosure of Invention
Methods and compositions related to expanding a tumor-infiltrating lymphocyte (TIL) population and using the TIL population to treat cancer are disclosed.
In one aspect, disclosed herein are methods of producing tumor-infiltrating lymphocytes comprising a) administering to a tumor cell an effective amount of an oncolytic virus that expresses one or more exogenous immunostimulatory molecules (e.g., CD40-L, MEM, B7-1 (CD 80)/B7-2 (CD 86), OX40L, 4-1BBL, CD70, GITRL, LIGHT, TIM-4, ICAM-1, CD58, and/or SLAMF 6); and b) collecting tumor-infiltrating lymphocytes. In some aspects, the oncolytic virus may also express one or more type 1 Interferons (IFNs) (e.g., IFN- α, IFN- β, IFN- κ, IFN- δ, IFN- ε, IFN- τ, IFN- ω, and/or IFN- ζ). In some aspects, the TIL produced is obtained in a tumor microenvironment in which the oncolytic viral site is administered; however, TIL can also be obtained in a tumor microenvironment that is not infected with the oncolytic virus.
Also disclosed herein are methods of producing tumor-infiltrating lymphocytes of any of the preceding aspects, wherein the oncolytic virus is administered by intratumoral injection.
Also disclosed herein are methods of producing tumor-infiltrating lymphocytes of any of the preceding aspects, further comprising ex vivo expanding the harvested TILs.
In one aspect, disclosed herein is a method of expanding a tumor-infiltrating lymphocyte (TIL) population or a bone marrow-infiltrating lymphocyte (MILs) population, comprising: a) Collecting TIL or MILs from a subject having cancer; b) The harvested TIL or MIL is cultured in the presence of antigen presenting cells infected with an oncolytic virus that expresses one or more exogenous immunostimulatory molecules (e.g., CD40-L, MEM, B7-1 (CD 80)/B7-2 (CD 86), OX40L, 4-1BBL, CD70, GITRL, LIGHT, TIM-4, ICAM-1, CD58, and/or SLAMF 6). In some aspects, the oncolytic virus may also express one or more type 1 Interferons (IFNs) (e.g., IFN- α, IFN- β, IFN- κ, IFN- δ, IFN- ε, IFN- τ, IFN- ω, and/or IFN- ζ).
Also disclosed herein are methods of treating, reducing, inhibiting, reducing, ameliorating, and/or preventing cancer and/or metastasis in a subject comprising administering to the subject a therapeutically effective amount of the TIL or MILs of any of the preceding aspects. For example, disclosed herein are methods of treating, alleviating, inhibiting, reducing, ameliorating, and/or preventing cancer and/or metastasis in a subject comprising: a) Administering an effective amount of an oncolytic virus expressing one or more exogenous immunostimulatory molecules (e.g., CD40-L, MEM40, B7-1 (CD 80)/B7-2 (CD 86), OX40L, 4-1BBL, CD70, GITRL, LIGHT, TIM-4, ICAM-1, CD58, and/or SLAMF 6) into a tumor cell; b) Collecting tumor-infiltrating lymphocytes (TIL) and/or bone marrow-infiltrating lymphocytes (MILs); c) Amplifying the collected TIL and/or MIL ex vivo; and d) administering a therapeutically effective amount of the amplified TIL and/or MIL to the subject. In some aspects, the cancerous tumor or metastatic tumor treated, reduced, inhibited, reduced, ameliorated, and/or prevented is distant to a tumor that receives any oncolytic virus and/or TIL or MILs disclosed herein. In some aspects, the oncolytic virus may also express one or more type 1 Interferons (IFNs) (e.g., IFN- α, IFN- β, IFN- κ, IFN- δ, IFN- ε, IFN- τ, IFN- ω, and/or IFN- ζ).
Further, disclosed herein are methods of treating, alleviating, inhibiting, reducing, ameliorating, and/or preventing cancer and/or metastasis in a subject comprising a) harvesting tumor-infiltrating lymphocytes (TILs) and/or bone marrow-infiltrating lymphocytes (MILs) from a subject having cancer; culturing the harvested TIL or MILs in the presence of antigen presenting cells infected with an oncolytic virus expressing one or more exogenous immunostimulatory molecules; and administering a therapeutically effective amount of the amplified TIL and/or MILs to the subject. In some aspects, the oncolytic virus may also express one or more type 1 Interferons (IFNs) (e.g., IFN- α, IFN- β, IFN- κ, IFN- δ, IFN- ε, IFN- τ, IFN- ω, and/or IFN- ζ).
In one aspect, disclosed herein are methods of treating, alleviating, inhibiting, reducing, ameliorating, and/or preventing cancer and/or metastasis of any of the foregoing aspects, further comprising administering an anti-cancer agent to a subject.
Drawings
The accompanying drawings, which are incorporated in and constitute a part of this specification, illustrate various embodiments and, together with the description, explain the disclosed compositions and methods.
FIG. 1A shows B16-OVA cells were transduced with pLenti-Puro control lentiviruses or lentiviruses expressing mouse or human IFN beta, followed by puromycin selection. The same number of cells were plated, and after 2 days the supernatant was collected for ELISA to detect human and mouse IFNbeta. n=6, statistical analysis was performed using t-test of growth curve two-way ANOVA or OVA tetramer assessment. Statistical significance is expressed by p values as p <0.05, p <0.01, p <0.001.NS: is not significant.
FIG. 1B shows that wild-type or IFNAR1 KO (IFNAR) C57BL/6 mice received two rounds of B16-OVA-pLenti, B16-OVA-mouse IFNbeta or B16-OVA-human IFNP vaccine on day 0 and day 7 (100 Gy radiation was received on the cells prior to injection). Day 12, shown in MHCII in peripheral blood - And CD8 + OVA tetramers in cells + Is a percentage of (c). n=6, statistical analysis was performed using t-test of growth curve two-way ANOVA or OVA tetramer assessment. Statistical significance is represented by p-value as p<0.05,**p<0.01,***p<0.001.NS: is not significant.
FIG. 1C is the same as in (A) except that mice were challenged with 3e5 live B16-OVA cells on day 21. Tumor growth was determined as shown. n=6, statistical analysis was performed using t-test of growth curve two-way ANOVA or OVA tetramer assessment. Statistical significance is expressed by p values as p <0.05, p <0.01, p <0.001.NS: is not significant.
Fig. 2A is a schematic diagram of MEM 40.
FIG. 2B is a schematic diagram of MEM-288.
Figures 3A, 3B, 3C and 3D show that (3A) a549 cells or (3C) B16-F10 cells were infected with control GFP virus or oncolytic Ad-MEM-188 or 288, as shown at moi=250, for 2 days. Expression of GFP and MEM40 was determined by flow cytometry. After infection with the indicated OV in (3B) A549 cells or (3D) B16-F10 cells, IFN beta secretion was determined by ELISA.
FIGS. 4A, 4B and 4C show (4A) 344SQ (344), (4B) B16-F10 mouse cell line and (4C) A549 human cell line infected with designated OV AD-GFP (GFP), MEM-188 (188) or MEM-288 (288) at different MOI (1, 10, 100) for 2 days. Cell viability was determined by trypan blue staining assay 2 days after infection.
FIGS. 5A and 5B show the subcutaneous inoculation of 5e 5B 16-OVA cells from C57BL/6 mice. On day 12 and 16, these mice received two intratumoral injections of Ad-GFP, MEM-188 and MEM-288 (5A) 10e8 or (5B) 10e9 IU. The significance of the tumor size differences was shown compared to untreated control mice at the last time point.
FIG. 5C shows the percentage of OVA-specific MHCII-and CD8+ cells in peripheral blood at day 12 after intratumoral injection of l0e9 IU of MEM-188 and MEM-288 in B16-OVA. Statistical analysis was performed using t-test with two-way ANOVA or OVAT assessment of growth curves. Statistical significance is represented by p-value as p<0.05、**p<0.01、***p<0.001.NS: is not significant. FIG. 5D shows quantification of ELISPOT results for IFNγ from spleen CD 8T cells. C57BL/6WT, IFNAR1 KO and CD40 KO mice (3 per group) were inoculated subcutaneously with 5e 5B 16-OVA cells on the flank and injected with PBS (UT: untreated) or 10e9 IU MEM-288 on day 12 and day 16. The spleen of the mice was subjected to magnetic bead isolation of CD 8T cells according to the manufacturer's recommendations. Subsequently, 2×10 5 CD8 cells and 1X 10 cells per well 5 The 50Gy irradiated B16-OVA cells per well were plated into triplicate wells and incubated in 96-well plates for 24 hours at 37 ℃. Stimulation of tumor cells with ifnγ increases MHC expression. T cells were also cultured alone or with concanavalin a (ConA) as negative and positive controls, respectively. The results are shown relative to ConA treatment for each group. Statistical analysis was performed using t-test. Statistical significance is represented by p-value as p<0.05、**p<0.01、***p<0.001.NS: is not significant.
Fig. 6A shows the treatment regimen for mice: c57BL/6 mice were inoculated subcutaneously with 5e 5B 16-F10 cells at the primary site and 2.5e 5B 16-F10 cells at the contralateral site. As shown, these mice were injected with 10e9 IU of MEM-288 to the primary tumor on day 12 and day 16, and anti-PD-1 and CTLA-4 antibodies to the primary tumor on day 16, day 19, day 23, and day 27.
FIGS. 6B and 6C show that tumor growth is determined at the primary site (6B) and the contralateral site (6C) as shown. Statistical analysis was performed using two-way ANOVA of the growth curve. Statistical significance is expressed by p values as p <0.05, p <0.01, p <0.001.NS: is not significant.
Fig. 6D shows Kaplan-Meier survival analysis showing overall survival of mice. Statistical significance is expressed by p values as p <0.05, p <0.01, p <0.001.NS: is not significant.
FIG. 7A shows that 129 mice were subcutaneously inoculated with 5e5 344 cells on the flank and 10e9 IU of Ad-GFP, MEM-188 or 288 was injected into the tumor on day 12 and day 16. Tumor growth was determined at the primary site as shown. Showing significance compared to the control UT group (PBS injection). Statistical significance is expressed by p values as p <0.05, p <0.01, p <0.001.NS: is not significant.
Figure 7B shows a typical H & E staining of lung tumors of tumor-bearing mice injected subcutaneously 344 in (7A) on day 38.
Figure 7C shows the quantification of tumors from individual mice from different groups, as shown. Statistical significance is expressed or represented by p values as p <0.05, < p <0.01, < p <0.001.NS: is not significant.
FIG. 7D shows a typical IHC staining of mouse lung CD 8T cells in (7A).
Figure 7E shows quantification of CD 8T cell density from individual mice from different groups, as shown. Statistical significance is expressed or represented by p values as p <0.05, < p <0.01, < p <0.001.NS: is not significant.
Figures 8A and 8B show that 129 mice injected subcutaneously 5e5 344 cells on the flank and 10e9 IU of MEM-288 on day 12 and day 16 and anti-PD-1 antibodies on day 16, day 19, day 23 and day 27 intraperitoneally. Fig. 8A shows ifnγ ELISPOT from spleen CD 8T cells of mice, and fig. 8B shows quantification of ELISPOT results from (a). Statistical analysis was performed using t-test. Statistical significance is expressed by p values as p <0.05, p <0.01, p <0.001.NS: is not significant.
FIG. 9A shows a flow cytometry analysis protocol of B16-OVA to detect the indicated macrophage, neutrophil, monocyte and DC populations.
FIG. 9B shows a flow cytometry analysis protocol of B16-OVA to detect populations of B cells, CD 4T cells, CD 8T cells, and OVA-specific CD 8T cells.
FIG. 10 shows that C57BL/6 mice were subcutaneously injected on the flank with 5e 5B 16-OVA or B16-OVA-ZsGreen cells. On day 14, tumor B16-OVA was analyzed by flow cytometry to detect ZsGreen positive populations of macrophages and DCs as identified in FIG. 9A. The percentage of positive cells is shown.
FIG. 11A shows that C57BL/6 mice were inoculated with 5e 5B 16-OVA or B16-OVA-ZsGreen cells subcutaneously on the flank. On day 14, flow cytometry analysis was performed to detect CD45 as indicated - ZsGreen in (A) + Tumor cells.
FIG. 11B shows that B16-OVA-ZsGreen tumors were injected into tumors on day 12 with 10e9 IU of PBS or MEM-288. ZsGreen from PBS and MEM-288 injected tumors + CD45 - Cells were analyzed by flow cytometry for CD 40L.
FIG. 12A shows MHC-II progression of the tumor of FIG. 11b High height Macrophages and DC (CD 11 b) + Flow cytometry analysis of CD80 and CD86 expression in DC 2). Injection of PBS and MEM-288 in tumors is shown.
Fig. 12B shows the Mean Fluorescence Intensity (MFI) of the result (a).
Fig. 13 shows DC populations in inguinal LNs. CD11c was detected + MHC-II + Two major populations of DCs. The MHC-II high population comprises migratory DC1 and migratory DC2. The MHC-II intermediate population comprises colonising DC1 and colonising DC2. As expected, mobility groupsThe body has a higher proportion of CD103 + DC1, while the colonising population has a higher proportion of CD8a + DC1。
FIG. 14 shows DC populations in LN of WT, CD40 KO and IFNAR1 KO mice. CD11c + MHC-II + Two major populations of DCs were detected in all genotype mice. The MHC-II high population comprises migratory DC1 and migratory DC2. The MHC-II intermediate population comprises colonising DC1 and colonising DC2.
FIGS. 15A and 15B show that C57BL/6 mice were inoculated with 5e 5B 16-OVA cells subcutaneously on the flank. On days 12 and 16, tumors received injections of PBS (n=4), adenovirus-GFP (n=3) or MEM-288 (n=4) of 10e9 IU. On day 20, tumors were obtained for IHC to detect CD8 + The presence of Tumor Infiltrating Lymphocytes (TILs). CD 8T cell staining was scored on a scale of 0-3 by a pathologist blinded to each group. Fig. 15A shows representative tumor images of 3 treatment groups. Fig. 15B shows the scoring values of the 3 treatment groups.
Detailed Description
Before the present compounds, compositions, articles, devices, and/or methods are disclosed and described, it is to be understood that they are not limited to specific synthetic methods or specific recombinant biotechnology methods, or specific reagents, unless otherwise indicated, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting.
A. Definition of the definition
As used in the specification and the appended claims, the singular forms "a," "an," and "the" include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to "a pharmaceutical carrier" includes mixtures of two or more such carriers, and the like.
Ranges may be expressed herein as from "about" one particular value, and/or to "about" another particular value. When such a range is expressed, another embodiment includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent "about," it will be understood that the particular value forms another embodiment. It will also be understood that the endpoints of each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint. It will also be understood that there are many values disclosed herein, and that each value is also disclosed herein as a particular value other than the "about" value itself. For example, if the disclosed value is "10," then "about 10" is also disclosed. It will also be understood that when a value is disclosed, "less than or equal to" the value, "greater than or equal to the value," and possible ranges between values are also disclosed, as would be well understood by one of ordinary skill in the art. For example, if the value "10" is disclosed, then "less than or equal to 10" and "greater than or equal to 10" are also disclosed. It should also be understood that throughout this application, data is provided in a variety of different formats, and that this data represents endpoints and starting points, and ranges for any combination of the data points. For example, if a particular data point "10" and a particular data point 15 are disclosed, it is understood that greater than, greater than or equal to, less than or equal to, and equal to 10 and 15, and 10-15 are considered disclosed. It should also be understood that each unit between two particular units is also disclosed. For example, if 10 and 15 are disclosed, 11, 12, 13 and 14 are also disclosed.
In this specification and in the claims that follow, reference will be made to a number of terms, which shall be defined to have the following meanings:
"optional" or "optionally" means that the subsequently described event or circumstance may or may not occur, and that the description includes instances where the event or circumstance occurs and instances where it does not.
As used herein, the term "antigen presenting cell" (APC) refers to a professional antigen presenting cell selected from the group consisting of dendritic cells, macrophages and B cells. In some embodiments, the APC is DC. In some embodiments, the APC is a mammalian cell. In some embodiments, the APC (e.g., DC, macrophage, or B cell) is a human cell
An "increase" may refer to any change in the amount that results in a greater amount of symptoms, disease, composition, condition, or activity. The increase may be any individual, median or average increase in condition, symptom, activity, composition in a statistically significant amount. Thus, the increase may be 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 100% as long as the increase is statistically significant.
"reduced" may refer to any change in the amount that results in less symptoms, disease, composition, condition, or activity. When the genetic output of a gene product having the substance is small relative to the output of a gene product without the substance, the substance is also understood to reduce the genetic output of the gene. Also, for example, the decrease may be a change in symptoms of the disorder, making the symptoms less than previously observed. The decrease may be any individual, median or average decrease in condition, symptom, activity, composition in a statistically significant amount. Thus, the decrease may be a decrease of 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 100% as long as the decrease is statistically significant.
"Inhibit", "Inhibit" and "inhibition" refer to a decrease in activity, response, condition, disease or other biological parameter. This may include, but is not limited to, complete elimination of activity, response, condition or disease. This may also include, for example, a 10% reduction in activity, response, condition or disease compared to a natural or control level. Thus, the decrease may be 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100% or any decrease in between, as compared to a natural or control level.
"reduction" or other forms of the word, such as "reduce" or "reduction", refer to a decrease in an event or feature (e.g., tumor growth). It will be appreciated that this is typically associated with certain standards or expected values, in other words, it is relative, but it is not always necessary to refer to a standard or relative value. For example, "reducing tumor growth" refers to reducing the growth rate of a tumor relative to a standard or control.
"prevention" or other forms of words, such as "prevention" or "prevention," refer to the cessation of a particular event or feature to stabilize or delay the development or progression of the particular event or feature, or to minimize the chance of the particular event or feature occurring. Prevention does not need to be compared to control, as it is generally more absolute than, for example, reduction, etc. As used herein, something may be reduced but cannot be prevented, but reduction of something may also be prevented. Also, something can be prevented but cannot be reduced, but something that is prevented can also be reduced. It is to be understood that where the use is reduced or prevented, the use of other words is also expressly disclosed unless specifically stated otherwise.
The term "subject" refers to any individual to whom the target of administration or treatment is directed. The subject may be a vertebrate, for example a mammal. In one aspect, the subject may be a human, non-human primate, bovine, equine, porcine, canine, or feline. Thus, the subject may also be guinea pig, rat, hamster, rabbit, mouse or mole. Thus, the subject may be a human or veterinary patient. The term "patient" refers to a subject under treatment by a clinician (e.g., doctor).
The term "therapeutically effective amount" refers to an amount of the composition used sufficient to ameliorate one or more causes or symptoms of a disease or disorder. This improvement need only be reduced or altered and need not necessarily be eliminated.
The term "treatment" refers to the medical management of a patient with the aim of curing, ameliorating, stabilizing or preventing a disease, pathological condition or disorder. The term encompasses active treatments, i.e. treatments directed specifically to amelioration of a disease, pathological condition or disorder, as well as causal treatments, i.e. treatments directed specifically to elimination of the etiology of the associated disease, pathological condition or disorder. Furthermore, the term includes palliative treatment, i.e. treatment intended to alleviate symptoms rather than cure a disease, pathological condition or disorder; prophylactic treatment, i.e., treatment intended to minimize or partially or completely inhibit the development of a related disease, pathological condition, or disorder; and supportive treatment, i.e., treatment for supplementing another specific therapy aimed at ameliorating a related disease, pathological condition, or disorder.
"biocompatible" generally refers to materials and any metabolites or degradation products thereof that are generally non-toxic to the recipient and do not significantly adversely affect the subject.
"comprising" is intended to mean including the composition, method, etc. of the recited elements, but not excluding other elements. When used to define compositions and methods, "consisting essentially of … …" is meant to include the recited elements, but not other elements that are of significance to the combination. Thus, a composition consisting essentially of the elements defined herein does not exclude minor contaminants such as phosphate buffered saline, preservatives, and the like, both in isolation and purification methods, as well as in pharmaceutically acceptable carriers. "consisting of … …" means the substantial process steps excluding other ingredients beyond trace elements and for the administration of the compositions provided and/or claimed in the present disclosure. Embodiments are defined by each of these transitional terms within the scope of this disclosure.
A "control" is an alternative subject or sample used for comparison purposes in an experiment. The control may be "positive" or "negative".
An "effective amount" of an agent refers to an amount of the agent sufficient to provide the desired effect. The amount of an agent that is "effective" will vary from subject to subject, depending on a number of factors, such as the age and general condition of the subject, the particular agent or agents, and the like. Therefore, it is not always possible to specify an "effective amount" of an amount. However, a suitable "effective amount" in any subject case can be determined by one of ordinary skill in the art using routine experimentation. Furthermore, as used herein, unless specifically stated otherwise, an "effective amount" of an agent may also be meant to encompass both a therapeutically effective amount and a prophylactically effective amount. The "effective amount" of the agent necessary to achieve a therapeutic effect may vary depending on factors such as the age, sex, and weight of the subject. Dosage regimens may be adjusted to provide the optimum therapeutic response. For example, multiple divided doses may be administered daily, or the dose may be proportionally reduced as indicated by the emergency state of the treatment situation.
A "pharmaceutically acceptable" component may refer to a component that is not biologically or otherwise undesirable, i.e., the component may be incorporated into a pharmaceutical formulation provided by the present disclosure and administered to a subject as described herein without causing a significant undesirable biological effect or interacting in a deleterious manner with any of the other components of the formulation in which it is contained. When used in reference to administration to humans, the term generally means that the ingredient has reached the required criteria for toxicology and manufacturing trials, or that it is contained in an inactive ingredient guide established by the U.S. food and drug administration (Food and Drug Administration).
"pharmaceutically acceptable carrier" (sometimes referred to as "carrier") refers to a carrier or excipient used in the preparation of generally safe and nontoxic pharmaceutical or therapeutic compositions, including veterinary and/or human pharmaceutical or therapeutic acceptable carriers. The term "carrier" or "pharmaceutically acceptable carrier" may include, but is not limited to, various types of phosphate buffered saline solutions, water, emulsions (e.g., oil/water or water/oil emulsions), and/or wetting agents. As used herein, the term "carrier" includes, but is not limited to, any excipient, diluent, filler, salt, buffer, stabilizer, solubilizer, lipid, stabilizer, or other material known in the art for use in pharmaceutical formulations and as further described herein.
"pharmacological activity" (or simply "activity"), as in a "pharmacologically active" derivative or analog, may refer to a derivative or analog (e.g., salt, ester, amide, conjugate, metabolite, isomer, fragment, etc.) that has the same type of pharmacological activity as the parent compound and is substantially equivalent in extent.
"therapeutic agent" refers to any composition having a beneficial biological effect. Beneficial biological effects include therapeutic effects (e.g., treating a disorder or other undesirable physiological condition) and prophylactic effects (e.g., preventing a disorder or other undesirable physiological condition (e.g., non-immunogenic cancer)). The term also includes pharmaceutically acceptable, pharmacologically active derivatives of the beneficial agents specifically mentioned herein, including but not limited to salts, esters, amides, precursors, active metabolites, isomers, fragments, analogs, and the like. When the term "therapeutic agent" is used, or when a particular agent is specifically identified, it is understood that the term includes the agent itself as well as pharmaceutically acceptable, pharmacologically active salts, esters, amides, precursors, conjugates, active metabolites, isomers, fragments, analogs, and the like.
A "therapeutically effective amount" or "therapeutically effective dose" of a composition (e.g., a composition comprising a pharmaceutical agent) refers to an amount effective to achieve a desired therapeutic result. In some embodiments, the desired therapeutic result is the management of type I diabetes. In some embodiments, the desired therapeutic result is the management of obesity. The therapeutically effective amount of a given therapeutic agent will generally vary with factors such as the type and severity of the disorder or disease being treated and the age, sex and weight of the subject. The term may also refer to an amount of a therapeutic agent or a rate of delivery of a therapeutic agent (e.g., an amount that varies over time) that is effective to promote a desired therapeutic effect, such as pain relief. The exact desired therapeutic effect will vary depending on the condition to be treated, the tolerance of the subject, the agent and/or agent formulation to be administered (e.g., the efficacy of the therapeutic agent, the concentration of the agent in the formulation, etc.), and various other factors understood by one of ordinary skill in the art. In some cases, the desired biological or medical response is achieved after administration of multiple doses of the composition to the subject over a period of days, weeks, or years.
Throughout this application, various publications are referenced. The disclosures of these publications in their entireties are hereby incorporated by reference into this application in order to more fully describe the state of the art to which they pertain. The disclosed references are also incorporated herein by reference, individually and specifically, where the materials contained therein are dependent upon being discussed in the sentences of the references.
B. Composition and method for producing the same
Disclosed are ingredients for preparing the disclosed compositions, as well as the compositions themselves for use in the methods disclosed herein. These and other materials are disclosed herein, and it is understood that when combinations, subsets, interactions, groups, etc. of these materials are disclosed that while specific reference of each various individual and collective combinations and permutation of these compounds may not be explicitly disclosed, each is specifically contemplated and described herein. For example, if a particular type 1 IFN and immunostimulant comprising an oncolytic virus are disclosed and discussed, and a number of modifications that can be made to a number of molecules comprising a type 1 IFN and an immunostimulant comprising an oncolytic virus are discussed, each and every combination and permutation of a type 1 IFN and an immunostimulant comprising an oncolytic virus, and potentially large modifications, are specifically contemplated unless specifically indicated to the contrary. Thus, if the classes of molecules A, B and C and the classes of molecules D, E and F and examples of combined molecules are disclosed, A-D are disclosed, then each individually and collectively are contemplated to mean a combination, even though each is not individually recited, and A-E, A-F, B-D, B-E, B-F, C-D, C-E and C-F are considered disclosed. Also, any subset or combination of these is disclosed. Thus, for example, the A-E, B-F and C-E subsets would be considered public. This concept applies to all aspects of the present application including, but not limited to, steps in methods of making and using the disclosed compositions. Thus, if there are a plurality of additional steps that can be performed, it should be understood that each of these additional steps can be performed with any particular embodiment or combination of embodiments of the disclosed methods.
Binding of CD40 expressed on DCs by CD40L ligand results in the acquisition of a critical cross-priming function to activate CD 8T cells. Thus, the therapeutic use of CD40 agonists has the potential to trigger powerful anti-tumor T cell immunity. Recent clinical studies have shown that the combination of CD40 agonistic antibodies delivered systemically with ICI and chemotherapy has a good sensitization response, but this is also associated with significant toxicity. In addition to the role of type 1 IFNs in enhancing tumor immunogenicity by increasing expression of immune function genes in a variety of cell types, type 1 IFNs can act as direct activators of Dendritic Cell (DC) and T cell functions. This key immunostimulatory function of type 1 IFN has recently been exploited through the use of stimulators of type 1 IFN expression (e.g., STING and TLR9 agonists). There is a synergistic relationship between CD40 ligation and stimulators of type I IFN for robust CD 8T cell activation. However, the combined systemic administration of CD40 agonists and type 1 IFN activators is highly toxic.
In the intralesional immunotherapy approach, the tumor acts as a vaccine site, resulting in DC activation and subsequent T cell stimulation to generate systemic anti-tumor immunity capable of controlling the growth of distant untreated tumors. This approach aimed at avoiding systemic toxicity has recently been tested with STING and TLR9 agonists. It is shown herein that combined intralesional activation of CD40 and type 1 IFN signaling results in robust immune activation in the Tumor Microenvironment (TME), resulting in high levels of increase in systemic T cell responses.
Oncolytic Viruses (OVs) have been developed for their ability to replicate specifically in cancer cells. Recent studies have shown that stimulation of host anti-tumor immunity is critical to the mechanism of action of OV. OV also allows the ability to encode transgenes that can be used to express powerful immune response activators to further enhance anti-tumor immunity. It is shown herein that intravesically delivered OVs capable of activating type 1 IFN signaling in immunostimulatory molecules (e.g., such as CD 40) and/or TMEs can act as potent activators of systemic T cell responses. To test this, a conditionally replicating adenovirus type 5 that expresses chimeric CD40L ligand (MEM 40) and IFN beta was developed in concert with the company Memgen. We further demonstrated that MEM-288 induced high levels of CD40L and ifnβ expression and induced a robust systemic T cell response that was able to significantly reduce (curtaining) distant tumor growth in murine melanoma and lung tumor models.
In one aspect, disclosed herein are methods of producing tumor-infiltrating lymphocytes comprising a) administering an oncolytic virus expressing one or more type 1 Interferons (IFNs) (e.g., IIFN- α, IFN- β, IFN- κ, IFN- δ, IFN- ε, IFN- τ, IFN- ω, and/or IFN- ζ) and/or one or more exogenous immunostimulatory molecules (e.g., CD40-L, MEM, B7-1 (CD 80)/B7-2 (CD 86), OX40L, 4-1BBL, CD70, GITRL, LIGHT, TIM-4, ICAM-1, CD58, and/or SLAMF 6) into a tumor cell; b) Tumor infiltrating lymphocytes are collected. It is understood and contemplated herein that oncolytic viruses may be administered to a tumor by any means known in the art, including but not limited to intratumoral injection. While the above methods result in a significant increase in the number of TILs and MILs at the tumor site, it is also recognized that TILs and MILs can be produced and/or increased at tumor sites outside of the treated tumor microenvironment (i.e., distant effects).
Simply because the amount of TIL and MILs increases at the target site and/or distant tumor site of oncolytic virus administration does not mean that no further amplification occurs. In one aspect, it is understood and contemplated herein that the TIL in MILs may be further amplified if cultured ex vivo. Thus, also disclosed herein are methods of producing tumor-infiltrating lymphocytes, further comprising ex vivo expansion of the harvested TILs.
In one aspect, it is to be understood and contemplated herein that expansion of TIL and MILs is not necessarily limited to oncolytic viral methods in vivo, wherein tumors are infected with oncolytic viruses and harvested, but expansion of TIL can occur in vitro by harvesting TIL and MILs at a cancer site, and then culturing the harvested cells in the presence of oncolytic virus-infected antigen presenting cells. Thus, amplification of TIL and/or MILs occurs entirely in vitro. Accordingly, disclosed herein are methods of expanding a tumor-infiltrating lymphocyte (TIL) population or a bone marrow-infiltrating lymphocyte (MILs) population, comprising: a) Collecting TIL or MILs from a subject having cancer; b) Culturing the harvested TIL or MIL in the presence of antigen presenting cells infected with an oncolytic virus that expresses one or more type 1 Interferons (IFNs) (e.g., IIFN-alpha, IFN-beta, IFN-kappa, IFN-delta, IFN-epsilon, IFN-tau, IFN-omega, and/or IFN-zeta) and/or one or more exogenous immunostimulatory molecules (e.g., CD40-L, MEM, B7-1 (CD 80)/B7-2 (CD 86), OX40L, 4-1BBL, CD70, GITRL, LIGHT, TIM-4, ICAM-1, CD58, and/or SLAMF 6).
In certain embodiments, the invention provides a viral vector, such as a lentivirus (lentivirus), that expresses one or more type 1 Interferons (IFNs) (e.g., IIFN- α, IFN- β, IFN- κ, IFN- δ, IFN- ε, IFN- τ, IFN- ω, and/or IFN- ζ) and/or one or more exogenous immunostimulatory molecules (e.g., CD40-L, MEM40, cluster of Differentiation (CD) 80, and/or CD86 (also referred to as B7-1 (CD 80) and B7-2 (CD 86)), OX40L, 4-1BB ligand (4-1 BBL), CD70, LIGHT, glucocorticoid-induced TNFR-related protein ligand (GITRL), LIGHT, T cell immunoglobulin, and mucin domain 4 (TIM-4), intracellular adhesion molecule-1 (ICAM-1), CD58, and/or Signaling Lymphocyte Activating Molecule (SLAM) family member 6 (SLAM 6)), or any combination thereof.
Other embodiments of the invention provide oncolytic viruses that express type I IFNs (e.g., IFN- α, IFN- β, IFN- ε, IFN- κ, and IFN- ω) as well as any combination of immunostimulatory molecules (e.g., CD40-L, MEM, B7-1 (CD 80)/B7-2 (CD 86), OX40L, 4-1BBL, CD70, GITRL, LIGHT, TIM-4, ICAM-1, CD58, and/or SLAMF 6), e.g., by one or more heterologous nucleic acid sequences encoding a combination of IFN- β and CD 40-L. Any oncolytic virus may be used. In some embodiments, the oncolytic virus may be an adenovirus, a respiratory enterovirus, a herpes virus, a picornavirus (including coxsackie virus, poliovirus, and saint card virus (Seneca Valley virus)), a paramyxovirus (including measles virus and Newcastle Disease Virus (NDV)), a parvovirus, a rhabdovirus (including Vesicular Stomatitis Virus (VSV)), or a vaccinia virus. Preferably, the oncolytic virus is replication competent.
Other embodiments of the invention provide methods of treating a malignancy in a subject by administering an oncolytic virus as disclosed herein to the subject in combination with administering a checkpoint inhibitor to the subject.
IFN- α can be represented by the sequence of SEQ ID NO:1, and the sequence of the polypeptide is expressed as human IFN-alpha. The IFN- α may be mammalian IFN- α, such as mouse, rat, rabbit, pig, feline, canine, or bovine IFN- α. Other embodiments of IFN- α from other mammals are known to the skilled artisan and such embodiments are within the scope of the invention. In certain embodiments, IFN- α has 80.00% to up to 99.99% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) identity with human wild-type IFN- α (e.g., IFN- α of SEQ ID NO: 1).
IFN- β may be represented by the sequence of SEQ ID NO:2, and 2. The IFN- β may be a mammalian IFN- β, such as a mouse, rat, rabbit, pig, feline, canine, or bovine IFN- β. Other embodiments of IFN- β from other mammals are known to the skilled artisan and such embodiments are within the scope of the invention. In certain embodiments, IFN- β has 80.00% to up to 99.99% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity with a human wild-type IFN- β (e.g., IFN- β of SEQ ID NO: 2). In particular embodiments, IFN- β lacks the sequence of SEQ ID NO:2, and optionally further having 17 cysteine substitutions to obtain a 165 amino acid peptide having serine.
IFN-. Epsilon.may be represented by the sequence of SEQ ID NO:3, and 3. IFN- ε may be mammalian IFN- ε, e.g., mouse, rat, rabbit, pig, feline, canine, or bovine IFN- ε. Other embodiments of IFN- ε from other mammals are known to the skilled artisan and such embodiments are within the scope of the invention. In certain embodiments, IFN- ε has 80.00% to at most 99.99% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity with human wild-type IFN- ε (e.g., IFN- ε of SEQ ID NO: 3).
IFN-. Kappa.can be expressed by the sequence of SEQ ID NO:4, and the sequence of 4. IFN-kappa may be mammalian IFN-kappa, e.g., mouse, rat, rabbit, pig, feline, canine, or bovine IFN-kappa. Other embodiments of IFN- κ from other mammals are known to the skilled artisan and such embodiments are within the scope of the invention. In certain embodiments, IFN-kappa has 80.00% to up to 99.99% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to human wild-type IFN-kappa (e.g., IFN-kappa of SEQ ID NO: 4).
IFN- ω can be represented by the sequence of SEQ ID NO:5, and the sequence of the sequence is expressed as human IFN-omega. IFN- ω can be mammalian IFN- ω, e.g., mouse, rat, rabbit, pig, feline, canine, or bovine IFN- ω. Other embodiments of IFN- ω from other mammals are known to the skilled artisan and such embodiments are within the scope of the invention. In certain embodiments, IFN- ω has 80.00% to up to 99.99% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity with human wild-type IFN- ω (e.g., IFN- ω of SEQ ID NO: 5).
CD40-L may be represented by SEQ ID NO:6, and the sequence of human CD40-L. The CD40-L may be mammalian CD40-L, such as mouse, rat, rabbit, pig, feline, canine, or bovine CD40-L. Other embodiments of CD40-L from other mammals are known to the skilled artisan and such embodiments are within the scope of the invention. In certain embodiments, CD40-L has 80.00% to up to 99.99% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity with human wild-type CD40-L (e.g., CD40-L of SEQ ID NO: 6).
CD40-L may be a chimeric CD40-L or a non-chimeric CD40-L polypeptide. In some embodiments, the CD40-L expressed in an oncolytic virus of the invention is chimeric CD40-L. Such chimeric CD40-L polypeptides comprise CD40-L domains or subdomains from at least two different species, such as human and mouse CD40-L. Chimeric CD40-L may provide a higher stimulation of immune responses than naturally occurring CD40-L. Examples of chimeric CD40-L suitable for use in the present invention are disclosed in U.S. Pat. Nos. 7,495,090, 7,928,213 and 8,138,310. Each of these patents is incorporated by reference herein in its entirety.
In certain embodiments of chimeric CD40-L, at least one domain or subdomain of CD40-L comprises a cleavage site for human CD40-L and is substituted with a corresponding domain or subdomain of non-human CD40-L, preferably murine CD40-L. In addition, chimeric CD40-L may comprise a domain or subdomain of human CD40-L that binds to the CD40-L receptor. Domains I to IV of human CD40-L (SEQ ID NO: 6) correspond to SEQ ID NO: amino acid portions 1-14, 14-45, 46-110 and 111-261 of 6. Based on sequence alignment of non-human CD40-L with human CD40-L, the skilled artisan can determine domains I through IV of non-human CD40-L. Certain domain positions for non-human CD40-L are provided in Table 1 of U.S. Pat. No. 7,495,090, which is incorporated herein by reference in its entirety.
In some embodiments, chimeric CD40-L comprises a first subdomain of non-human CD40-L, wherein the subdomain replaces the cleavage site of human CD40-L, and a second subdomain of human CD40-L that binds to the CD40-L receptor.
The first subdomain may comprise a subdomain of domain IV of non-human CD40-L. Furthermore, the first subdomain may also comprise domain III of non-human CD40-L, or subdomain or domain III. In certain embodiments, the first subdomain replaces a portion of the cleavage site of human CD40-L. In a further embodiment, the chimeric CD40-L comprises a domain II or a subdomain of domain II of a non-human CD40-L in addition to domain IV or a subdomain of domain IV, and optionally domain III or a subdomain of domain III. In addition, the first subdomain of chimeric CD40-L may comprise domain I or a subdomain of domain I of non-human CD40-L. Thus, in some chimeric CD40-L, the first subdomain comprises domains or subdomains of domains I, II, III, and IV of non-human CD40-L. In a preferred embodiment, the non-human CD40-L is murine CD40-L.
In a preferred embodiment, the chimeric human/mouse CD40 ligand has 92% amino acid sequence homology with human CD40L (SEQ ID NO: 12) (see, U.S. Pat. No. 7,495,090, incorporated herein by reference and referred to herein as "MEM 40"). "CD40 ligand" and "CD40-L" are used interchangeably herein and may also be referred to as "CD154". Specifically, domains I, II and III-regions comprising the intracellular, intramembrane and proximal extracellular domains, respectively, of this molecule-have been fully humanized. Of domain IV comprising the CD40 binding portion of the molecule, only those murine domains are retained that are necessary for optimal CD40 ligand expression in the cell. MEM40 is fully humanized at the 3' end of the molecule, wherein antibody binding neutralizes the activity of murine CD154 (CD 40 ligand) when administered to humans.
Non-limiting examples of chimeric CD40-L useful in the present invention include the following sequences:
SEQ ID NO:7
MIETYSQPSPRSVATGLPASMKIFMYLLTVFLITQMIGSVLFAVYLHRRLDKVEEEVNLHEDFVFIKKLKRCNKGEGSLSLLNCEEMRRQFEDLVKDITLNKEEKKENSFEMQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
SEQ ID NO:8
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
SEQ ID NO:9
MIETYSQPSPRSVATGLPASMKIFMYLLTVFLITQMIGSVLFAVYLHRRLDKVEEEVNLHEDFVFIKKLKRCNKGEGSLSLLNCEEMRRQFEDLVKDITLNKEEKKENSFEMQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
SEQ ID NO:10
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
SEQ ID NO:11
MIETYSQPSPRSVATGLPASMKIFMYLLTVFLITQMIGSVLFAVYLHRRLDKVEEEVNLHEDFVFIKKLKRCNKGEGSLSLLNCEEMRRQFEDLVKDITLNKEEKKENSFEMQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
SEQ ID NO:12
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
SEQ ID NO:13
MIETYSQPSPRSVATGLPASMKIFMYLLTVFLITQMIGSVLFAVYLHRRLDKVEEEVNLHEDFVFIKKLKRCNKGEGSLSLLNCEEMRRQFEDLVKDITLNKEEKKENSFEMQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIVGLWLKPSSGSERILLKAANTHSSAKPCGQQSIHLGGVFELQPGASCFVNVTDPSQVSHGTGFTSFGLLKL
SEQ ID NO:14
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIVGLWLKPSSGSERILLKAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
SEQ ID NO:15
MIETYSQPSPRSVATGLPASMKIFMYLLTVFLITQMIGSVLFAVYLHRRLDKVEEEVNLHEDFVFIKKLKRCNKGEGSLSLLNCEEMRRQFEDLVKDITLNKEEKKENSFEMQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
SEQ ID NO:16
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
SEQ ID NO:17
MIETYSQPSPRSVATGLPASMKIFMYLLTVFLITQMIGSVLFAVYLHRRLDKVEEEVNLHEDFVFIKKLKRCNKGEGSLSLLNCEEMRRQFEDLVKDITLNKEEKKENSFEMQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
SEQ ID NO:18
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
encoding SEQ ID NO: certain nucleotide sequences of chimeric CD40-L of 7 to 18 are disclosed in U.S. Pat. Nos. 7,495,090, 7,928,213 and 8,138,310. These nucleotide sequences are incorporated herein by reference, and the use of such nucleotide sequences is contemplated herein.
Oncolytic viruses of the invention may comprise a nucleic acid encoding an IFN- α, wherein the IFN- α comprises human wild-type IFN- α (SEQ ID NO: 1) or has 80.00% to at most 99.99% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to human wild-type IFN- α (e.g., IFN- α of SEQ ID NO: 1).
Oncolytic viruses of the invention may comprise a nucleic acid encoding an IFN- β, wherein the IFN- β comprises a human wild-type IFN- β (SEQ ID NO: 2) or has 80.00% to at most 99.99% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to a human wild-type IFN- β (e.g., IFN- β of SEQ ID NO: 2). In particular embodiments, the nucleic acid sequence encodes an IFN- β lacking the sequence of SEQ ID NO:2, and optionally further having 17 cysteine substitutions to obtain a 165 amino acid peptide having serine.
Oncolytic viruses of the invention may comprise a nucleic acid encoding IFN- ε, wherein IFN- ε comprises human wild-type IFN- ε (SEQ ID NO: 3) or has 80.00% to 99.99% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to human wild-type IFN- ε (e.g., IFN- β of SEQ ID NO: 3).
Oncolytic viruses of the invention may comprise a nucleic acid encoding an IFN-kappa, wherein the IFN-kappa comprises human wild-type IFN-kappa (SEQ ID NO: 4) or has 80.00% to at most 99.99% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to human wild-type IFN-kappa (e.g., IFN-kappa of SEQ ID NO: 4).
Oncolytic viruses of the invention may comprise a nucleic acid encoding an IFN- ω, wherein the IFN- ω comprises a human wild-type IFN- ω (SEQ ID NO: 5) or has 80.00% to at most 99.99% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to a human wild-type IFN- ω (e.g., IFN- ω of SEQ ID NO: 5).
Oncolytic viruses of the invention may comprise a nucleic acid encoding CD40-L, wherein the CD40-L comprises human wild-type CD40-L (SEQ ID NO: 6) or CD40-L having 80.00% to at most 99.99% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity to human wild-type CD40-L (e.g., CD40-L of SEQ ID NO: 6). The oncolytic viruses of the present invention may comprise a nucleic acid encoding a chimeric CD40-L, wherein the chimeric CD40-L has a sequence selected from the group consisting of SEQ ID NOs: 7 to 18 or with a sequence having a sequence selected from SEQ ID NOs: the chimeric CD40-L of the sequences of 7 to 18 has a CD40-L that comprises 80.00% to at most 99.99% (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
In a preferred embodiment, the oncolytic virus of the present invention may comprise a nucleic acid encoding MEM 40. For example, in a preferred embodiment, the oncolytic virus of the invention comprises an IFN beta having at least 80% sequence identity to a human IFN beta (SEQ ID NO: 2) and has the sequence of SEQ ID NO:12, the chimeric CD40-L has at least 80% sequence identity to CD40-L.
One or more heterologous nucleic acid sequences encoding a combination of type I IFN and CD40-L may be present in one or more viral constructs. Non-limiting examples of viral constructs include adenovirus constructs, adeno-associated virus constructs (AAV), poxvirus constructs, lentivirus constructs, alpha virus constructs (alphaviral construct), herpes virus constructs, retrovirus constructs, vaccinia virus constructs, vesicular stomatitis virus constructs, or herpes simplex virus constructs.
In addition to nucleic acids encoding type I interferon (e.g., IFNP) and CD40-L (chimeric human/mouse CD 40L), oncolytic viruses according to the invention may also comprise other modifications in their genome. For example, it may contain additional DNA inserted into a gene that has been inactivated or substituted for the deleted gene. Oncolytic viruses may also incorporate one or more promoters therein that confer an enhanced level of tumor cell specificity to the virus. In this way, oncolytic viruses can be targeted to specific cancer types using cancer cell-specific promoters. The term "tumor cell-specific promoter" or "tumor cell-specific transcriptional regulatory sequence" or "tumor-specific promoter" or "tumor-specific transcriptional regulatory sequence" means transcriptional regulatory sequences, promoters and/or enhancers that are present in a target cancer cell at a higher level than in a normal cell. For example, oncolytic viruses may be used in the present invention under the control of exogenously added modulators.
In a preferred embodiment, the oncolytic virus is an adenovirus (Ad). Ad is a large (about 36 kb) DNA virus that infects humans, but also shows a broad host range. Physically, adenoviruses are icosahedral viruses that comprise a double-stranded linear DNA genome. Human adenoviruses are of about 50 serotypes, and are divided into six families according to molecular, immunological and functional criteria. By adulthood, nearly everyone is infected with adenovirus serotypes with the more common primary effect being cold-like symptoms.
Adenovirus infection of the host cell results in the maintenance of adenovirus DNA in free form, which reduces the potential genotoxicity associated with integrating vectors. In addition, adenoviruses are structurally stable and no genomic rearrangement is detected after extensive amplification. Adenoviruses can infect most epithelial cells, regardless of the stage of their cell cycle. Up to now, adenovirus infection appears to be associated with only mild diseases (e.g. acute respiratory diseases in humans).
The adenovirus infection cycle occurs in two steps: early stages before the start of adenovirus genome replication allow the production of regulatory proteins and proteins involved in viral DNA replication and transcription, as well as late stages leading to the synthesis of structural proteins. Early genes are distributed in 4 regions scattered in the adenovirus genome, designated as E1 to E4 ("E" means "early"). The early region contains at least six transcription units, each with its own promoter. The expression of early genes is itself regulated, with some genes being expressed before others. The three regions E1, E2 and E4 are critical for viral replication. Thus, if one of these functions of the adenovirus is defective, the protein must be provided in trans, otherwise the virus will not replicate.
The E1 early region is located 5' to the adenovirus genome and comprises 2 viral transcription units E1A and E1B. The protein encoded by this region is involved in the very early stages of the viral cycle and is critical for the expression of almost all other genes of adenovirus. In particular, the E1A transcription unit encodes a protein that transactivates transcription of other viral genes, inducing transcription from the promoters of the E1B, E2A, E2B, E3 and E4 regions and late genes.
Adenovirus enters the permissive host cell through a cell surface receptor and is then internalized. Viral DNA associated with certain viral proteins required in the first step of the replication cycle enters the nucleus of the infected cell where transcription begins. Replication of adenovirus DNA occurs in the nucleus of the infected cell and cell replication is not required. After the new viral particles or virions are assembled, they are released from the infected cells and may infect other allowed cells.
Adenoviruses are an attractive delivery system. Embodiments of the present disclosure may utilize manufacturing processes that may be free or substantially free of proteins, serum, and animal derived components, making them suitable for use in a wide range of prophylactic and therapeutic vaccine products.
If the adenovirus has been mutated to replicate conditionally (replication-competent under certain conditions), helper cells may be required for viral replication. When desired, the helper cell line may be derived from a human cell, such as a human embryonic kidney cell, muscle cell, hematopoietic cell, or other human embryonic mesenchymal or epithelial cell. Alternatively, the helper cells may be derived from cells of other mammalian species that are permissive for human adenovirus. Such cells include, for example, vero cells or other monkey embryo mesenchymal cells or epithelial cells. In certain aspects, the helper cell line is 293. Various methods of culturing host cells and helper cells can be found in the art, for example (Racher, a.j., fooks, a.r., and Griffiths, j.b. biotechnol Tech (1995) 9:169).
1. Delivery of drug carriers/drug products
As noted above, the compositions may also be administered in vivo in a pharmaceutically acceptable carrier. By "pharmaceutically acceptable" is meant a material that is biologically or otherwise undesirable, i.e., the material may be administered to a subject with a nucleic acid or vector without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained. The carrier will naturally be selected to minimize any degradation of the active ingredient and to minimize any adverse side effects in the subject, as is well known to those skilled in the art.
The compositions may be administered orally, parenterally (e.g., intravenously), by intramuscular injection, by intraperitoneal injection, transdermally, extracorporeally, topically, etc., including topical intranasal administration or inhalation administration. As used herein, "topical intranasal administration" refers to delivery of a composition into the nose and nasal passages through one or both nostrils, and may include administration by a spray mechanism or a droplet mechanism, or by nebulization of a nucleic acid or carrier. Administration of the composition by inhalation may be by nasal or oral delivery by a spray or droplet mechanism. It may also be delivered directly to any area of the respiratory system (e.g., the lungs) through a cannula. The exact amount of the composition required will vary from subject to subject, depending on the species, age, weight and general condition of the subject, the severity of the allergic disease being treated, the particular nucleic acid or vector used, its mode of administration, and the like. Thus, it is not possible to specify an exact amount for each composition. However, the appropriate amount may be determined by one of ordinary skill in the art using only routine experimentation given the teachings herein.
Parenteral administration of the composition, if used, is typically characterized by injection. Injections may be prepared in conventional forms, such as liquid solutions or suspensions, solid forms of solutions suitable for suspension in a liquid prior to injection, or emulsions. A recently modified method for parenteral administration involves the use of slow or sustained release systems to maintain a constant dose. See, for example, U.S. Pat. No. 3,610,795, incorporated herein by reference.
The material may be a solution, suspension (e.g., incorporated into microparticles, liposomes, or cells). These may be targeted to a particular cell type by antibodies, receptors or receptor ligands. The following references are examples of using this technique to target specific proteins to tumor tissue (Senter et al, bioconjugate chem.,2:447-451, (1991); bagshawe, K.D., br.J.Cancer,60:275-281, (1989); bagshawe et al, br. J. Cancer,58:700-703, (1988); senter et al, bioconjugate chem.,4:3-9, (1993); battelli et al, cancer immunol. Immunother.,35:421-425, (1992); pieteersz and McKenzie, immunolog.Reviews,129:57-80, (1992); roffer, et al, biochem. Pharmacol,42:2062-2065, (1991)). Vectors such as "stealth" (stealth) and other liposome-coupled antibodies (including lipid-mediated colon cancer targeting drugs), receptor-mediated DNA targeting by cell-specific ligands, lymphocyte-directed tumor targeting, and highly specific therapeutic retroviral targeting of mouse glioma cells in vivo. The following references are examples of targeting specific proteins to tumor tissue using this technique (Hughes et al, cancer Research,49:6214-6220, (1989), and Litzinger and Huang, biochimica et Biophysica Acta,1104:179-187, (1992)). In general, receptors are involved in the endocytic pathway, either constitutive or ligand-induced. These receptors accumulate in clathrin-coated cells, enter the cells through clathrin-coated vesicles, pass through acidified endosomes in which the receptors are classified, and then are recycled to the cell surface for storage in the cell or degradation in lysosomes. The internalization pathway has a variety of functions, such as nutrient uptake, removal of activated proteins, clearance of macromolecules, opportunistic entry of viruses and toxins, dissociation and degradation of ligands, and receptor level modulation. Many receptors follow more than one intracellular pathway, depending on the cell type, receptor concentration, ligand type, ligand valency and ligand concentration. The molecular and cellular mechanisms of receptor-mediated endocytosis have been reviewed (Brown and Greene, DNA and Cell Biology 10:6, 399-409 (1991)).
a) Pharmaceutically acceptable carrier
The compositions, including antibodies, may be used in combination with a pharmaceutically acceptable carrier.
Suitable carriers and formulations thereof are described in "leimington: pharmaceutical science and practice (Remington: the Science and Practice of Pharmacy) (19 th edition) is described in Easton, pa., 1995, by the company Mack publishing, A.R. Gennaro. Typically, an appropriate amount of a pharmaceutically acceptable salt is used in the formulation to render the formulation isotonic. Examples of pharmaceutically acceptable carriers include, but are not limited to, saline, ringer's solution, and dextrose solution. The pH of the solution is preferably from about 5 to about 8, more preferably from about 7 to about 7.5. Other carriers include sustained release formulations such as semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, liposomes, or microparticles. It will be apparent to those skilled in the art that certain carriers may be more preferred depending, for example, on the route of administration and the concentration of the composition to be administered.
Drug carriers are known to those skilled in the art. These are most typically standard carriers for administration to humans, including solutions such as sterile water, saline, and buffered solutions at physiological pH. The composition may be administered intramuscularly or subcutaneously. Other compounds will be administered according to standard procedures used by those skilled in the art.
In addition to the selected molecules, the pharmaceutical compositions may contain carriers, thickeners, diluents, buffers, preservatives, surfactants and the like. The pharmaceutical composition may also contain one or more active ingredients, such as antimicrobial agents, anti-inflammatory agents, anesthetics, and the like.
The pharmaceutical compositions may be administered in a variety of ways depending on whether local or systemic treatment and the area to be treated is desired. Administration may be topical (including ocular, vaginal, rectal, intranasal), oral, by inhalation, or parenteral, for example by intravenous drip injection, subcutaneous injection, intraperitoneal injection, or intramuscular injection. The disclosed antibodies can be administered intravenously, intraperitoneally, intramuscularly, subcutaneously, intracavity, or transdermally.
Formulations for parenteral administration include sterile aqueous or nonaqueous solutions, suspensions and emulsions. Examples of nonaqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil and injectable organic esters such as ethyl oleate. The aqueous carrier comprises water, an alcohol/water solution, an emulsion or a suspension, including saline and a buffer medium. Parenteral carriers include sodium chloride solution, ringer's dextrose, dextrose and sodium chloride, ringer's lactate solution, or fixed oils. Intravenous infusion includes liquid and nutritional supplements, electrolyte supplements (such as those based on ringer's dextrose), and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like.
Formulations for topical administration may include ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders. Conventional pharmaceutical carrier matrices, aqueous matrices, powder matrices or oily matrices, thickeners, and the like may be necessary or desirable.
Compositions for oral administration comprise powders or granules, suspensions or solutions in water or non-aqueous media, capsules, sachets or tablets. Thickeners, flavoring agents, diluents, emulsifiers, dispersing aids or binders may be required.
Certain compositions may potentially be administered as pharmaceutically acceptable acid or base addition salts formed by reaction with inorganic acids such as hydrochloric, hydrobromic, perchloric, nitric, thiocyanate, sulfuric and phosphoric acids, and organic acids such as formic, acetic, propionic, glycolic, lactic, pyruvic, oxalic, malonic, succinic, maleic and fumaric acids, or by reaction with inorganic bases such as sodium hydroxide, ammonium hydroxide, potassium hydroxide, and organic bases such as mono-, di-, tri-and aryl amines and substituted ethanolamines.
b) Therapeutic use
The effective dosage and schedule of administration of the composition can be determined empirically and making such decisions is within the purview of those skilled in the art. The compositions are administered in a dosage range large enough to produce the desired effect affecting the symptoms of the disorder. The dosage should not be so large as to cause deleterious side effects such as undesired cross-reactions, allergic reactions, and the like. Generally, the dosage will vary with the age, condition, sex and extent of disease of the patient, the route of administration or whether other drugs are included in the regimen, and can be determined by one skilled in the art. In the case of any contraindications, the individual physician can adjust the dosage. The dosage may vary and may be administered in one or more doses per day for one or more days. Guidance regarding the proper dosage of a given class of drugs can be found in the literature. Guidance for selection of appropriate doses of antibodies can be found, for example, in the literature for antibody therapeutic use, e.g., in monoclonal antibody handbook (Handbook of Monoclonal Antibodies), ferrone et al eds, noges Publications, park Ridge, n.j. (1985) ch.22 and pp.303-357; smith et al, antibodies in human diagnosis and therapy (Antibodies in Human Diagnosis and Therapy), haber et al, eds., raven Press, new York (1977) pp.365-389. Typical daily doses of antibody used alone may range from about 1 μg/kg to up to above 100mg/kg body weight per day, depending on the factors described above.
C. Methods of treating cancer
The disclosed compositions may be used to treat any disease in which uncontrolled cell proliferation occurs, such as cancer. A representative but non-limiting list of cancers that the disclosed compositions can be used to treat is as follows: lymphomas; b cell lymphoma; t cell lymphomas; mycosis fungoides; hodgkin's disease; myeloid leukemia; bladder cancer; brain cancer; cancers of the nervous system; cancer of head and neck; squamous cell carcinoma of head and neck; lung cancer, such as small cell lung cancer and non-small cell lung cancer; neuroblastoma/glioblastoma; ovarian cancer; skin cancer; liver cancer; melanoma; squamous cell carcinoma of the mouth, throat, and lungs; cervical cancer; cancer of the cervix; breast cancer; epithelial cancer; renal cancer; genitourinary system cancer; lung cancer; esophageal cancer; cancer of the head and neck; colorectal cancer; hematopoietic cancers; testicular cancer; colon cancer; rectal cancer; prostate cancer or pancreatic cancer.
In one aspect, disclosed herein is a method of treating, reducing, inhibiting, reducing, ameliorating, and/or preventing cancer and/or cancer metastasis (including distant tumors) in a subject comprising administering to the subject any of the amplified TILs or MILs disclosed herein. For example, disclosed herein are methods of treating, alleviating, inhibiting, reducing, ameliorating, and/or preventing cancer and/or cancer metastasis in a subject comprising: a) Administering an oncolytic virus expressing one or more type 1 Interferons (IFNs) (e.g., IFN- α, IFN- β, IFN- κ, IFN- δ, IFN- ε, IFN- τ, IFN- ω, and/or IFN- ζ) and/or one or more exogenous immunostimulatory molecules (e.g., CD40-L, MEM, B7-1 (CD 80)/B7-2 (CD 86), OX40L, 4-1BBL, CD70, GITRL, LIGHT, TIM-4, ICAM-1, CD58, and/or SLAMF 6) into a tumor cell; b) Collecting tumor-infiltrating lymphocytes (TIL) and/or bone marrow-infiltrating lymphocytes (MILs); c) Amplifying the collected TIL and/or MIL ex vivo; and d) administering the amplified TIL and/or MIL to the subject. In some aspects, the cancerous or metastatic tumor treated, reduced, inhibited, reduced, ameliorated, and/or prevented is distant from a tumor that receives any oncolytic virus and/or TIL or MILs disclosed herein.
Alternatively, TIL or MIL may be first harvested from a tumor and then expanded ex vivo in the presence of antigen presenting cells infected with an oncolytic virus expressing one or more type 1 Interferons (IFNs) and/or one or more exogenous immunostimulatory molecules; and administering the amplified TIL and/or MILs to the subject. The amplified TIL or MILs may then be sequentially administered (adoptive transfer) to a subject with cancer. Thus, in one aspect, disclosed herein are methods of treating, alleviating, inhibiting, reducing, ameliorating, and/or preventing cancer and/or cancer metastasis in a subject comprising a) harvesting tumor-infiltrating lymphocytes (TILs) and/or bone marrow-infiltrating lymphocytes (MILs) from a subject having cancer; culturing the harvested TIL or MILs in the presence of antigen presenting cells infected with an oncolytic virus that expresses one or more type 1 Interferons (IFNs) (e.g., IFN- α, IFN- β, IFN- κ, IFN- δ, IFN- ε, IFN- τ, IFN- ω, and/or IFN- ζ) and/or one or more exogenous immunostimulatory molecules (e.g., CD40-L, MEM40, B7-1 (CD 80)/B7-2 (CD 86), OX40L, 4-1BBL, CD70, GITRL, LIGHT, TIM-4, ICAM-1, CD58, and/or SLAMF 6); and administering the amplified TIL and/or MILs to the subject.
In one aspect, it is understood and contemplated herein that successful treatment of cancer in a subject is important and that doing so may include administration of additional treatments. Accordingly, it is contemplated that the methods of treating, inhibiting, alleviating and/or preventing cancer disclosed herein may be enhanced by any cancer treatment, including, but not limited to, surgical, radiation and/or pharmaceutical treatment of cancer. Thus, the treatment of the present disclosure may include and/or further include any anti-cancer therapy known in the art, including but not limited to Abemacili (Abemacilib), abiraterone acetate, methotrexate (methotrexate), albumin paclitaxel (paclitaxel albumin stabilized nanoparticle formulation), ABVD, ABVE, ABVE-PC, AC-T, bentuximab (vitamin B), ADE, trastuzumab-maytansine conjugate, doxorubicin (doxorubicin hydrochloride), alfutilin dimaleate, feitinib (everolimus), ozagrypitant (netupitant and palonosetron hydrochloride), imiquimod (Imiqumod), aldesinterleukin, ai Leti-ni (Alatinib), aletinib, alemtuzumab, praecorata (disodium), coupananic (gemcitabine hydrochloride (354235), injection use of MALALABRANL (melphalan hydrochloride), MALALALALALALAL (melem), palonosetron hydrochloride), panoramide (palonosetron hydrochloride), 84 (buntinib), fluzamide (benzogline), prandine (Alexazobactam, asprine (Alexamide), aspride (Alexazobactam), asprine (Alexamide), alexazopran (Alexazobactam, alexade (Alexazopran), alexade (Alexazopraline), alexazopran (Alexaratan), alexaratan (Alexazone, alexapraline (Alexa) and Alexapraline (Alexa), altilizumab, avastin (bevacizumab), avistuzumab, axitinib, azacytidine, avistuzumab (bavendio/Avelumab), BEACOPP, carmustine (Becenum/Carmustine), beliostat (beloodaq/Belinostat), beliostat (Belinostat), bendamustine hydrochloride, BEP, oxbeuzumab (Besponsa/Inotuzumab Ozogamicin), bevacizumab, bexarotene, bucking (tositumomab and iod [131I ] tositumomab), bicalutamide, biCNU (Carmustine), bleomycin, bolimab, belitude (bortezomib), bortezomib (Bosutinib/Bosutinib), bosutinib, beniximab, buzanib, busulfan white sulfebuxine, cabazitaxel, cabazithromycin (cabazithromycin malate), cabazithromycin, CAF, canpase (alemtuzumab), irinotecan (irinotecan hydrochloride), capecitabine, CAPOX, fluorouracil (fluorouracil-topical), carboplatin-paclitaxel, carfilzomib, carmustine (carmubis/Carmustine), carmustine implant, constantan (bicalutamide), CEM, ceritinib, secatinib hydrochloride (daunorubicin hydrochloride), donepezil (recombinant HPV bivalent vaccine), cetuximab, CEV, chlorambucil-prednisone, CHOP, cisplatin, cladribine, cyclophosphamide (Clafen/cyclophospamide), clofarabine, clofarex/Clofarabine, CMF, cobratinib, cabazithromycin (cabazithromycin malate), copperac acid, COPDAC, COPP, COPP-ABV, actinomycin (Cosmegen/Dactinomycin), cobratinib (cobmetinib), crizotinib, CVP, cyclophosphamide, cyfos (ifosfamide), and Ramopirumab (Cyramza/Ramucicrumab), cytarabine liposome, sidamasca-U (cytarabine), cyclophosphamide (Cytoxan/Cyclophosphamide), dabrafenib, dacarbazine, decitabine (Dacog/Decistabine), actinomycin, darimumab (Darzalex/Daratumumab), dasatinib, daunorubicin hydrochloride, daunorubicin daunorubicin hydrochloride and cytarabine liposomes, decitabine, sodium defibrinate (Defitelio/Defibrotide Sodium), degarelix, dimesleukin, denolizumab, liposomal cytarabine (DepoCyt/Cytarabine Liposome), dexamethasone, dexrazoxane hydrochloride, denotuximab, docetaxel, doxycycline (doxorubicin hydrochloride liposomes), doxorubicin hydrochloride liposomes, dox-SL (doxorubicin hydrochloride liposomes), dacarbazine injection (dacarbazine), devaluzumab, fluoxetine (fluorodioxetine-topical), irinotecan (labyrin), epirubicin hydrochloride, erltuzumab, lenxadine (oxaliplatin), oxepin, etrazopraline, izomet, embodiment (aprepitant), embotuzumab (Emplititi/Elotuzumab), ensibirin mesylate, enzalutamine, epirubicin hydrochloride, EPOCH, erbitux (cetuximab), eribulin mesylate, vermod gedy/Vismodytab, erlotinib hydrochloride, yiwann (EmbH asparaginase), amiforin (amifostine), etoposide (etoposide phosphate), etoposide, doxorubicin (doxorubicin hydrochloride) liposomes, everolimus, raloxifene (raloxifene hydrochloride), uvulvonine (melphalan hydrochloride), exemestane, 5-FU (fluorouracil injection) 5-FU (fluorouracil-topical), fabryostat (toremifene), prabinostat (Farydak/Panobinostat), fulvestrant (Falodex/Fulvestrant), FEC, letrozole (Femara/Letrozole), fegrid, fludarabine (fludarabine phosphate), fludarabine phosphate, fluorouracil (fluorouracil-topical), fluorouracil injection, fluorouracil-topical, fluotamide, fluoxetine (methotrexate), folex PFS (methotrexate), irinotecan-bevacizumab, irinotecan-cetuximab, oxaliplatin (LFIRINOX), oxaliplatin (FOLFOX), prasufloxacin (Foloton/Pralarexa), FU-LV, fluoretinide, additional Wei Miao (recombinant HPV tetravalent vaccine), jiujiujiadaprocess (recombinant HPV nine vaccine), ozyme You Tuozhu mab (Gazyva/Obenutuzumab), gefitinib, gemcitabine hydrochloride, gemcitabine cisplatin, gemcitabine-cisplatin, gemtuzumab, gemcitabine hydrochloride, ji Tairui (bimetanide), glibenc (imatinib mesylate), gliclazide (carmustine implant), carmustine implant (carmustine implant), carboxypeptidase, goserelin acetate, eskibulin mesylate (Halaven/Eribulin Mesylate), propranolol hydrochloride (hemageol/Propranolol Hydrochloride), herceptin (trastuzumab), HPV bivalent vaccine, recombinant HPV nine vaccine recombinant HPV tetravalent vaccine, recombinant, cancer-condine (topotecan hydrochloride), hydroxyurea (hydroea/Hydroxyurea), hydroxyurea, high dose-CVAD, ebosin (Pabosutinib), temozolomide, ibrutinib, ICE, ponatinib (Prazotinib hydrochloride), idarubicin (idarubicin hydrochloride), idarubicin hydrochloride, ideranine, encidipine (Encidipine mesylate), ifex (Ifosfamide), ifosfamide (Ifosfamide/Ifosfamide), IL-2 (aldinterleukin), imatinib mesylate, ibutenib, devaluzumab (Imfinzi/Durvalumab), imiquimod, encidipine (Encidipine mesylate), ifex (Ifosfamide), ifosfamide, and other pharmaceutical compositions, imlygic (La-Tarillim (Talimogene Laherparepvec)), axitinib (Inlyta (Axitinib), orituximab, recombinant interferon alpha-2 b, recombinant interferon-2 (Aldiliginet), gan Le-energy A (recombinant interferon alpha-2 b), iodine [131I ] toxilimumab and toxilimumab, ipilimumab, iridamide (gefitinib), irinotecan hydrochloride liposome, romidepsin (Istodax/Romidepsin), ixabepilone, igafungin citrate, ixempron (Ixempra/Ixabepilone), ponitinib (ruxotinib phosphate), JEB, cabazitaxel (Jevtan/Cabazitaxel), trastuzumab (o-Adtrastuzumab-mevalnovel conjugate), and Raloxifene (raloxifene hydrochloride), paliff (Kepimobendan/Palifemin)), coryda (pembrolizumab), rebamiphene (Kisqali/Ribociclib), s Li Fuming (Kymriah/Tisamplelec Leucel), carfilzomib (Kyprolis/Carfilzomib), lanreotide acetate, lapatinib tosylate, olanizumab (Lartruvo/Olamaumab), lenalidomide, lenvatinib mesylate, lenvatinib (Levalatinib mesylate), letrozole, calcium folinate, octonine (Leukeran/Choramb), leuprorelin acetate, cladribine (Leustaine/Cladribine), levan (aminolevulinic acid), linezolid (Onconine), lipodox (doxorubicin hydrochloride), lenaline (Leustoride), the pharmaceutical compositions comprise roflumidine, troluridine (troluridine and tepirimidine hydrochloride), leuprolide acetate (Lupron/Leuprolide Acetate), leuprolide acetate microspheres (Lupron Depot) (leuprolide acetate), leuprolide acetate microspheres for injection (Lupron Depot-peg) (leuprolide acetate), olaparib (lynparaza/Olaparib), vincristine sulfate liposome injection (vincristine sulfate liposome), methylbenzyl hydrazine (methylbenzyl hydrazine hydrochloride), nitrogen mustard, megestrol acetate, trimetinib (Mekinist/trametinb), melphalan hydrochloride, mercaptopurine, mesna, mesnex/Mesna), temozolomide (Methalfastone/Temozolomide), methotrexate methotrexate LPF (Methotrexate), methylnaltrexone bromide, methotrexate (Mexate/methotrexa), methotrexate-AQ (Methotrexate), midostaurin, mitomycin C, mitoxantrone hydrochloride, mitomycin (Mitozytrex) (mitomycin C), MOPP, plexafu (Mozobil/plaixfor), nitrogen mustard (nitrogen mustard hydrochloride), mitomycin (mitomycin C), busulfan (mylaran/Busulfan), azacytidine (azacytidine), gemtuzumab (Mylotarg/Gemtuzumab Ozogamicin), paclitaxel nanoparticles (paclitaxel albumin stabilized nanoparticle formulation), noveltamitraz (vinorelbine tartrate), rituximab, nelarabine, cyclophosphamide (Neosar), nevirapine, lenatinib maleate, lenatinib (lenatinib maleate), netupitant and palonosetron hydrochloride, pefepristine (neuassta/Pegfilgrastim), fepristine (neuogen/Filgirstim), sorafenib tosylate (Nexavar/Sorafenib Tosylate), nilamide (niladron/Nilutamide), nilotinib, nilamide, i Sha Zuo m (Sha Zuo m), nilapamide monohydrate, niwuzumab, tamoxifen (tamoxifen citrate), romisettin (nplatte/romiplos), oxybutynin You Tuozhu monoclonal antibody, sonidegin (Odomzo/sonideginb), OEPA, ofloxamu monoclonal antibody, OFF, olaparib, homoharringtonine, asparaginase (Oncapar/pespargase), hydrochloride irinotecan hydrochloride liposomes (Onivyde/Irinotecan Hydrochloride Liposome), dimesleukin (Ontak/Denileukin Diftitox), nivolumab (Opdivo/Nivolumab), OPPA, ornitanib, oxaliplatin, paclitaxel albumin stabilized nanoparticulate formulations, PAD, palbociclib, palivomim, palonosetron hydrochloride and netupitant, pamidronate disodium, panitumumab, panitustat, pazopanib (Carboplatin), carboplatin (Paraplatin/Carboplatin), pazopanib hydrochloride, PCV, PEB, peginase, pefegliptin, pegylated alpha-2 b interferon, petaloenergy (pegylated alpha-2 b interferon), pembrolizumab, pemetrexed disodium, pertuzumab (Pertuta/jezumab), pertuzumab, cisplatin/cispratin, cisplatin-AQ (Cisplatin), praisafu, pomalidomide (Pomalidomide/Pomalidomide), ponatinib monohydrochloride, cetuximab (portraza/necitramulab), pralatrexed, prednisone, procarbazine hydrochloride, aldinterleukin (promeukin/Aldesleukin), pra Luo Li (dieselimab), eltrapopap (Ai Qubo pamine), propranolol hydrochloride, plaguezide (profenoki-T), mercaptopurine (pureethhol/mercaptepurine), mercaptopurine (puroxan/mercaptoprene), 223 dichloro, raloxifene hydrochloride, lei Molu monoclonal antibody, labyrinase, R-CHOP, R-CVP, recombinant human papilloma virus (bivalent HPV) vaccine recombinant Human Papillomavirus (HPV) nine-valent vaccine, recombinant Human Papillomavirus (HPV) tetravalent vaccine, recombinant interferon alpha-2 b, rigefenamide, bromomethylnaltrexone (methylnaltrexone bromide), R-EPOCH, lenalidomide (Revlimid/Lenalidomide), methotrexate (Rheumatrex/methotrex), rabocillin, R-ICE, rituximab (Rituximab/Rituximab), rituximab and hyaluronidase compositions (Rituximab and human hyaluronidase), rituximab and human hyaluronidase, roller-triptan hydrochloride, romide, romidepsin, erythromycins (daunorubicin hydrochloride), capenib (Rikappapyrisylate), the pharmaceutical composition comprises, in combination, ruxofenadine, ruxotinib phosphate, midostaurin (rydactyline/Midosatin), sterile talc aerosol (talc), rituximab, praline, lanreotide acetate (somatine Depot/Lanreotide Acetate), sonian gebub, sorafenib, dasatinib (Sprycel/Dasatinib), doxorubin (STANFORD V), sterile talc (talc), sterile talc particles (talc), regoramide (Stivarga/Regorafeib), sunitinib malate, sunitinib (sunitinib), polyethylene glycol interferon (polyethylene glycol alpha-2 b interferon), stetuximab (Sylvatin/Siltuximab), tricuspenside alkali (Synbot/Omacetaxine Mepesuccinate), thioguanine (Tableid/Thioguraine), talartinib (Talartinib/Dataenib), olanil), oxhide (Tafinamib), oxhide (Taxazin), tafmatin (Tafmatin/Tafmatin), tavanil (Tavanb), tavanil (Tavanneamide (Tavanb), talbox (Talbzocine/F), talbzocine (Talbox), talbox (Talbox), talbzocine (Talbox), talbox (Talbzob), talbzocine (Talbox) and other drugs (Talbuted/P-2 b), talbutinib (Talbuted), talbutinac (Talbuted) and (Talbuted) may be used in combination (Talbutinb) and may be used as drugs Topotecan hydrochloride, toremifene, temsirolimus (Torisel/Temsirimus), tositumomab and iodine [131I ] tositumomab, dexrazoxane (dexrazoxane hydrochloride), TPF, trabectedin, trametinib, trastuzumab, bendamustine (bendamustine hydrochloride), trofloxuridine and tepirimidine hydrochloride, arsenic Trioxide (Trisenox/Arsenic Trioxide), lapatinib (Lapatinib xylene sulfonate), denotuximab (Unituxin/Dinutuximab), uridine triacetate, VAC, vandetanib, VAMP, tarpitan (Lapidem hydrochloride), panitumumab (Vectibix/Panitumab), velp, vinblastine sulfate (Velban/Vinblastine Sulfate), velcade (bortezomib) vinblastine sulfate (Velsar/Vinblastine Sulfate), vemurafenib tablet, vinpockel (Venclexta/Venetoclax), venegram, glass fiber cilin (Verzenio/Abemaciclib), leuprorelin acetate implant (Leuprolide acetate), vedazab (azacytidine), vinblastine sulfate, vincristine PFS (vincristine sulfate), vincristine sulfate liposome, vinorelbine tartrate, VIP, vemoji, uridine triacetate (Vistogard/Uridine Triacetate), carboxypeptidase (Voraxaze/Glucoarpidase), vorinostat, pazopanib hydrochloride), daunorubicin+cytarabine composition (Vyxeos) (daunorubicin hydrochloride and cytarabine liposome), leucocyte (Wellcovarin/Leucovorin Calcium), folic acid, sicorydaline, XELIRI, XELOX, dirnosema (Xgeva/Denosumab), radium 223Dichloride (Xofigo/Radium 223 Dichloride), enzalutamide (Xtandi/Enzalutamide), yiprinima (Yervoiy/Ipain), trobin/trabectin, abelmosidene (Zaltrap/Ziv-Aflibeccept), femagistin (Zarcio/Filgastrim), then le (Nilapatinib monohydrate), zobevacine (vitamin Mo Feini), zevalin (Tivalin) (temozolomab), dex (dextrorotatum), abelmoschus, pivoxine (danserin hydrochloride), noridem (acetic acid), zoledronic acid (Zondatine/Vortide), or Albizizane acetate (Zidedate/Zibdate), and Albizizane. Chemotherapeutic agents (e.g., PD-1 inhibitors (Lambrolizumab), nivolumab, pembrolizumab, pilizumab, BMS-936559, atilizumab, dewaruzumab, or avermectin) are also contemplated herein as PDl/pdl blocking inhibitors.
D. Examples
The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and evaluate the compounds, compositions, articles, devices, and/or methods claimed herein, and are intended to be purely exemplary and are not intended to limit the disclosure. Efforts have been made to ensure accuracy with respect to numbers (e.g., amounts, temperature, etc.), but some errors and deviations should be accounted for. Unless otherwise indicated, parts are parts by weight, temperature is at or below ambient temperature, and pressure is at or near atmospheric pressure.
Example 1: immunostimulatory activity of human IFNbeta in a mouse model of melanoma
Animal studies using the same reagents as human trials are critical. However, this represents a biological problem, for example, the cross-reactivity between different human and mouse cytokines is very different for the use of cytokines. As noted above, it would be desirable to develop an OV expressing CD40L and human IFN beta as an anti-cancer therapeutic. IFNbeta in mice trigger signal transduction, although less than mouse IFN beta proficiency. Prior to OV development, it was first determined whether human IFN beta could trigger an anti-tumor T cell response in mice, as this is the primary focus of the present study. For this, we utilized a recently developed assay, where we found that irradiated B16-F10 or B16-OVA melanoma expressing mouse ifnβ could act as a potent prophylactic vaccine, with protection depending on CD8 and CD 4T cells (unpublished results). This approach is functionally similar to GM-CSF which expresses tumor cells (GVAX). B16-OVA cells were transduced with pLenti-Puro control lentiviruses or lentiviruses expressing mouse or human IFNbeta, followed by puromycin selection. The same number of cells were plated, after 2 days, the supernatant was collected for ELISA to detect human IFN beta and mouse IFN beta. Both human and mouse ifnβ were expressed at high levels, but higher levels of mouse ifnβ were detected (fig. 1A). Notably, both mouse and human ifnβ were found to be very effective in inducing T cell responses against tumor-encoded model antigens, although the mouse ifnβ induced a higher response (fig. 1B). The higher response to mouse ifnβ was likely due in part to higher expression (fig. 1A). Furthermore, this effect of human IFNbeta is strictly dependent on the presence of type 1 IFN receptor alpha 1 (IFNAR 1) in the host (FIG. 1B; similar results were obtained with independent experiments with mouse IFNbeta). Functionally, mouse and human IFNbeta are very effective in preventing tumor growth after challenge with live B16-OVA (FIG. 1C). These results indicate that human IFNbeta is also able to induce an anti-tumor T cell response in mice using OV.
Example 2: MEM-288 production and in vitro testing
We generated chimeric CD40L expression driven by the CMV promoter (fig. 2A) and added an expression cassette to drive human IFN beta expression (MEM-288) (fig. 2B) type 5 oncolytic adenovirus. As a control, we used adenoviruses expressing only GFP (Ad-GFP) and chimeric CD40L (MEM-188). All 3 viruses used contained a deletion of E1A D to allow specific replication and lysis of cancer cells (see figure 4 below). Infection of human A549 lung cancer strains with MEM-188 or MEM-288 induced high CD40L expression, as determined by flow cytometry, whereas infection with Ad-GFP resulted in high GFP expression (FIG. 3A). High secretion of IFNbeta into the culture supernatant was observed only after MEM-288 infection (FIG. 3B). Similar results were obtained in a number of other human cell lines. Studies on the B16-F10 melanoma cell line also demonstrated high transgene expression after MEM-288 infection (FIG. 3C) and secretion of IFN beta into culture supernatants (FIG. 3D). Cell death by OV is due to the replication of the virus in the infected cancer cells resulting in cell lysis. Type 1 IFN does not impair adenovirus replication. Notably, the mouse cells did not support adenovirus replication, consistent with our findings that Δ24-deleted viruses did not induce lysis of the mouse B16-F10 and 344SQ cell lines (fig. 4), whereas human a549 cells were readily lysed (fig. 4; MEM-288 is shown). These results indicate that in vivo mouse studies, the anti-tumor response induced by OV injection is more likely to be due to immunostimulation rather than oncolysis. Despite the lack of oncolytic effects in mouse cells, we refer to these viruses as OV to demonstrate their use in humans.
Example 3: study of murine melanoma model
One of the main preconditions for the use of intralesional methods is the possibility of generating a systemic anti-tumor immune response that can target non-injected lesions, i.e. trigger a distant effect. Thus, the main objective of these studies was to determine whether combined activation of CD40 and type 1 IFN signaling could generate a strong anti-tumor T cell response, thereby enabling inhibition of growth of injected and non-injected tumors. Studies of adenovirus with no replication capacity of non-oncolytic cells expressing MEM40/CD40L showed activity in the B16-F10 melanoma model. However, 4 injections of this virus were required to observe activity as a single agent or in combination with ICI.
We first studied in B16-OVA melanoma to allow tracking of OVA-reactive CD8T cells. Typical doses of adenovirus used in mice to determine the effect of anti-tumor therapy are 10e9-10 Infectious Units (IU). Lower dose 1×l0 8 Ad-GFP, MEM-188 and MEM-288 of (A) were used for intratumoral injection in the first experiment (FIG. 5A). Interestingly, MEM-288 showed a more significant reduction in tumor growth compared to Ad-GFP and MEM-188 (FIG. 5A). In the next experiment we used a 10e9 IU dose that was 10 times the previous dose of all 3 viruses, with MEM-288 injection resulting in the most significant reduction in tumor growth (fig. 5B). The above studies show that after 4 injections with adenovirus expressing MEM40/CD40L, significant activity was demonstrated. However, we did not see similar activity after two injections of MEM-188, suggesting that more durable CD40L expression may be required by multiple viral injections. MEM-288 also resulted in an increase in circulating OVA-specific CD8T cells, whereas MEM-188 did not (fig. 5C).
a) Effects of MEM-288 on systemic T cell responses: CD40 and IFNAR1 role.
For these studies we compared with PBS control using MEM-288 alone. The administration of MEM-288 into B16-OVA tumors resulted in a significant increase in the number of tumor-reactive CD 8T cells in the spleen of mice, as determined by ifnγ secretion (ELISPOT assay) (fig. 5D). To evaluate the role of CD40 and type 1 IFN signaling therein, we used CD40 and IFNAR1 KO mice carrying B16-OVA tumors. Importantly, the CD 8T cell response was significantly reduced in both IFNAR1 and CD40 KO mice (fig. 5D), indicating that both pathways are independently required for MEM-288 activity. The studies presented in the present application accurately determine how these 2 pathways play a role in activating T cell responses by studying APC and T cell regulation.
b) ICI-treated MEM-288 activity.
We wanted to determine the effect of MEM-288 intratumoral injection on injected tumor and on the growth of non-injected contralateral tumors (fig. 6A). Importantly, MEM-288 inhibited growth of both the injected tumor and the contralateral tumor (fig. 6B-6C). In contrast, ICI anti-CTLA 4 and anti-PD-1 therapies had minimal impact on tumor growth as known from this tumor model (fig. 6B-6C). These results indicate that MEM-288 has better efficacy in this tumor model compared to anti-ctla4+pd-1 treatment. Importantly, the combination of anti-ctla4+pd-1 and MEM-288 significantly reduced tumor growth compared to MEM-288 alone, indicating the benefits of ICI are more pronounced when combined with MEM-288 (fig. 6B-6C). Finally, MEM-288 alone increased the survival of mice, which effect was further enhanced when combined with ICI (fig. 6D). Thus, these results demonstrate that (a) topical MEM-288 administration induces strong distal activity as a single agent, and (b) ICI treatment benefits are manifested when used in combination with MEM-288 in ICI resistant tumor models.
Example 4: pulmonary metastasis model study
Subcutaneous injections of KRAS and TP53 mutant murine 344SQ (344) lung tumor cells were injected at the primary site to form tumors, followed by metastatic spread to the lung and other sites. We found that this model was resistant to PD-1 checkpoint blockade. The key issue we want to solve is the effectiveness of MEM-288 as a single agent in PD-1 refractory tumors. We show here whether MEM-288 induced T cell activation and expansion prevents metastatic spread and/or reduces primary tumor growth. Two doses of 10e9 IU of Ad-GFP, MEM-188 and MEM-288 were administered intratumorally 12 days after inoculation. Only MEM-288 administration resulted in a significant reduction in tumor growth by subcutaneous injection (fig. 7A). Tumor lesions in the lung were determined 38 days after tumor inoculation. As expected, mice injected subcutaneously with PBS into tumors had massive lung metastases (lungs mets), as was the case with mice injected with Ad-GFP and MEM-188 (FIGS. 7B-7C). In sharp contrast, MEM-288 injected mice had significantly reduced lung tumor lesions (fig. 7B-7C). Furthermore, tumor lesion size also appeared to be significantly smaller than in MEM-288 and MEM-188 injected mice. CD8 IHC further revealed a significantly higher TIL density in MEM-288 lung tumors and a lesser degree of MEM-188 treated mice (FIGS. 7D-7E). These results indicate that the addition of IFNbeta to CD40L may enhance the immunostimulatory function in this model. We next determined whether this is true and additionally studied the efficacy of MEM-288 with anti-PD-1. Importantly, we found that robust increase of tumor cell-reactive CD8T cells in tumor cells was determined by ifnγ ELISPOT in the spleen of MEM-288 injected mice (fig. 8A-8B). On the other hand, anti-PD-1 did not significantly increase tumor-reactive T cells. We conclude that local MEM-288 injection has the potential to trigger a strong systemic T cell response, probably as a single agent in PD-1 resistant tumors is able to control tumor growth. In other ongoing studies, we determined the synergistic effect of anti-tumor activity when MEM-288 and ICI (anti-PD-1 +/-anti-CTLA 4) were combined in this model.
Example 5: research of immune stimulation mechanism of CD40L and IFN beta in tumor microenvironment
The results indicate that the CD40L and IFNb expressing virus (MEM-288) is capable of inducing an effective systemic anti-tumor T cell response, thereby controlling the growth of distant tumor lesions. In addition to the above viruses, we can also use human IFNb alone to conduct the studies presented herein. We can determine the effect of CD40L and IFNb expression in TME on various immune cell types, especially DCs. Macrophages represent another major target of CD40L activity, which can lead to their enhanced antitumor activity. These studies included an in-depth assessment of the effect of OV on DCs, macrophages and T cells, the key goal of which was to determine the unique and synergistic effects of CD40L and IFNb. In addition to the IFNAR1 and CD40KO mice mentioned above, we can also use the bat f3 KO mice lacking DC1 (see below). We show above that human IFNb triggers T cell activation in mice in an IFNAR 1-dependent manner (fig. 1). However, human IFNb can elicit a more substantial response in the setting of the human IFNAR1/2 receptor in mouse cells. Importantly, harari et al generated a transgenic mouse strain designated HyBNAR (hybrid IFNAR) with a human IFNAR1/2 extracellular ligand binding domain and a mouse IFNAR1/2 receptor signaling domain. In this study, it was shown that although human IFNb induced signaling in wild-type mice, consistent with the results, this response was enhanced in HyBNAR mice.
The primary objective here was to show the effect of intralesional OV administration on TME in B16 melanoma and 344 lung tumor models. We define here the unique and complementary effects of CD40E and IFNb receptor binding on immune cells in TME and can also study their underlying mechanisms by using mice lacking CD40 or IFNAR 1. We believe that DC represents the primary target of MEM-288 activity, for which we can conduct the most intensive study to investigate the effect of OV on the function of DC1 and DC2 subsets.
a) Effects of OV on TME: description of CD40L and IFN beta specific role
The main objective was to determine the mechanism of action of CD40L and IFNbeta in TME, for which we can use Ad-GFP, ad-IFNbeta, MEM-188 and MEM-288OV. These exploratory studies can help to assess the broad effects of the above OVs on the main populations of bone marrow cells, DCs, T cells and B cells. As shown in FIG. 9A, by flow cytometry analysis of B16-OVA tumors, we easily detected macrophages (F4/80 + Ly6C + CD11b + MHC-II + ) Monocytes and neutrophils (F4/80) - CD11b + Ly6C + Or Ly6G + ) Including DC1 (CD 11 c) + CD11b - MHC-II + CD103 + ) And DC2 (CD 11 c) + CD11b + MHC-II + CD103 - ) Is a DC of (c). We also detected B cells, CD4 + T cells, CD8 + T cells and OVA-specific CD 8T cells (fig. 9B). The main emphasis can be on The effect of OV on DC activation in tumors was determined. Tumor antigens are readily taken up by resident macrophages and DCs, which can be detected by using tumors expressing GFP or ZsGreen. Recent studies have also demonstrated that antigen uptake functionally reprograms DCs. We generated B16-OVA and B16-F10 expressing ZsGreen to track antigen uptake by tumor resident APCs (FIG. 10). As shown in FIG. 10, zsGreen + Populations of macrophages and DCs were readily detected in ZsGreen-expressing tumors compared to parental non-expressing tumors. ZsGreen expression for identification of tumor cells (ZsGreen + CD45 - ) Among them, we could also detect CD40L expression 2 days after a single MEM-288 injection (FIGS. 11A-11B). Importantly, we also found that both DC and MHC-II were found in the same tumor after MEM-288 injection High height CD80/CD86 increase in macrophages (FIGS. 12A-12B). While these results indicate that MEM-288 induces activation of macrophages and DCs, we show that they demonstrate the feasibility of detecting CD40L expression and activation markers in APC, rather than as a practical finding. We are currently further determining the kinetics of CD40L transgene expression by testing tumors in the B16 and 344 models on days 2, 4 and 6 after a single injection. We can select the time point with the highest expression level for the following study.
b) Effects of OV on TME.
Here we determined that different OV pairs tumor infiltration CD45 in the B16-OVA, B16-F10 and 344 models + The number and phenotypic effects of immune cells. By determining CD45 per gram of tumor + Percentage of cells and number of cells to count each cell type. The main population is shown in figure 9, but NK cell assays with nk1.1ab were added, as NK cells are known targets for CD40L and type 1 IFN, while tregs (with intracellular FoxP3 expression) also play a role in regulating T cell responses after OV injection. Groups of mice bearing ZsGreen expressing tumors (see also statistical programs) can be treated with PBS or 4 OVs above. We can use 5 mice per treatment in 2 independent experiments. 2 days after treatment (or at various time points based on the highest CD40L expression in the study described above), tumors can be digested for flow cytometry,to determine the differences in immune cells following injection of different OVs. Particular attention may be paid to the tumor antigen-specific CD 8T cells in B16-OVA tumors. In mice implanted with B16-OVA treated with MEM-288, we easily detected an increase in anti-tumor T cells in blood (fig. 5C) and spleen (fig. 5D). We can determine here if MEM-288 treatment resulted in the highest level of sum in tumor and OVA-specific CD 8T cells (as detected in fig. 9B). We next determined how different OVs affected uptake of ZsGreen by macrophages and DCs. In a key study, the expression of MHC-II and activation markers CD80, CD86 and CD40 in DC1 and DC2 could be determined. We can also determine ZsGreen + And ZsGreen - Activation state of the cells. Furthermore, we can determine the effect of treatment on CCR7 expression in DCs, as it plays a critical role in DEN transport of DCs. IL-12p70 is a key Th 1-response promoting cytokine secreted by DCs and is also a known target for CD 40L. In addition, tumor DC expression of IL-12p70 is critical for T cell anti-tumor immune responses. As described, we can determine the expression of the IL-12p40 subunit by intracellular flow in DC after administration of brefeldin A in mice. In summary, these studies can help determine how different transgenes, i.e., CD40L, IFN β and cd40l+ ifnβ, affect the total number and activation status of DC1 and DC 2. For example, these studies could help determine if the increased CD80/CD86 expression we observed after MEM-288 injection (FIG. 12) was due to CD40L, IFNP or both. And (3) statistical inspection: for comparison of the two groups, student's t-test can be used to determine mean differences. The mean differences (e.g., specific cell types or activation marker expression) for multiple treatment groups can be determined by the Tukey method.
c) The specific effects of CD40L and IFNbeta are defined using the receptor KO mice.
OVs expressing different transgenes have different effects on broader TME and T cell/DC activation. Furthermore, MEM-288 has the most robust stimulatory effect due to the combined expression of CD40L and IFN beta. Using the complementary approach, we can use the lack of CD40 and IFNAR1 mice in MEM-288 injection after observed CD40L and IFN beta on key phenotype alone effect. Although the above studies indicate that CD40 and IFNAR1 are important for T cell responses (fig. 5D), we herein determine the role of DCs in this response. In the context of MEM-288 therapy, this approach may help provide additional insight into the unique and overlapping functions of the two approaches. These studies can be performed in the B16-F10 and B16-OVA models to match the C57BL/6 genetic background of CD40 and IFNAR1 KO.
d) Determination of the Effect of OV on DC transport to DLN and T cell stimulatory Capacity
As shown in fig. 10, both macrophages and DCs readily absorbed ZsGreen. However, DCs have the unique ability to transport from tumors to DLNs where they present tumor antigens to the naive T cells to trigger their activation. Shown herein is how different OVs affect DC migration to DLN and their ability to initiate T cells. For these studies, we can track migration of DC1 and DC2 to DLN by ZsGreen, as shown in a recent study, and evaluate their ability to activate T cells. These studies help to determine how different transgenes affect DC migration and T cell sensitization.
As shown in FIG. 13, MHC-II + CD11c + 2 major populations of cells were detected in inguinal DLN. MHC (major histocompatibility complex) High height Populations are considered to contain migratory DC1 and DC2, as expected, with higher CD103 + DC and CD11b + DC percentage. Has moderate level of MHC-II (MHC) int ) CD11c of the population + The population contains colonising DC1 and DC2 and has lower CD103 + DC percentage. Most of ZsGreen + DC colonise MHC High height In the population. We can determine here the effect of different OVs on the distribution and activation phenotype of these different populations. MEM-288 administration may result in the highest DLN transport and these DCs have the strongest activation phenotype. We can also determine the ability of MEM-288 to induce DC migration in CD40 and IFNAR1 KO mice. As shown in fig. 14, the LN population of DCs appeared to be unaffected by the deletion of CD40 and IFNAR 1. Nevertheless, it is not clear whether the absence of CD40 and IFNAR1 would affect migration of DC from tumor to DLN.
We can next determine the ability of LN DCs to activate T cells. While studies have shown that MEM-288 greatly enhances T cell sensitization, these studies can specifically determine if this is due at least in part to DC activation. For this, we can use mice bearing B16-OVA tumors for injection of all 4 OVs. Next, we can use DC1 and DC2, selected from DLN cells, for co-culture with CFSE-labeled naive cells OT-1cd 8T cells to perform the CFSE dilution assay described herein. These studies can determine whether MEM-288 induced DC activation resulted in the highest level of T cell proliferation. Furthermore, we can conduct the ELISPOT assay to determine ifnγ secretion by culturing DCs with OT-1cd 8T cells. Using MEM-288, we could next use CD40 and IFNAR1 KO mice to determine the specific role that these 2 transgenes play in the ability of DC to activate T cells. Finally, using BATF3 KO mice, we can determine the effect of DC1 on MEM-288-induced T cell proliferation and increased IFNγ secretion.
Example 6: oncolytic viral treatment of tumors
To demonstrate the effect of oncolytic viruses on tumors in vivo, C57BL/6 mice were inoculated subcutaneously with 5e 5B 16-OVA cells on the flank. Tumors were PBS, 10 on day 12 and day 16 9 IU adenovirus-GFP or MEM-288 injection. On day 20, tumors were obtained for IHC to detect CD8 + The presence of Tumor Infiltrating Lymphocytes (TILs). Mice treated with PBS or GFP-expressing oncolytic viruses showed a similar amount of TIL. In contrast, the TIL of tumors vaccinated with MEM-288 had a nearly 3-fold increase (FIG. 15).
E. Reference to the literature
Ahonen, C.L., doxsee, C.L., mcGurran, S.M., riter, T.R., wade, W.F., barth, R.J., vasilakos, J.P., noelle, R.J., and Kedl, R.M.2004.TLR and CD40 combined triggering induces strong CD8+ T cell expansion and different dependence on type I interferons J Exp Med199:775-784.
Aran, d., looney, a.p., liu, l., wu, e, fong, v., hsu, a, chak, s., naikawadi, r.p., wolters, p.j., abate, a.r., button, a.j., and Bhattacharya, m.2019 reference discloses transitional, pro-fibrotic macrophages Nature Immunology 20:163-172 based on lung single cell sequencing analysis.
Bevan, M.J.2004. Helps CD8 (+) T cell response. Nat Rev Immunol 4:595-602.
Billerbeck, E., barry, W.T., mu, K., dorner, M., rice, C.M., and Ploss, A.2011. Human CD4+FoxP3+ regulatory T cells were cultured in human stem cytokine-, granulocyte-macrophage colony stimulating factor-, and interleukin-3-expressing NOD-SCID IL2 Rgamma (no) humanized mice.
Characteristics of human antiviral adaptive immune responses during infection of HLA-transgenic human immune system mice with hepadnavirus, bilerbeck, e, horwitz, j.a., labitt, r.n., donovan, b.m., vega, k., budell, w.c., koo, g.c., rice, c.m., and Ploss, a.2013. J Immunol 191:1753-1764.
Blair, G.E., dixon, S.C., griffiths, S.A., and Zajdel, M.E.1989. Restricted replication of human adenovirus type 5 in mouse cell lines. Virus Res 14:339-346.
Blander, J.M.2018. Cell biology modulation of antigen cross presentation Annu Rev Immunol36:717-753.
Bommareddy, P.K., shettigar, M.and Kaufman, H.L.2018. Integration of oncolytic viruses in combination cancer immunotherapy Nat Rev Immunol 18:498-513.
Bommareddy, P.K., silk, A.W., and Kaufman, H.L.2017, methods of intratumoral treatment of melanoma Cancer J23:40-4 7.
Brahmer, j., reckamp, k.l., bias, p., crino, l., eberhardt, w.e., podubskaya, e., antonia, s, plurzanski, a., vokes, e.e., holgado, e., waterhouse, d., ready, n., gainor, j., aren front, o, havel, l., steins, m., garasino, m.c., aerts, j.g., domine, m., paz-Ares, l., reck, m, baudelet, c., harbinson, c.t., lestini, b, and spinel, d.r.2015, monoclonal antibody, and docetaxel are compared to other non-small cell lung cancer cells j.123:123.
Brahmer, j.r., tykodi, s.s., chow, l.q., hwu, w.j., topalian, s.l., hwu, p., drake, c.g., camacho, l.h., kauh, j., odusi, k., pitot, h.c., hamid, o., bhatia, s., martins, r., eaton, k., chen, s., salay, t.m., alatarthy, s., grosso, j.f., korman, a.j., parker, s.m., agrawal, s., goldberg, s.m., pardol, d.m., gupta, a, and Wigginton, j.m.2012, safety antibodies against-PD-L1 and n.v. of advanced cancer patients are n.55.
Chen, D.S. and Mellman, I.2017. Elements of cancer immunization and cancer immunization set points Nature541:321-330.
Cho, h.i. and Celis, e.2009. Optimized peptide vaccine that elicits a broad range of CD 8T cell responses with therapeutic anti-tumor effects.
Curtsinger, J.M., valenzuela, J.O., agarwal, P., lins, D, and Mescher, M.F.2005.I type IFN provided a third signal to CD 8T cells to stimulate clonal expansion and differentiation J Immunol174:4465-4469.
de Mingo Pulido, A., gardner, A., hiebler, S., soliman, H., rugo, H.S., krummel, M.F., coussens, L.M., and Ruffell, B.2018.TIM-3 regulates CD103 (+) dendritic Cell function and response to breast Cancer chemotherapy.
Dendritic cells selectively require type I interferon for immunological rejection of tumors, the Journal of experimental medicine 208:1989-2003, diamond, m.s., kine, m, matsushita, h, mashyekhi, m, dunn, g.p., archamault, j.m., lee, h, arthur, c.d., white, j.m., kaline, u, murphy, k.m., and Schreiber, r.d.2011.
Dobin, A., davis, C.A., schlesinger, F., drenkow, J., zaleski, C. Jha, S., batut, P., chaisson, M.and Gingerass, T.R.2013.STAR: ultra-fast universal RNA-sequence aligners, bioinformatics 29:15-21.
Ferris, S.T., durai, V, wu, R, theisen, D.J., ward, J.P., bern, M.D., davidson, J.T.t., bagadia, P., liu, T., briseno, C.G., li, L., gillanders, W.E., wu, G.F., yokoyama, W.M., murphy, T.L., schreiber, R.D., and Murphy, K.M.2020.cDC1 induces anti-tumor immunity primarily by CD4 (+) T cell permissives.
Flood, b.a., higgs, e.f., li, s, luke, j.j. and Gajewski, t.f.2019. Sting pathway agonists as cancer therapeutics. Immunol Rev 290:24-38.
Fuertes, M.B., kacha, A.K., kline, J., woo, S.R., kranz, D.M., murphy, K.M., and Gajewski, T.F.2011 host type I IFN signals are necessary for anti-tumor CD8+ T cell responses by CD8{ α } + dendritic cells The Journal of experimental medicine208:2005-2016.
Gardner, a. And Ruffell, b.2016. Dendritic cells were immunized with tumor.
Gibbons, D.L., lin, W., cright on, C.J., rizvi, Z.H., gregory, P.A., goodall, G.J., thilaganathan, N., du, L., zhang, Y., pertsemidis, A. And Kurie, J.M.2009. Background extracellular signals promote tumor cell EMT and metastasis by modulating miR-200 family expression.
Genomic variation analysis of microarray and RNA-Seq data, BMC Bioinformatics 14:7.
Harari, d., abramovich, r., zozulya, a, smith, p., pouly, s, koster, m., hauser, h, and Schreiber, g.2014. Transgenic mice humanized for type I interferon response, PLoS One 9:e84259 across species gap.
Herbst, r.s., soria, j.c., kowanetz, m., fine, g.d., hamid, o., gordon, m.s., sosman, J.A., mcDermott, D.F., powdery, j.d., gettinger, s.n., kohrt, h.e., hom, l., lawrence, d.p., rost, s., leaman, m., xiao, y., mokatrin, a, koeppen, h., hegde, p.s., mellman, L, chen, d.s., and Hodi, f.s.2014, predictability-related factors of mppd-Ll antibody L3280A responses in cancer patients.
The key role of cd8α+ dendritic cells in cytotoxic T cell immunity was revealed by the absence of Hildner, k, edlson, b.t., purtha, w.e., diamond, m., matsushita, h., kohyama, m., calderon, b., schraml, b.u., unanue, e.r., diamond, m.s., schreiber, r.d., murphy, t.l., and Murphy, k.m.2008.batf3.
The recombinant adenovirus vector opened a type I interferon system without inhibiting transgene expression and viral replication, mol ter 14:129-138, and was characterized by Huarte, e, larread, e, hemandez-alceba, r, alfaro, c, murillo, o, arina, a, tirapu, I, azpiliueta, a, herva-stub, s, bortolanza, s, perez-Gracia, j.l., cinira, m.p., prieto, j, riezu-Boj, j.i., and Melero, i.2006.
Joyce, J.A. and Fearon, D.T.2015.T cell rejection, immune exemption and tumor microenvironment. Science 348:74-80.
Kolumam, G.A., thomas, S., thompson, L.J., sprent, J.and Murali-Krishna, K.2005.I type interferons act directly on CD 8T cells to allow clonal expansion and memory formation in response to viral infection J Exp Med 202:637-650.
The individual cells were subjected to highly parallel whole genome expression profiling using nanoliter droplets using Macosko, e.z., basu, a, satija, r, nemesh, j, shekhar, k, goldman, m, tirosh, i, bialas, a.r., kamitaki, n., martersteck, e.m., trombetta, j.j., weitz, d.a., sanes, j.r., shalek, a.k, regev, a.and McCarroll, S.A.2015..
The dendritic cell modulating program that is conserved limits anti-tumor immunity, nature 580:257-262, by Maier, B, leader, A.M., chen, S.T., tung, N, chang, C., leBerich, J, chudnovskiy, A, maskey, S, walker, L., finnigan, J.P., kirkling, M.E., reizs, B, ghosh, S, D' Amore, N.R., bhardwai, N, rothlin, C.V., wolf, A, flores, R, marron, T., rahman, A.H., kenigsberg, E, brown, B.D., and Merad.
Intratumoral delivery of the Melo-Cardens, J., urquiza, M., kipps, T.J., and Castro, J.E.2012.CD 154 homolog (Ad-ISF 35) induced tumor regression by vector biodistribution, persistence and Gene expression analysis.
O' Hara, m.h.2019.cd40 agonistic monoclonal antibody APX005M in combination with gemcitabine (Gem) and albumin-bound paclitaxel (NP), with or without nivolumab (Nivo) untreated metastatic ductal pancreatic cancer (PDAC) patients study stage Ib AACR Annual Meeting.
Ribas, a., dummer, r, puzanov, i., vanderWalde, a., andtbacka, r.h.i., michielin, o., olski, a.j., malvehy, j., cebon, j., fernandez, e., kirkwood, j.m., gajewski, t.f., chen, l., gorski, k.s., anderson, a.a., diede, s.j., lassman, m.e., ganser, j., hodi, f.s., and Long, g.v.2017, oncolytic virus therapy promotes intratumoral T Cell infiltration and improves anti-PD-1 immunotherapy, cell 170:1109-1119 ello.
Ribas, a., medina, t., kummar, s, amin, a, kalbai, a, droaback, j.j., barve, m, daniels, g.a., wong, d.j., schmidt, e.v., candia, a.f., cofman, r.l., leung, a.c.f., and Janssen, r.s.2018.sd-101 combined palbociclizumab to treat advanced melanoma.
The key role of CCR 7-bearing CD103 (+)/CD 141 (+) dendritic cells in melanoma tumor antigen transport and T Cell immune initiation, cancon Cell 30:324-336.
Ruffell, b. And Coussens, l.m.2015. Therapeutic resistance of macrophages to Cancer.
Ruffell, b., chan-Strachan, d., chan, v., rosenbusch, a, ho, c.m., pryer, n., daniel, d., hwang, e.s., rugo, h.s., and Coussens, l.m.2014, macrophage IL-10 blocks cd8+ T Cell dependent response to chemotherapy by inhibiting intratumoral dendritic Cell IL-12 expression.
Sanchez, P.J., mcWilliams, J.A., haluszczak, C., yagita, H.and Kedl, R.M.2007.TLR/CD40 combination stimulation mediated effective cellular immunity by modulating dendritic cell expression of CD70 in vivo J Immunol 178:1564-1572.
Scarlett, U.K., cube-Ruiz, J.R., nesboth, Y.C., martinez, D.G., engle, X, gewirtz, A.T., ahonen, C.L., and Conejo-Garcia, J.R.2009. In situ stimulation of CD40 and Toll-like receptor 3 converts ovarian Cancer infiltrating dendritic cells from immunosuppressive cells to immunostimulatory cells.
T cell help of Schoenberger, S.P., toes, R.E., van der Voort, E.I., offringa, R.and Melief, C.J.1998. Cytotoxic T lymphocytes is mediated by CD40-CD40L interactions. Nature 393:480-483.
Seymour, L.W., and Fisher, K.D.2016. Oncolytic virus: final delivery. Br J Cancer114:357-361.
Shalma, P., hu-Lieskovan, S., wargo, J.A., and Ribas, A.2017. Primary, adaptive, and acquired resistance to cancer immunotherapy. Cell 168:707-723.
Singh, m., vianden, c., cantwell, m.j., dai, z, xiao, z, sharma, m., khong, h., jaiswal, a.r., faak, f., hailmethael, y., janssen, l.m.e., bhardwaj, u., curran, m.a., diab, a., bassett, r.l., tweardy, d.j., hwu, p, and overhijk, w.w.2017, intratumoral CD40 activation and checkpoint blockade induces T cell-mediated eradication of melanoma in the brain, nat com 8:1447.
Subramannian, A., tamayo, P., mootha, V.K., mukherjee, S., ebert, B.L., gillette, M.A., paulovich, A., pomeroy, S.L., golub, T.R., lander, E.S., and Mesirov, J.P.2005., genome enrichment analysis knowledge-based Whole genome expression Spectrometry Proceedings of the National Academy of Sciences 102:15545-15550.
Tirosh, i., izar, b., prakaman, s.m., wadsworth, M.H.,2nd,Treacy,D, trombetta, j.j., rotem, a, rodman, c., lan, c., murphy, g., fanshi-sicani, m., dutton-regestr, k., lin, j. -r, cohen, o., shah, p, lu, d., genshaft, a.s., hughes, t.k., ziegler, c.g., k., kazer, s.w., gaillard, a, kolb, k.e., villani, a-c., johanssen, c.m., shah, p, lu, k, hughes, t.k., zieger, c.g., kalzer, s.w., kolb, k.e., villan, a., j Andreev, A.Y., van Allen, E.M., bertagnolli, M., sorger, P.K., sullivan, R.J., flahererty, K.T., frederick, D.T., jane-Valbuena, J., yoon, C.H., rozenblatt-Rosen, O., shalk, A.K., regev, A.and Garraway, L.A.2016. The multicellular ecological system of metastatic melanoma was profiled with single-cell RNA-seq.
The antibodies are those which are active against cancer in Topalian, S.L., hodi, F.S., brahmer, J.R., gettinger, S.N., smith, D.C., mcDermott, D.F., powdery, J.D., carvajal, R.D., sosman, J.A., atkins, M.B., leming, P.D., spigel, D.R., antonia, S.J., horn, L., drake, C.G., parmall, D.M., chen, L., sharfman, W.H., anders, R.A., taube, J.M., mcMiller, T.L., xu, H, korman, A.J., jure-Kunkel, M., agrawal, S., mcDonald, D., kollia, G.D., gup, A., wiggon, J.M., and Szem.24, S. 43-366, and related to safety.
Tumeh, P.C., harview, C.L., yearley, J.H., shintaku, I.P., taylor, E.J., robert, L., chuelewski, B, spasic, M, henry, G., ciobanu, V., west, A.N., carmona, M., kivork, C., seja, E, cherry, G., gutierrez, A.J., grogan, T.R., mateus, C., tomasic, G., glaspy, J.A., emerson, R.O., robin, H, pierce, R.H., elashoff, D.A., robert, C and ris, A.2014.PD-1 blocking the immune response by the inhibition inducible immune response.
The intratumoral injection of Ad-ISF35 (chimeric CD 154) by Urquiza, M., melo-cardeas, J., aguillon, R., kipps, T.J., and Castro, J.E.2015, breaks tolerance and induces tumor regression in lymphomas Hum Gene Ther 26:14-25.
Valenzuela, J.O., illozan, C., hossain, M.S., prlic, M., hopewell, E, bronk, C.C., wang, J., celis, E, engelman, R.W., blazar, B.R., bevan, M.J., waller, E.K., yu, X.Z., and Beg, A.A.2009. PKCcheta are required for alloreactivity and GVHD but not for immune response to leukemia and infection in mice J Clin Invest 119:3774-3786.
Valenzuela, J.O., illozan, C., hossain, M.S., prlic, M., hopewell, E, bronk, C.C., wang, J., celis, E, engelman, R.W., blazar, B.R., bevan, M.J., waller, E.K., yu, X.Z., and Beg, A.A.2009. PKCcheta are required for alloreactivity and GVHD but not for immune response to leukemia and infection in mice The Journal of clinical investigation119:3774-3786.
Vondelheide, R.H.2018. Immune revolution: initiation, but not checkpoint. Cancer Cell33:563-569.
CD40 agonist antibodies in the treatment of cancer, annu Rev Med 71:47-58.
Wculek, S.K., cueto, F.J., mujal, A.M., melero, I., krummel, M.F., and Sancho, D.2020, role of dendritic cells in tumor immunization and immunotherapy Nat Rev Immunol20:7-24.
Xie, M., zheng, H., madan-Lala, R., dai, W., gimbrane, N.T., chen, Z., kinose, F., blackstone, S.A., smalley, K.S.M., cress, W.D., haura, E.B., rix, U.S. and Beg, A.A.2019.MEK inhibits the modulation of cytokine responses to mediate the therapeutic effects of lung Cancer.
Zheng, h., zhao, w., yan, c., watson, c.c., messengll, m., xie, m., messengll, c., noyes, d., martinez, g.v., afzal, r., chen, z., ren, x., antonia, s.j., haura, e.b., ruffell, b.and Beg, a.a.2016.hdac inhibitors enhance T cell chemokine expression and enhance lung adenocarcinoma patients' response to PD-1 immunotherapy.
Sequence(s)
SEQ ID NO:1 is the amino acid sequence of human wild-type interferon-alpha (UniProtKB reference number P05014):
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFGFPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVlQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAE1Lv1RSLSFST NLQKRLRRKD
SEQ ID NO:2 is the amino acid sequence of human wild-type interferon- β (UniProtKB reference number P01574):
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
SEQ ID NO:3 is the amino acid sequence of human wild-type interferon-epsilon (UniProtKB reference number Q9P0W 0):
MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
SEQ ID NO:5 is the amino acid sequence of human wild-type interferon- ω (UniProtKB reference number P05000):
MALLFPLLAALVMTSYSPVGSLGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQ ERLRSKDRDLGSS
SEQ ID NO:6 is the amino acid sequence of human CD40-L (ETniprotKB reference number P29965):
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
Claims (20)
1. a method of producing tumor-infiltrating lymphocytes, comprising:
a. administering an oncolytic virus expressing one or more exogenous immunostimulatory molecules into a tumor cell; and
b. tumor infiltrating lymphocytes are collected.
2. The method of producing tumor-infiltrating lymphocytes according to claim 1, wherein the oncolytic virus further expresses one or more type 1 interferons.
3. The method of producing tumor-infiltrating lymphocytes according to claim 2, wherein the one or more type 1 interferons comprise IFN- α, IFN- β, IFN- κ, IFN- δ, IFN- ε, IFN- τ, IFN- ω, and/or IFN- ζ.
4. The method of producing tumor-infiltrating lymphocytes according to any one of claims 1-3, wherein the one or more immunostimulatory molecules comprise CD40-L, MEM, B7-1 (CD 80)/B7-2 (CD 86), OX40L, 4-1BBL, CD70, GITRL, LIGHT, TIM-4, ICAM-1, CD58, and/or SLAMF6.
5. The method of producing tumor-infiltrating lymphocytes according to any one of claims 1-4, wherein the oncolytic virus is MEM288.
6. The method of producing tumor-infiltrating lymphocytes according to any one of claims 1-5, wherein the oncolytic virus is administered by intratumoral injection.
7. The method of producing tumor-infiltrating lymphocytes according to any one of claims 1-6, further comprising ex vivo expansion of the harvested TILs.
8. A method of expanding a tumor-infiltrating lymphocyte (TIL) population or a bone marrow-infiltrating lymphocyte (MIL) population, comprising:
a. collecting TIL or MILs from a subject having cancer;
b. the harvested TIL or MILs are cultured in the presence of antigen presenting cells infected with an oncolytic virus expressing one or more exogenous immunostimulatory molecules.
9. The method of expanding a population of tumor-infiltrating lymphocytes (TIL) or a population of bone marrow-infiltrating lymphocytes (MILs) according to claim 8, wherein the oncolytic virus further expresses one or more type 1 interferons.
10. The method of expanding a population of tumor-infiltrating lymphocytes (TIL) or bone marrow-infiltrating lymphocytes (MIL) according to claim 9, wherein the one or more type 1 interferons comprise IFN- α, IFN- β, IFN- κ, IFN- δ, IFN- ε, IFN- τ, IFN- ω, and/or IFN- ζ.
11. The method of expanding a population of tumor-infiltrating lymphocytes (TIL) or bone marrow-infiltrating lymphocytes (MILs) according to any one of claims 8-10, wherein the one or more immunostimulatory molecules comprise CD40-L, MEM, B7-1 (CD 80)/B7-2 (CD 86), OX40L, 4-1BBL, CD70, GITRL, LIGHT, TIM-4, ICAM-1, CD58, and/or SLAMF6.
12. The method of expanding a tumor-infiltrating lymphocyte (TIL) population or a bone marrow-infiltrating lymphocyte (MIL) population according to any one of claims 8-11, wherein the oncolytic virus is MEM-288.
13. A method of treating cancer in a subject comprising administering the TIL or MIL of any of claims 1-12 to the subject.
14. A method of treating cancer in a subject, comprising:
a. administering an oncolytic virus expressing one or more immunostimulatory molecules into a tumor cell;
b. collecting tumor-infiltrating lymphocytes (TIL) and/or bone marrow-infiltrating lymphocytes (MILs);
c. amplifying the collected TIL and/or MIL ex vivo; and
d. the amplified TIL and/or MILs are administered to a subject.
15. A method of treating cancer in a subject, comprising:
a. collecting tumor-infiltrating lymphocytes (TILs) and/or bone marrow-infiltrating lymphocytes (MILs) from a subject having cancer;
b. culturing the harvested TIL or MILs in the presence of antigen presenting cells infected with an oncolytic virus expressing one or more exogenous immunostimulatory molecules; and
c. the amplified TIL and/or MI are administered to subject L.
16. The method of treating cancer in a subject according to claim 14 or 15, wherein the oncolytic virus further expresses one or more type 1 interferons.
17. The method of treating cancer according to claim 16, wherein the one or more type 1 interferons comprise IFN- α, IFN- β, IFN- κ, IFN- δ, IFN- ε, IFN- τ, IFN- ω, and/or IFN- ζ.
18. The method of treating cancer according to any one of claims 14-17, wherein the one or more immunostimulatory molecules comprise CD40-L, MEM40, B7-1 (CD 80)/B7-2 (CD 86), OX40L, 4-1BBL, CD70, GITRL, LIGHT, TIM-4, ICAM-1, CD58 and/or SLAMF6.
19. The method of treating cancer according to any one of claims 14-18, wherein the oncolytic virus is MEM-288.
20. The method of treating cancer according to any one of claims 13-19, further comprising administering an anti-cancer agent to the subject.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202063106215P | 2020-10-27 | 2020-10-27 | |
US63/106,215 | 2020-10-27 | ||
PCT/US2021/056829 WO2022093944A2 (en) | 2020-10-27 | 2021-10-27 | Oncolytic virus boosts t cell response for effective til therapy |
Publications (1)
Publication Number | Publication Date |
---|---|
CN116710564A true CN116710564A (en) | 2023-09-05 |
Family
ID=81384494
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202180073895.XA Pending CN116710564A (en) | 2020-10-27 | 2021-10-27 | Oncolytic viruses enhance T cell response to effective TIL therapy |
Country Status (8)
Country | Link |
---|---|
EP (1) | EP4237566A2 (en) |
JP (1) | JP2023548831A (en) |
CN (1) | CN116710564A (en) |
AU (1) | AU2021368569A1 (en) |
BR (1) | BR112023007922A2 (en) |
CA (1) | CA3196553A1 (en) |
MX (1) | MX2023004780A (en) |
WO (1) | WO2022093944A2 (en) |
Families Citing this family (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA3207359A1 (en) * | 2021-02-05 | 2022-08-11 | Cecile Chartier-Courtaud | Adjuvant therapy for cancer |
WO2023108003A2 (en) * | 2021-12-07 | 2023-06-15 | Memgen, Inc. | Oncolytic virus boosts t cell response for effective til therapy |
CN116059260A (en) * | 2023-03-07 | 2023-05-05 | 华南农业大学 | Application of SVA virus in preparation of tumor prevention and treatment drugs and anti-tumor composition |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20160146713A (en) * | 2014-03-20 | 2016-12-21 | 에이치 리 모피트 캔서 센터 앤드 리서어치 인스티튜트 아이엔씨 | Tumor-infiltrating lymphocytes for adoptive cell therapy |
CA3104469A1 (en) * | 2018-06-19 | 2019-12-26 | H. Lee Moffitt Cancer Center And Research Institute, Inc. | Oncolytic virus or antigen presenting cell mediated cancer therapy using type i interferon and cd40-ligand |
-
2021
- 2021-10-27 CN CN202180073895.XA patent/CN116710564A/en active Pending
- 2021-10-27 JP JP2023526170A patent/JP2023548831A/en active Pending
- 2021-10-27 BR BR112023007922A patent/BR112023007922A2/en unknown
- 2021-10-27 WO PCT/US2021/056829 patent/WO2022093944A2/en active Application Filing
- 2021-10-27 CA CA3196553A patent/CA3196553A1/en active Pending
- 2021-10-27 AU AU2021368569A patent/AU2021368569A1/en active Pending
- 2021-10-27 MX MX2023004780A patent/MX2023004780A/en unknown
- 2021-10-27 EP EP21887430.3A patent/EP4237566A2/en active Pending
Also Published As
Publication number | Publication date |
---|---|
WO2022093944A2 (en) | 2022-05-05 |
BR112023007922A2 (en) | 2023-10-03 |
EP4237566A2 (en) | 2023-09-06 |
JP2023548831A (en) | 2023-11-21 |
WO2022093944A3 (en) | 2022-07-21 |
CA3196553A1 (en) | 2022-05-05 |
MX2023004780A (en) | 2023-05-09 |
AU2021368569A1 (en) | 2023-06-08 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11246906B2 (en) | Compositions and methods for subcutaneous administration of cancer immunotherapy | |
JP7157181B2 (en) | Use of plinabulin in combination with immune checkpoint inhibitors | |
Van der Jeught et al. | Targeting the tumor microenvironment to enhance antitumor immune responses | |
JP6515182B2 (en) | Combination of WT1 antigenic peptide and immunomodulator | |
CN116710564A (en) | Oncolytic viruses enhance T cell response to effective TIL therapy | |
JP2021523110A (en) | Nanoparticles for gene expression and their use | |
US20220401474A1 (en) | Hdac6-activated macrophages, compositions, and uses thereof | |
JP2009509991A (en) | Compositions and methods for treating tumors presenting survivin antigen | |
US20230241207A1 (en) | Protein antigens and uses thereof | |
US20180128833A1 (en) | Methods of treating with tumor membrane vesicle-based immunotherapy and predicting therapeutic response thereto | |
US20230220031A1 (en) | Engineered il-12 and il-23 polypeptides and uses thereof | |
US20220354972A1 (en) | In situ recruitment, reprogramming, and release of car-t cells | |
JP2020531409A (en) | Phosphatidylserine targeted fusion molecules and how to use them | |
US20240226168A1 (en) | Engineered nk cells and uses thereof | |
WO2018032501A1 (en) | Novel tumor-specific polypeptide and application thereof | |
US20230107770A1 (en) | Method of enhancing immunotherapy using er stress pathway inhibitors | |
KR20240056684A (en) | Vasoactive intestinal peptide (VIP) receptor antagonist | |
US20230270784A1 (en) | Oncolytic virus boosts t cell response for effective til therapy | |
US20200038440A1 (en) | Short-term activated dc1s and methods for their production and use | |
WO2019076269A1 (en) | Mevalonic acid pathway inhibitor and pharmaceutical composition thereof | |
US10722563B2 (en) | Prostate-specific tumor antigens and uses thereof | |
JP2009091348A (en) | Method for treatment of cancer | |
WO2023220659A1 (en) | Individualized cancer epitopes and methods of using the same | |
WO2023197014A2 (en) | Combination therapy comprising pd-l1 knockout nk cell and anti-pdl1 antibodies |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination |