CN116603060A - Monkey poxvirus subunit vaccine and preparation method and application thereof - Google Patents
Monkey poxvirus subunit vaccine and preparation method and application thereof Download PDFInfo
- Publication number
- CN116603060A CN116603060A CN202310668344.9A CN202310668344A CN116603060A CN 116603060 A CN116603060 A CN 116603060A CN 202310668344 A CN202310668344 A CN 202310668344A CN 116603060 A CN116603060 A CN 116603060A
- Authority
- CN
- China
- Prior art keywords
- monkey
- pox virus
- monkey pox
- virus antigen
- antigen protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 241000700627 Monkeypox virus Species 0.000 title claims abstract description 98
- 229940031626 subunit vaccine Drugs 0.000 title claims abstract description 30
- 238000002360 preparation method Methods 0.000 title claims abstract description 7
- 102000036639 antigens Human genes 0.000 claims abstract description 61
- 108091007433 antigens Proteins 0.000 claims abstract description 61
- 239000002671 adjuvant Substances 0.000 claims abstract description 23
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 18
- 239000000427 antigen Substances 0.000 claims abstract description 14
- 102000004169 proteins and genes Human genes 0.000 claims description 22
- 108090000623 proteins and genes Proteins 0.000 claims description 22
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 14
- 230000003053 immunization Effects 0.000 claims description 12
- 239000007788 liquid Substances 0.000 claims description 12
- 150000007523 nucleic acids Chemical group 0.000 claims description 12
- 230000001580 bacterial effect Effects 0.000 claims description 11
- 230000014509 gene expression Effects 0.000 claims description 11
- 238000002649 immunization Methods 0.000 claims description 11
- 208000005871 monkeypox Diseases 0.000 claims description 10
- 239000013604 expression vector Substances 0.000 claims description 9
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical group [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 claims description 8
- 238000000034 method Methods 0.000 claims description 8
- 241000588724 Escherichia coli Species 0.000 claims description 4
- 238000012258 culturing Methods 0.000 claims description 3
- 239000003814 drug Substances 0.000 claims description 3
- 201000010099 disease Diseases 0.000 claims description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 2
- 238000002347 injection Methods 0.000 claims description 2
- 239000007924 injection Substances 0.000 claims description 2
- 230000002265 prevention Effects 0.000 claims 1
- 230000028993 immune response Effects 0.000 abstract description 7
- 230000003472 neutralizing effect Effects 0.000 abstract description 6
- 241000700605 Viruses Species 0.000 abstract description 5
- 238000010255 intramuscular injection Methods 0.000 abstract description 4
- 239000007927 intramuscular injection Substances 0.000 abstract description 4
- 230000028996 humoral immune response Effects 0.000 abstract description 3
- 230000003255 anti-acne Effects 0.000 abstract 1
- LHMQDVIHBXWNII-UHFFFAOYSA-N 3-amino-4-methoxy-n-phenylbenzamide Chemical compound C1=C(N)C(OC)=CC=C1C(=O)NC1=CC=CC=C1 LHMQDVIHBXWNII-UHFFFAOYSA-N 0.000 description 19
- 210000004027 cell Anatomy 0.000 description 19
- 241000699670 Mus sp. Species 0.000 description 13
- 239000000243 solution Substances 0.000 description 12
- 102220536912 Transcription factor JunD_A35R_mutation Human genes 0.000 description 10
- 101100000230 Vaccinia virus (strain Copenhagen) A35R gene Proteins 0.000 description 10
- 101100000231 Vaccinia virus (strain Western Reserve) VACWR158 gene Proteins 0.000 description 10
- 229960005486 vaccine Drugs 0.000 description 9
- 239000006228 supernatant Substances 0.000 description 8
- 208000015181 infectious disease Diseases 0.000 description 7
- 229940124965 ACAM2000 Drugs 0.000 description 6
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 6
- 210000001744 T-lymphocyte Anatomy 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 6
- 238000002965 ELISA Methods 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 229940037003 alum Drugs 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 229930027917 kanamycin Natural products 0.000 description 5
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 5
- 229960000318 kanamycin Drugs 0.000 description 5
- 229930182823 kanamycin A Natural products 0.000 description 5
- 210000002966 serum Anatomy 0.000 description 5
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 230000024932 T cell mediated immunity Effects 0.000 description 4
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 4
- 241000700647 Variola virus Species 0.000 description 4
- 239000004202 carbamide Substances 0.000 description 4
- 210000003000 inclusion body Anatomy 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 230000009465 prokaryotic expression Effects 0.000 description 4
- 230000001105 regulatory effect Effects 0.000 description 4
- 229940083538 smallpox vaccine Drugs 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 102100037850 Interferon gamma Human genes 0.000 description 3
- 108010074328 Interferon-gamma Proteins 0.000 description 3
- 241000700629 Orthopoxvirus Species 0.000 description 3
- 229940124939 Pox vaccine Drugs 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 238000004925 denaturation Methods 0.000 description 3
- 230000036425 denaturation Effects 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 238000001962 electrophoresis Methods 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 229910052759 nickel Inorganic materials 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 239000002244 precipitate Substances 0.000 description 3
- 238000001742 protein purification Methods 0.000 description 3
- 238000004153 renaturation Methods 0.000 description 3
- 235000020183 skimmed milk Nutrition 0.000 description 3
- 210000004989 spleen cell Anatomy 0.000 description 3
- 238000002255 vaccination Methods 0.000 description 3
- 239000011534 wash buffer Substances 0.000 description 3
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 239000000020 Nitrocellulose Substances 0.000 description 2
- 241001052560 Thallis Species 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 229910021502 aluminium hydroxide Inorganic materials 0.000 description 2
- UDSAIICHUKSCKT-UHFFFAOYSA-N bromophenol blue Chemical compound C1=C(Br)C(O)=C(Br)C=C1C1(C=2C=C(Br)C(O)=C(Br)C=2)C2=CC=CC=C2S(=O)(=O)O1 UDSAIICHUKSCKT-UHFFFAOYSA-N 0.000 description 2
- 229910002092 carbon dioxide Inorganic materials 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 239000008367 deionised water Substances 0.000 description 2
- 229910021641 deionized water Inorganic materials 0.000 description 2
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 239000003480 eluent Substances 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 210000003743 erythrocyte Anatomy 0.000 description 2
- 238000001641 gel filtration chromatography Methods 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 238000006386 neutralization reaction Methods 0.000 description 2
- 229920001220 nitrocellulos Polymers 0.000 description 2
- 238000005457 optimization Methods 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 230000001681 protective effect Effects 0.000 description 2
- 239000012460 protein solution Substances 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 230000003362 replicative effect Effects 0.000 description 2
- 238000005070 sampling Methods 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000012137 tryptone Substances 0.000 description 2
- 238000000108 ultra-filtration Methods 0.000 description 2
- CGMWMYHEKGCISN-UHFFFAOYSA-N (2-chloro-6-fluorophenyl)hydrazine Chemical compound NNC1=C(F)C=CC=C1Cl CGMWMYHEKGCISN-UHFFFAOYSA-N 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 108010041986 DNA Vaccines Proteins 0.000 description 1
- 229940021995 DNA vaccine Drugs 0.000 description 1
- 201000004624 Dermatitis Diseases 0.000 description 1
- 206010012438 Dermatitis atopic Diseases 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 101000658547 Escherichia coli (strain K12) Type I restriction enzyme EcoKI endonuclease subunit Proteins 0.000 description 1
- 101000658543 Escherichia coli Type I restriction enzyme EcoAI endonuclease subunit Proteins 0.000 description 1
- 101000658546 Escherichia coli Type I restriction enzyme EcoEI endonuclease subunit Proteins 0.000 description 1
- 101000658530 Escherichia coli Type I restriction enzyme EcoR124II endonuclease subunit Proteins 0.000 description 1
- 101000658540 Escherichia coli Type I restriction enzyme EcoprrI endonuclease subunit Proteins 0.000 description 1
- 101000658545 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) Type I restriction enyme HindI endonuclease subunit Proteins 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 208000029462 Immunodeficiency disease Diseases 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000004388 Interleukin-4 Human genes 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 101000658548 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Putative type I restriction enzyme MjaIXP endonuclease subunit Proteins 0.000 description 1
- 101000658542 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Putative type I restriction enzyme MjaVIIIP endonuclease subunit Proteins 0.000 description 1
- 101000658529 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Putative type I restriction enzyme MjaVIIP endonuclease subunit Proteins 0.000 description 1
- 241001183012 Modified Vaccinia Ankara virus Species 0.000 description 1
- 208000009525 Myocarditis Diseases 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 241000700625 Poxviridae Species 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 101001042773 Staphylococcus aureus (strain COL) Type I restriction enzyme SauCOLORF180P endonuclease subunit Proteins 0.000 description 1
- 101000838760 Staphylococcus aureus (strain MRSA252) Type I restriction enzyme SauMRSORF196P endonuclease subunit Proteins 0.000 description 1
- 101000838761 Staphylococcus aureus (strain MSSA476) Type I restriction enzyme SauMSSORF170P endonuclease subunit Proteins 0.000 description 1
- 101000838758 Staphylococcus aureus (strain MW2) Type I restriction enzyme SauMW2ORF169P endonuclease subunit Proteins 0.000 description 1
- 101001042566 Staphylococcus aureus (strain Mu50 / ATCC 700699) Type I restriction enzyme SauMu50ORF195P endonuclease subunit Proteins 0.000 description 1
- 101000838763 Staphylococcus aureus (strain N315) Type I restriction enzyme SauN315I endonuclease subunit Proteins 0.000 description 1
- 101000838759 Staphylococcus epidermidis (strain ATCC 35984 / RP62A) Type I restriction enzyme SepRPIP endonuclease subunit Proteins 0.000 description 1
- 101000838756 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) Type I restriction enzyme SsaAORF53P endonuclease subunit Proteins 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- HDOVUKNUBWVHOX-QMMMGPOBSA-N Valacyclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCOC(=O)[C@@H](N)C(C)C)C=N2 HDOVUKNUBWVHOX-QMMMGPOBSA-N 0.000 description 1
- 230000010530 Virus Neutralization Effects 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 238000007605 air drying Methods 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 201000008937 atopic dermatitis Diseases 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 229940031567 attenuated vaccine Drugs 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- 238000005206 flow analysis Methods 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000007813 immunodeficiency Effects 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 239000002198 insoluble material Substances 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 229960005030 other vaccine in atc Drugs 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 208000008494 pericarditis Diseases 0.000 description 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55505—Inorganic adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55561—CpG containing adjuvants; Oligonucleotide containing adjuvants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/24011—Poxviridae
- C12N2710/24111—Orthopoxvirus, e.g. vaccinia virus, variola
- C12N2710/24122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/24011—Poxviridae
- C12N2710/24111—Orthopoxvirus, e.g. vaccinia virus, variola
- C12N2710/24134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/01—Bacteria or Actinomycetales ; using bacteria or Actinomycetales
- C12R2001/185—Escherichia
- C12R2001/19—Escherichia coli
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Virology (AREA)
- Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Molecular Biology (AREA)
- Pharmacology & Pharmacy (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Epidemiology (AREA)
- Biophysics (AREA)
- Mycology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- General Chemical & Material Sciences (AREA)
- General Engineering & Computer Science (AREA)
- Immunology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Communicable Diseases (AREA)
- Physics & Mathematics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Plant Pathology (AREA)
Abstract
The invention discloses a monkey pox virus subunit vaccine, a preparation method and application thereof, and relates to the technical field of biology. The anti-acne virus antigen comprises an antigen and an adjuvant, wherein the antigen components are monkey pox virus antigen proteins M1R, A29L, A R and B6R, his tags are added to the tail parts of the monkey pox virus antigen proteins M1R, A29L, A R or B6R, the amino acid sequence of the monkey pox virus antigen protein M1R is shown as SEQ ID NO.1, the amino acid sequence of the monkey pox virus antigen protein A29L is shown as SEQ ID NO.2, the amino acid sequence of the monkey pox virus antigen protein A35R is shown as SEQ ID NO.3, and the amino acid sequence of the monkey pox virus antigen protein B6R is shown as SEQ ID NO. 4. The mouse intramuscular injection secondary subunit vaccine can cause wide neutralizing antibody and cell immune response, induce strong cell immune and humoral immune response, can be clinically popularized and used, is used for common people to inoculate when needed, and is safer and wider in application range.
Description
Technical Field
The invention relates to the technical field of biology, in particular to a monkey pox virus subunit vaccine, a preparation method and application thereof.
Background
Monkey Poxvirus (MPXV) belongs to the family poxviridae, orthopoxvirus, and also to smallpox, vaccinia, and the like, and the MPXV genome is a double stranded DNA up to 196kb long comprising 190 open reading frames encoding about 200 proteins, of which about 100 are nonstructural proteins, and since basic studies on MPXV are not much, only a few proteins of MPXV currently have a known function.
Currently, there are no specific vaccines and drugs against MPXV infection. Due to the cross-protective effect of the antigen of the orthopoxvirus member, the smallpox vaccine has a certain protective activity on the monkey pox. Studies show that smallpox vaccine has 85% protection efficiency for MPXV. Epidemiological studies have shown that about 90% of MPXV diagnosed cases have not been infected with other poxviruses, most of which were born after the WHO announced the end of the smallpox eradication program in 1980 and have not been vaccinated with smallpox vaccine. Two types of vaccines were approved by the FDA for pre-exposure vaccination against orthopoxviruses including monkey pox, the second generation vaccine ACAM2000 and the third generation vaccine Jynneos, respectively. ACAM2000 has been shown to alleviate symptoms of MPXV during the first U.S. MPXV epidemic in this century. There are side effects, including myocarditis and pericarditis, however, with a higher risk for some populations (e.g. eczema patients and pregnant women), resulting in the vaccine not being offered to the public nor used in areas where MPXV is prevalent. The danish Bavarian Nordic company developed a non-replicating smallpox-monkey pox vaccine Jynneos based on its own modified vaccinia ankara virus (modified vaccinia virus Ankara-Bavarian Nordic, MVA-BN) technology platform. Compared with the early vaccine, the JYNNEOS and other third-generation attenuated vaccines have better safety. Jynneos vaccine was approved by the FDA in the united states at month 9 of 2019, and vaccinated by subcutaneous injection, can elicit body fluid and cellular immune responses that are highly effective against MPXV, and is used to prevent smallpox (smallpox) and monkey pox (monkey pox) infections in high-risk adult populations over 18 years of age. The international personal matter (ACIP) consensus voting supports Jynneos as an alternative to ACAM2000, month 11 2021. This is the only non-replicating smallpox vaccine approved by the FDA and is the only monkey pox vaccine marketed worldwide. Unlike ACAM2000, jynneos can be used for atopic dermatitis patients and immunodeficiency patients. However, the function and effect of some immunomodulatory proteins in humans is not clear, as the protective targets are not yet defined. Furthermore, JYNNEOS was vaccinated at 28 day intervals, so in the case of post-exposure vaccination, the second dose could be too late to help prevent the disease, it is not clear whether the first dose was sufficient to achieve therapeutic effect. Both ACAM2000 and Jynneos were only approved for emergency immunization of the exposed population, and not for the general population. No complete clinical study data (vaccinator vs control group) was available for ACAM2000, jynneos and subunit and DNA vaccines under investigation to prevent MPXV infection, whether these vaccines could effectively prevent MPXV epidemics in the general population was yet to be determined.
Therefore, there remains a need to develop an effective and safe new generation of monkey pox specific vaccines for convenient, when needed, vaccination of the general population.
Disclosure of Invention
The invention provides a monkey pox virus subunit vaccine, a preparation method and application thereof, and aims to solve the problems in the background technology. Compared with other vaccines, subunit vaccines have good safety and are also suitable for the population with low immunity. The subunit vaccine provided by the invention comprises M1R, A L antigen protein from MPXV intracellular mature virus particles (Intracellular mature virus, IMV) and A35R, B R antigen protein from extracellular envelope virus particles (Extracellular enveloped virus, EEV), and is mixed with aluminum hydroxide (alum) or CpG. Intramuscular injection of the secondary subunit vaccine into mice can cause extensive neutralizing antibodies and cellular responses, inducing strong cellular and humoral immune responses.
In order to achieve the technical purpose, the invention mainly adopts the following technical scheme:
in a first aspect, the invention discloses a monkey pox virus subunit vaccine, which comprises an antigen and an adjuvant, wherein the antigen components are monkey pox virus antigen proteins M1R, A29L, A R and B6R, his tags are added to the tail parts of the monkey pox virus antigen proteins M1R, A29L, A R or B6R, the amino acid sequence of the monkey pox virus antigen protein M1R is shown as SEQ ID NO.1, the amino acid sequence of the monkey pox virus antigen protein A29L is shown as SEQ ID NO.2, the amino acid sequence of the monkey pox virus antigen protein A35R is shown as SEQ ID NO.3, the amino acid sequence of the monkey pox virus antigen protein B6R is shown as SEQ ID NO.4,
preferably, the adjuvant is aluminum hydroxide or CpG.
More preferably, the adjuvant is CpG.
In a second aspect, the invention discloses a nucleic acid sequence capable of encoding a monkey pox virus antigen protein M1R as shown in SEQ ID NO.5, a nucleic acid sequence encoding a monkey pox virus antigen protein A29L as shown in SEQ ID NO.6, a nucleic acid sequence encoding a monkey pox virus antigen protein A35R as shown in SEQ ID NO.7, and a nucleic acid sequence encoding a monkey pox virus antigen protein M1R as shown in SEQ ID NO. 8.
In a third aspect, the invention discloses a method for preparing a monkey poxvirus subunit vaccine according to the first aspect, comprising the steps of:
(1) Constructing expression vectors containing nucleotide sequences capable of encoding the monkey poxvirus antigen protein M1R, A L, A R or B6R respectively;
(2) Transferring each expression vector into a host cell for expression culture to obtain recombinant thalli containing the monkey pox virus proteins;
(3) Culturing the recombinant bacterial liquid to express monkey pox virus antigen protein M1R, A29L, A R or B6R;
(4) The monkey pox virus subunit vaccine is prepared by separating and purifying the monkey pox virus antigen protein M1R, A29L, A R or B6R and assisting with an adjuvant.
Preferably, the expression vector is pET-9a.
Preferably, the host cell is an E.coli BL21 (DE 3) competent cell.
In a preferred embodiment of the invention, in step (4), when the adjuvant is aluminium hydroxide, the monkey poxvirus antigen protein amounts to 10 μg each of M1R, A29L, A R and B6R, 40 μg of aluminium hydroxide adjuvant; when the adjuvant is CpG, the monkey pox virus antigen protein is 10 mug of each of M1R, A29L, A R and B6R, and CpG790910 mug, and the adjuvant and each monkey pox virus antigen protein are fully and uniformly mixed.
In a fourth aspect, the invention discloses the use of a monkey poxvirus subunit vaccine according to the first aspect in monkey poxvirus immunization or for the preparation of a medicament for the prevention of diseases caused by infection by monkey poxviruses.
Furthermore, when the monkey pox virus subunit vaccine is applied to monkey pox virus immunization, 2 injection is inoculated.
Compared with the prior art, the invention has the following beneficial effects:
the monkey pox virus subunit vaccine prepared by the invention can cause wide neutralizing antibody and cell immune response after intramuscular injection of mice with the subunit vaccine for the second time, and can induce strong cell immune and humoral immune response.
The monkey pox virus subunit vaccine prepared by the invention can be used for common people to inoculate when needed, and is safer and wider in application range.
Drawings
FIG. 1 is a schematic diagram of the structure of a constructed expression vector plasmid;
FIG. 2 is a protein gel electrophoresis detection diagram of the isolated and purified monkey pox virus antigen protein M1R, A29L, A R and B6R;
FIG. 3 is a flow chart of immunization and blood collection of mice;
FIG. 4 is a graph showing the change of antibodies against each antigen in the serum of mice after immunization;
FIG. 5 is a graph showing the results of a specific T cell immunoassay for a monkey pox vaccine using a flow assay technique;
FIG. 6 is a graph showing the results of an enzyme-linked immunospot (ELISPOT) experiment;
FIG. 7 is a comparison of infection cells measured for monkey poxvirus neutralizing antibodies.
Detailed Description
In order to make the objects, technical solutions and advantages of the present invention more apparent, the present invention will be further described with reference to examples. It should be understood that the embodiments described herein are for illustration only and are not intended to limit the invention.
EXAMPLE 1 expression and purification of monkey poxvirus antigen
(1) Prokaryotic expression plasmid construction
His tag is added to the tail of the monkey pox virus antigen protein M1R (aa 1-182), A29L (aa 1-110), A35R (aa 57-181) and B6R (aa 19-280), the amino acid sequence is synthesized by Kirschner Biotechnology Co., ltd, and the amino acid sequence is subjected to codon optimization, and a prokaryotic expression vector pET-9a (4.3 kb) is inserted, and the cleavage site is selected from NdeI and BamHI on a plasmid. The constructed plasmids were designated pET-9a-M1R, pET-9a-A29L, pET-9a-B6R, pET-9a-A35R, respectively, see FIG. 1.
Wherein, the amino acid sequence of the M1R ORF is shown as SEQ ID NO. 1:
MGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTGGGGSHHHHHH
the amino acid sequence of the A29L ORF is shown as SEQ ID NO. 2:
MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRHPYEGGGGSHHHHHH
the amino acid sequence of the A35R ORF is shown as SEQ ID NO. 3:
MVRLNQCMSANKAAITDSAVAVAAASSTHRKVVSSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTGGGGSHHHHHH
the amino acid sequence of the B6R ORF is shown as SEQ ID NO. 4:
MSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIGGGGSHHHHHH
the nucleic acid sequence of the M1R ORF of the antigen protein of the monkey poxvirus is shown in SEQ ID NO. 5:
ATGGGAGCAGCTGCGTCAATACAAACTACAGTCAACACCCTGAGCGAACGTATTAGCTCTAAGTTGGAGCAAGAGGCTAATGCAAGCGCCCAAACTAAGTGTGATATTGAGATTGGTAATTTCTACATCCGTCAAAACCATGGTTGTAACATCACCGTTAAGAACATGTGCAGCGCGGACGCCGACGCGCAATTGGACGCGGTCCTGAGCGCGGCTACCGAAACGTACAGCGGTCTGACCCCGGAACAGAAAGCGTATGTTCCGGCAATGTTCACCGCAGCGTTAAATATCCAGACCTCCGTTAATACCGTTGTGCGCGATTTTGAGAACTACGTGAAGCAGACGTGCAACAGCTCTGCTGTGGTGGATAATAAACTGAAAATCCAAAACGTGATCATCGACGAGTGCTATGGTGCGCCAGGTTCCCCGACCAACCTCGAATTTATCAACACCGGTTCCTCGAAAGGCAACTGCGCAATTAAAGCCCTGATGCAGCTGACTACGAAGGCGACCACACAGATTGCACCGCGTCAGGTTGCGGGCACCGGCGGCGGTGGCTCACATCACCACCACCATCAC
the nucleic acid sequence of the ORF of the monkey poxvirus antigen protein A29L is shown in SEQ ID NO. 6:
ATGGATGGAACACTATTTCCCGGGGATGACGACCTCGCGATCCCGGCGACCGAATTTTTCTCCACCAAGGCGGCTAAGAACCCGGAAACTAAGCGCGAGGCCATCGTGAAAGCGTACGGCGATGACAACGAGGAAACCCTGAAACAGCGTTTGACCAACCTGGAGAAAAAGATCACGAACATTACCACCAAGTTCGAGCAGATTGAGAAGTGCTGTAAACGTAATGATGAAGTTCTGTTTCGCTTGGAGAATCATGCGGAAACGCTGCGTGCAGCAATGATTAGCCTGGCTAAAAAAATCGACGTCCAAACCGGTCGTCATCCGTATGAAGGTGGCGGTGGCAGCCATCACCACCACCACCAC
the nucleic acid sequence of the ORF of the antigen protein A35R of the monkey poxvirus is shown in SEQ ID NO. 7:
ATGGTAAGGCTAAATCAATGTATGTCAGCTAACAAGGCGGCGATCACCGATAGCGCAGTTGCTGTGGCAGCCGCGAGCAGCACCCATCGTAAGGTCGTGAGCTCTACCACGCAGTATGATCATAAAGAGAGCTGCAACGGCCTGTATTACCAGGGTTCATGCTATATCTTGCACAGCGACTACAAATCTTTTGAGGACGCCAAAGCTAATTGTGCGGCGGAAAGCAGCACTCTGCCGAATAAGTCCGACGTACTGACCACGTGGCTCATTGATTACGTTGAAGATACCTGGGGTTCGGACGGCAACCCGATTACCAAAACCACGAGCGACTACCAAGATTCCGACGTGTCGCAAGAGGTTCGCAAGTATTTCTGCACCGGTGGCGGTGGCTCCCATCACCATCACCACCAC
the nucleic acid sequence of the monkey poxvirus antigen protein B6R ORF is shown in SEQ ID NO. 8:
ATGTCAACATGTACTGTACCCACGATGAATAACGCTAAGTTGACCTCTACGGAAACGAGCTTCAACGACAAGCAGAAGGTGACCTTCACCTGCGACAGCGGCTACCATAGTCTGGACCCGAACGCCGTTTGTGAAACCGATAAGTGGAAATACGAGAACCCGTGTAAAAAAATGTGCACGGTTTCGGATTACGTGAGCGAACTGTATGATAAACCGCTTTATGAGGTGAATAGCACCATGACCTTGTCTTGCAATGGTGAGACGAAATACTTTCGTTGTGAAGAGAAAAACGGCAACACCAGCTGGAACGACACCGTGACCTGTCCGAATGCGGAATGCCAGCCACTGCAGCTGGAGCACGGCTCCTGCCAACCGGTGAAAGAAAAGTACTCCTTTGGTGAGTATATGACCATCAACTGCGACGTGGGTTACGAGGTTATCGGCGTAAGCTACATTAGCTGCACTGCGAATTCTTGGAATGTCATCCCTTCCTGCCAACAGAAGTGCGACATCCCGAGCCTCTCCAACGGTCTGATTAGCGGCTCCACCTTCAGCATTGGCGGTGTCATCCACCTGAGCTGCAAAAGCGGTTTTACCCTGACCGGTTCGCCGTCATCTACATGCATCGACGGCAAATGGAACCCGATTCTGCCGACCTGTGTTCGCAGCAATGAAGAGTTCGATCCGGTTGATGACGGTCCGGATGATGAAACTGACCTGTCCAAGTTGTCTAAGGACGTTGTTCAGTATGAGCAAGAAATTGAGAGCCTGGAGGCAACCTATCATATCGGTGGCGGTGGCAGCCATCACCACCATCACCAC。
(2) Prokaryotic expression of proteins
E.coli BL21 (DE 3) competent cells were transformed with each expression vector, and after overnight culture in an incubator at 37℃positive clones were selected the next day and inoculated in 3ml LB medium (1.0% tryptone, 1.0% sodium chloride, 0.5% yeast extract, 1.5% agar, kanamycin 50. Mu.g/ml) containing 50. Mu.g/ml kanamycin, and shake-cultured overnight at 37℃at 180 rpm; the third day is followed by 1:100 is inoculated into LB culture medium (1.0% tryptone, 0.5% yeast powder, 1% sodium chloride, 50. Mu.g/ml kanamycin) containing 50. Mu.g/ml kanamycin, the temperature is regulated to 37 ℃, the rotation speed is regulated to 240rpm, shaking culture is carried out for 3 hours until the OD value measured when the bacterial liquid is 450nm in wavelength reaches about 0.8, IPTG is added to the final concentration of 1mmol/L, and induced culture is carried out for 2 hours under a constant temperature incubator at 37 ℃, so as to obtain bacterial liquid.
(3) SDS-PAGE and Western Blot identification of prokaryotic expression proteins
200. Mu.g of the bacterial solutions were collected, centrifuged for 2min, resuspended in 80. Mu.l of PBS, and mixed with 20. Mu.l of 5×loading buffer, boiled for 5min, and sampled for 10. Mu.g. And performing conventional SDS-PAGE identification, adjusting the voltage to 80V at the beginning of electrophoresis, adjusting the voltage to 120V after bromophenol blue enters the separation gel, and continuing electrophoresis until bromophenol blue reaches the bottom of the separation gel. SDS-PAGE gels were also transferred to Nitrocellulose (NC) membranes, and shaken for 2h at room temperature with 5% skim milk (PBST with 5% skim milk powder) and antibody skim milk 1: the 10000 released His-HRP labeled mouse monoclonal antibody is incubated and shaken for 3h at room temperature, PBST is washed for 3 times, 10min each time, the water on the surface of the membrane is absorbed, and after the membrane is dried, the developing solution is added for developing. Whether the M1R, A29L, B6R, A35R protein was expressed in E.coli was examined. The results are shown in FIG. 2B, where the size of each protein matches that expected, indicating successful expression of each antigen protein.
(4) Prokaryotic protein expression condition optimization
Amplifying and culturing the bacterial solutions, centrifuging for 30min, discarding supernatant, re-suspending with 30ml PBS, crushing bacterial cells with a high-pressure homogenizer until the appearance is clear and transparent, centrifuging for 15min with a high-speed centrifuge 10000 Xg. After centrifugation, the supernatant was purified by His-Band column and protein purifier. The ultraviolet absorbance peak-to-peak value was recorded. And (3) carrying out ultrafiltration concentration on the obtained sample, purifying again by a gel filtration chromatography system, sampling the collected sample, carrying out SDS-PAG identification, and evaluating the effect of protein purification.
The 4 kinds of expressed bacteria 1 are respectively taken: 100 is inoculated into LB culture medium containing 50 mug/ml kanamycin, the temperature is regulated to 37 ℃, the rotation speed is regulated to 240rpm, the shaking culture is carried out for 3 hours until the OD value of the bacterial liquid measured at the wavelength of 450nm reaches about 0.8, and IPTG is added to the final concentration of 0.2mmol/L,0.4mmol/L,0.8mmol/L and 1mmol/L. And respectively carrying out induction culture for 2h, 4h and 6h in a 37 ℃ constant temperature incubator and a 25 ℃ constant temperature incubator, and obtaining bacterial liquid for conventional SDS-PAGE identification. The optimal conditions for expression of the three proteins at different temperatures and different IPTG concentrations were compared as shown in fig. 2 a. The results show that the expression bacteria are expressed under the induction conditions of 37 ℃ and 25 ℃, the expression quantity of A29L and M1R is high at 37 ℃ for 4 hours, and the expression quantity of B6R and A35R is high at 25 ℃ for 6 hours (as shown in figure 2A).
(5) Purification of M1R, A29L, B6R, A35R protein
Bacterial pellet of monkey pox A29L and B6R was lysed with buffer A (50 mmol/LTris,500mmol/LNaCl, pH 7.4) and the bacteria resuspended in buffer A, broken by a protein homogenizer, 800pa,20min. The cell lysate was centrifuged at 10000 Xg for 15 minutes to remove insoluble materials. The supernatant was filtered through a 0.45 μm filter, and the filtrate was purified by passing through a nickel column. The nickel column is balanced by using the solution A with the volume of 10 times, then the protein is put on the column, the solution A with the volume of 5-10 times is used for balancing the nickel column, then the solution B with the volume of 10 times (50 mmol/LTris,500mmol/LNaCl,500mmol/LpH 7.4.4) is used for gradient elution, and the eluent is taken out to obtain the protein solution. The column was then equilibrated with 10 times the volume of solution A, eluted with 5 times the volume of deionized water, and finally eluted with 5 times the volume of 20% ethanol. Concentrating the collected protein liquid, purifying again by a gel filtration chromatography system, sampling the collected sample, performing SDS-PAG identification, evaluating the protein purification effect, detecting the protein purity by SDS-PAGE electrophoresis, concentrating the protein liquid in a ultrafiltration tube, measuring the concentration by a BCA kit, and sub-packaging and storing in a refrigerator at-20 ℃.
a35R, M1R was obtained from inclusion bodies by renaturation. And (5) crushing and centrifuging thalli, taking a precipitate, and discarding supernatant to leave the precipitate. The precipitate was taken, 40 times (g/mL) of washing buffer (50 mmol/LTris,500mmol/LNaCl,2mol/L urea, 1% Triton X-100, pH 7.4) was added, and after thorough mixing, the mixture was washed with a shaking table at room temperature for 2 hours, centrifuged at 4℃at 10000 Xg for 15min, and the supernatant was discarded to obtain inclusion bodies. The pellet and supernatant were taken from each of the above steps and subjected to 12% SDS-PAGE detection. Precisely weighing inclusion bodies, adding 20 times (g/mL) of denaturation buffer (50 mmol/LTris,500mmol/LNaCl,8mol/L urea, 50mM beta-mercaptoethanol pH 7.4), fully mixing, dissolving overnight at low temperature (8-10 ℃ C., 12h above), centrifuging at 4 ℃ C., 10000 Xg for 15min, and taking supernatant to obtain inclusion body denaturation solution. The heparin column was equilibrated with 10 volumes of denaturation buffer (50 mmol/LTris,500mmol/LNaCl,8mol/L urea, 50mM beta-mercaptoethanol pH 7.4) at a flow rate of 1mL/min on a protein purification apparatus; and (3) fully balancing the denatured protein sample at the flow rate of 0.5mL/min by using the balancing solution, and then starting gradient renaturation. And (3) solution A: 50mmol/LTris,500mmol/LNaCl,8mol/L urea, 50mM beta-mercaptoethanol pH 7.4; and (2) liquid B: 50mmol/LTris,500mmol/LNaCl, pH 7.4. After complete renaturation, the protein solution was obtained by gradient elution (10 column volumes, 1 mL/min) with imidazole-containing eluent B (50 mmol/LTris,500mmol/LNaCl,500mmol/LpH 7.4.4), and collecting the peak of each stage. The remaining steps are as described previously. The M1R, A29L, B6R, A R protein with higher purity is obtained, as shown in C in FIG. 2.
(6) And (3) fully mixing and incubating 10 mug of each of the M1R, A29L, A R and B6R proteins prepared by the method with 40 mug of aluminum hydroxide adjuvant or 40 mug of CpG adjuvant CpG790910 mug respectively to prepare the monkey pox virus subunit vaccine.
EXAMPLE 2 analysis of the immune response of mice elicited by MPXV subunits
(1) Immunization of mice
8-week-old female BALB/c mice were selected and randomly divided into five groups, five of each group, and the mice were immunized by intramuscular injection on days 0 and 14, respectively, according to the following method (note: 40. Mu.g of AMBA, which means 10. Mu.g of each of A29L, M1R, B R and A35R). The immunization program is shown in fig. 3:
(2) Determination of mouse specific antibody titers by enzyme-linked immunosorbent assay (ELISA)
M1R, A, A35, B6R antigen-specific antibody titers were detected by indirect ELISA, 96-well ELISA plates, coated overnight at 4℃with 200ng of purified monkey pox virus protein, washed 3 times with wash buffer and blocked in Blocking buffer for 2 hours. After washing the plates 3 times with Washingbuffer, the mouse serum was diluted and incubated on the plates for 2 hours at room temperature, followed by 3 washes. Plates were incubated with 1:50000 secondary anti-HRP conjugated anti-mouse IgG antibody followed by TMB substrate. Absorbance at 450nm was measured by an enzyme-labeled instrument.
As a result, as shown in fig. 4, MPXV-specific antibodies could be detected in all vaccinated mice after 14d of immunization 1, and the antibody levels in AMBA group, AMBA/alum group and AMBA/CpG group increased to higher levels after 14d of secondary immunization, while the antibody levels in alum group and CpG group were not significantly changed from those before immunization. And AMBA/CpG groups were able to generate a more intense and durable immune response compared to AMBA/alum groups, with higher levels of antibodies against each antigen in AMBA, AMBA/alum and AMBA/CpG group mouse serum after 60d of priming. The monkey pox virus subunit vaccine prepared by the invention can stimulate organisms to produce specific antibodies aiming at M1R, A, A35 and B6R antigens.
(3) Monkeypox virus specific T cell immunoassay
Antigen-specific T cell immune responses were analyzed on a polychromatic flow cytometer. After spleen cells were collected from immunized or control mice, 2X10 mice were taken from each 6 The individual cells were cultured in a carbon dioxide incubator and continued to be cultured for 4 hours after stimulation with 10. Mu.g/mL of the monkey poxvirus protein polypeptide. Brefeldin a was then added to spleen cells and incubated for 6 hours. The stimulated cells were washed in PBS/0.5% BSA and stained with APC/Fire 750 anti-mouse CD3 antibody, FITC anti-mouse CD4 antibody and Brilliant and then fixed using a fixation/rupture solution kit, and stained with PE anti-mouse IFN-gamma antibody, PE anti-mouse IL-2 antibody and PE anti-mouse IL-4 antibody. Finally, the flow analysis is carried out, and the results show that each group of mice CD4 + And CD8 + There was no significant difference in the percentage of T cells, but CD4 in AMBA/CpG immunized mice + IFN-gamma produced by T cells is significantly different from adjuvant CpG treated groups, demonstrating that the monkey poxvirus subunit vaccine is capable of inducing CD4 + T cells are responsible for inducing cellular immune responses as shown in figure 5.
(4) ELISA spot (ELISPOT) assay
The spleen tissue of the mice was isolated using a commercial kit (company: shenzhen Daidae bioengineering Co., ltd. # 2210005) and the cells were filtered using a40 μm cell filter. Cell count was performed after lysing erythrocytes in spleen cells with erythrocyte lysate at 2x10 5 The density of individual cells/wells was added to the medium. Three wells were set up for negative and positive controls. 10 mug of protein polypeptide stimulus is added, and the mixture is cultured in a 5% CO2 incubator at 37 ℃ for 32-48 hours. The culture broth was discarded and the cells were lysed using pre-chilled deionized water at 4℃for 10min. After washing the plate five times, the labeled detection antibody IFN-gamma was added and incubated at 37℃for 1h. After the antibody incubation is finished, pouring liquid in the hole, repeatedly washing for 5 times, and adding the enzyme-linked avidin for incubation for 1h. Washing the plate for 5 times after incubation; adding the color development liquid, and standing at room temperature in dark place for 15-45min, distilled water was added to terminate the reaction. After natural air drying, counts were performed using an ELISPOT reader system. As shown in fig. 6, the results showed that the adjuvant-only alum group and CpG group had very little IFN- γ expression, whereas AMBA group, AMBA/alum group and AMBA/CpG group all had high levels of IFN- γ expression, and that the amount of IFN- γ secreting lymphocytes was significantly higher in AMBA/CpG group than AMBA/alum group, indicating that PBMCs vaccinated with AMBA/CpG group were significantly more potent in secreting IFN- γ, inducing a more intense cellular immune response.
(5) Determination of monkey poxvirus neutralizing antibodies
Prior to conducting the infectious virus neutralization assay, the mouse serum is heat treated at 56℃for 30 minutes to remove complement and other potential neutralizing agents. Three-fold serial dilutions of serum from 1:10 to 1:2430 were incubated with VACV for 1 hour at 37 ℃. Mouse complement was added to the mixture at a final concentration of 2%. The mixture was then incubated with BHK 21 cells for 1 hour for adsorption. The supernatant was then replaced with fresh DMEM supplemented with 2% fbs. 72 hours after infection, cells were fixed in 4% paraformaldehyde for 15 minutes and then stained in DAPI for 5 minutes. The infected cells were assayed with the Harmony software (Perkin Elmer) by taking images with an OPeretta under a high content cell imaging system (Perkin Elmer). As shown in fig. 7, the neutralization titers of the alum group and the CpG group were zero, and the neutralization titers of the AMBA group and the AMBA/alum group were 1:270, whereas AMBA/CpG group has a higher potency of 1:810, the best protection effect.
The foregoing description of the preferred embodiments of the invention is not intended to be limiting, but rather is intended to cover all modifications, equivalents, and alternatives falling within the spirit and principles of the invention.
Claims (10)
1. The monkey pox virus subunit vaccine is characterized by comprising an antigen and an adjuvant, wherein the antigen components are monkey pox virus antigen proteins M1R, A29L, A R and B6R, his tags are added to the tail parts of the monkey pox virus antigen proteins M1R, A29L, A35R or B6R, the amino acid sequence of the monkey pox virus antigen protein M1R is shown as SEQ ID NO.1, the amino acid sequence of the monkey pox virus antigen protein A29L is shown as SEQ ID NO.2, the amino acid sequence of the monkey pox virus antigen protein A35R is shown as SEQ ID NO.3, and the amino acid sequence of the monkey pox virus antigen protein B6R is shown as SEQ ID NO. 4.
2. The monkey poxvirus subunit vaccine of claim 1, wherein: the adjuvant is aluminum hydroxide adjuvant or CpG adjuvant.
3. The monkey poxvirus subunit vaccine of claim 2, wherein: the adjuvant is CpG.
4. The nucleic acid sequence of encoding the monkey pox virus antigen protein M1R is shown as SEQ ID NO.5, the nucleic acid sequence of encoding the monkey pox virus antigen protein A29L is shown as SEQ ID NO.6, the nucleic acid sequence of encoding the monkey pox virus antigen protein A35R is shown as SEQ ID NO.7, and the nucleic acid sequence of encoding the monkey pox virus antigen protein M1R is shown as SEQ ID NO. 8.
5. A method of preparing a monkey poxvirus subunit vaccine according to any one of claims 1 to 3, comprising the steps of:
(1) Constructing expression vectors containing nucleotide sequences capable of encoding the monkey poxvirus antigen protein M1R, A L, A R or B6R respectively;
(2) Transferring each expression vector into a host cell for expression culture to obtain recombinant bacterial liquid containing the monkey pox virus protein;
(3) Culturing the recombinant bacterial liquid to express monkey pox virus antigen protein M1R, A29L, A R or B6R;
(4) The monkey pox virus subunit vaccine is prepared by separating and purifying the monkey pox virus antigen protein M1R, A29L, A R or B6R and assisting with an adjuvant.
6. The method for preparing the monkey poxvirus subunit vaccine according to claim 5, wherein the expression vector is pET-9a.
7. The method of producing a monkey poxvirus subunit vaccine according to claim 5, wherein the host cell is a competent cell of e.coli BL21 (DE 3).
8. The method of claim 5, wherein in step (4), when the adjuvant is aluminum hydroxide, the amount of the antigen protein of the monkey poxvirus is 10 μg each of M1R, A29L, A R and B6R, and the amount of the aluminum hydroxide adjuvant is 40 μg; when the adjuvant is CpG, the monkey pox virus antigen protein is 10 mug of each of M1R, A29L, A R and B6R, and CpG790910 mug, and the adjuvant and each monkey pox virus antigen protein are fully and uniformly mixed.
9. Use of a monkey poxvirus subunit vaccine according to any one of claims 1 to 3 in monkey poxvirus immunization or for the preparation of a medicament for the prevention of a disease caused by a monkey poxvirus infection.
10. The use according to claim 9, characterized in that: when the monkey pox virus subunit vaccine is applied to monkey pox virus immunization, 2 injections are inoculated.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310668344.9A CN116603060A (en) | 2023-06-07 | 2023-06-07 | Monkey poxvirus subunit vaccine and preparation method and application thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310668344.9A CN116603060A (en) | 2023-06-07 | 2023-06-07 | Monkey poxvirus subunit vaccine and preparation method and application thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
CN116603060A true CN116603060A (en) | 2023-08-18 |
Family
ID=87676350
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202310668344.9A Pending CN116603060A (en) | 2023-06-07 | 2023-06-07 | Monkey poxvirus subunit vaccine and preparation method and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN116603060A (en) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2024041612A1 (en) * | 2022-08-24 | 2024-02-29 | 康希诺(上海)生物研发有限公司 | Orthopoxvirus mrna vaccine, preparation method therefor, and use thereof |
CN117683122A (en) * | 2024-01-31 | 2024-03-12 | 深圳湾实验室 | Antibody against monkey poxvirus, and preparation method and application thereof |
-
2023
- 2023-06-07 CN CN202310668344.9A patent/CN116603060A/en active Pending
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2024041612A1 (en) * | 2022-08-24 | 2024-02-29 | 康希诺(上海)生物研发有限公司 | Orthopoxvirus mrna vaccine, preparation method therefor, and use thereof |
CN117683122A (en) * | 2024-01-31 | 2024-03-12 | 深圳湾实验室 | Antibody against monkey poxvirus, and preparation method and application thereof |
CN117683122B (en) * | 2024-01-31 | 2024-05-07 | 深圳湾实验室 | Antibody against monkey poxvirus, and preparation method and application thereof |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN116603060A (en) | Monkey poxvirus subunit vaccine and preparation method and application thereof | |
CN110760006B (en) | African swine fever immune system targeting genetic engineering vaccine | |
CN116143938B (en) | COVID-19 subunit vaccine and preparation method and application thereof | |
CN112409496B (en) | Fusion protein for transmembrane expression of novel coronavirus antigen S2, recombinant vector, recombinant dendritic cell and application thereof | |
CN111018995A (en) | B, T cell epitope tandem fusion vaccine for African swine fever | |
CN105906721B (en) | Varicella-zoster virus gB-gE-gH-gL fusion protein, genetic engineering subunit vaccine and preparation method | |
CN104293741A (en) | Respiratory syncytial virus virus-like particle vaccine as well as preparation method and application thereof | |
CN113845576A (en) | Recombinant feline herpesvirus type 1 gB-gD protein and application thereof | |
CN110684116A (en) | Mycobacterium tuberculosis EEC fusion protein, preparation method and application thereof | |
CN107141341B (en) | Antigen polypeptide pool for detecting mycobacterium tuberculosis infection and application | |
US8282936B2 (en) | Human papillomavirus vaccine for oral administration | |
CN101735310B (en) | Human papilloma virus (HPV) fusion protein, gene, carrier, strain, preparation method and application | |
CN116785423A (en) | mRNA vaccine for fusion expression of monkey pox virus protective antigen, composition for delivering mRNA vaccine, preparation method and application thereof | |
CN106226520A (en) | Antigen of mycobacterium tuberculosis albumen Rv0865 and the application of B cell epitope peptide thereof | |
CN101885778B (en) | HPV (Human Papilloma Virus) 16 type L2N120E7E6 fusion protein, gene, preparation method and application | |
CN115975924A (en) | Preparation method and application of CTL cell | |
CN112730829B (en) | Colloidal gold test strip for rapidly detecting oyster herpesvirus OsHV-1 and application thereof | |
CN112300290B (en) | Novel coronavirus polypeptide vaccine using papillomavirus viroid particle presentation antigen | |
CN111748042B (en) | African swine fever fusion protein containing endotoxin and preparation method and application thereof | |
CN107488677A (en) | One plant of vaccinia virus recombinant for carrying the latent gene of membranous antigen 2 of Epstein-Barr virus and its application | |
CN115322247A (en) | Novel charge mutant antigen of coronavirus receptor binding region and application | |
CN109568574B (en) | Application of sPD1 protein and/or sPD1 gene as immune adjuvant | |
RU2317107C2 (en) | Recombinant vaccine against human immunodeficiency virus type 1 | |
CN116162141B (en) | Mycobacterium tuberculosis antigen EPCRA013 and application thereof | |
CN116813795B (en) | Recombinant AaLS-BSP fusion peptide, preparation method and application |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination |