CN116426473A - NKG2D positive exosome, preparation method and application - Google Patents
NKG2D positive exosome, preparation method and application Download PDFInfo
- Publication number
- CN116426473A CN116426473A CN202310177680.3A CN202310177680A CN116426473A CN 116426473 A CN116426473 A CN 116426473A CN 202310177680 A CN202310177680 A CN 202310177680A CN 116426473 A CN116426473 A CN 116426473A
- Authority
- CN
- China
- Prior art keywords
- cell
- exosomes
- culture
- cells
- supernatant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 210000001808 exosome Anatomy 0.000 title claims abstract description 141
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 title claims abstract description 33
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 title claims abstract description 33
- 238000002360 preparation method Methods 0.000 title claims abstract description 16
- 210000000822 natural killer cell Anatomy 0.000 claims abstract description 53
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 35
- 201000007270 liver cancer Diseases 0.000 claims abstract description 25
- 208000014018 liver neoplasm Diseases 0.000 claims abstract description 24
- 238000004113 cell culture Methods 0.000 claims abstract description 12
- 210000004027 cell Anatomy 0.000 claims description 134
- 239000006228 supernatant Substances 0.000 claims description 37
- 238000000034 method Methods 0.000 claims description 30
- 238000001179 sorption measurement Methods 0.000 claims description 27
- 201000011510 cancer Diseases 0.000 claims description 15
- 239000012091 fetal bovine serum Substances 0.000 claims description 15
- 238000011282 treatment Methods 0.000 claims description 14
- 238000005199 ultracentrifugation Methods 0.000 claims description 13
- 239000004005 microsphere Substances 0.000 claims description 11
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 claims description 10
- 201000010099 disease Diseases 0.000 claims description 9
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 9
- 239000001963 growth medium Substances 0.000 claims description 9
- 230000001965 increasing effect Effects 0.000 claims description 9
- 210000002381 plasma Anatomy 0.000 claims description 9
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 claims description 8
- 239000000741 silica gel Substances 0.000 claims description 8
- 229910002027 silica gel Inorganic materials 0.000 claims description 8
- 108091003079 Bovine Serum Albumin Proteins 0.000 claims description 6
- 239000000706 filtrate Substances 0.000 claims description 6
- 239000007788 liquid Substances 0.000 claims description 6
- 239000000463 material Substances 0.000 claims description 6
- 229960002685 biotin Drugs 0.000 claims description 5
- 235000020958 biotin Nutrition 0.000 claims description 5
- 239000011616 biotin Substances 0.000 claims description 5
- 210000004369 blood Anatomy 0.000 claims description 5
- 239000008280 blood Substances 0.000 claims description 5
- 238000012258 culturing Methods 0.000 claims description 5
- 238000004519 manufacturing process Methods 0.000 claims description 5
- 239000002609 medium Substances 0.000 claims description 5
- 239000013049 sediment Substances 0.000 claims description 5
- 102100027221 CD81 antigen Human genes 0.000 claims description 4
- 101000914479 Homo sapiens CD81 antigen Proteins 0.000 claims description 4
- 239000011248 coating agent Substances 0.000 claims description 4
- 238000000576 coating method Methods 0.000 claims description 4
- 238000010899 nucleation Methods 0.000 claims description 4
- 239000008188 pellet Substances 0.000 claims description 4
- 238000000926 separation method Methods 0.000 claims description 4
- 239000000725 suspension Substances 0.000 claims description 4
- 238000012546 transfer Methods 0.000 claims description 4
- 238000005406 washing Methods 0.000 claims description 4
- 238000004383 yellowing Methods 0.000 claims description 4
- 206010020772 Hypertension Diseases 0.000 claims description 3
- 206010003246 arthritis Diseases 0.000 claims description 3
- 206010012601 diabetes mellitus Diseases 0.000 claims description 3
- 239000003814 drug Substances 0.000 claims description 3
- 239000003480 eluent Substances 0.000 claims description 3
- 238000002637 fluid replacement therapy Methods 0.000 claims description 3
- 238000000703 high-speed centrifugation Methods 0.000 claims description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims description 3
- 239000012531 culture fluid Substances 0.000 claims description 2
- 210000004748 cultured cell Anatomy 0.000 claims description 2
- 239000012894 fetal calf serum Substances 0.000 claims description 2
- 238000001914 filtration Methods 0.000 claims description 2
- 238000003306 harvesting Methods 0.000 claims description 2
- 239000002244 precipitate Substances 0.000 claims description 2
- 230000001502 supplementing effect Effects 0.000 claims description 2
- 210000002993 trophoblast Anatomy 0.000 claims 3
- 238000009472 formulation Methods 0.000 claims 2
- 239000000203 mixture Substances 0.000 claims 2
- 210000002966 serum Anatomy 0.000 description 10
- 239000012190 activator Substances 0.000 description 9
- 210000001744 T-lymphocyte Anatomy 0.000 description 8
- 101150108726 dex gene Proteins 0.000 description 7
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 7
- 210000004698 lymphocyte Anatomy 0.000 description 7
- 238000001514 detection method Methods 0.000 description 6
- 230000000638 stimulation Effects 0.000 description 6
- 210000004881 tumor cell Anatomy 0.000 description 6
- 108091007433 antigens Proteins 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 210000004700 fetal blood Anatomy 0.000 description 5
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 5
- 210000004185 liver Anatomy 0.000 description 5
- 230000035755 proliferation Effects 0.000 description 5
- 238000011160 research Methods 0.000 description 5
- 239000000427 antigen Substances 0.000 description 4
- 102000036639 antigens Human genes 0.000 description 4
- 239000011324 bead Substances 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 238000009169 immunotherapy Methods 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- 108090000765 processed proteins & peptides Proteins 0.000 description 4
- 229960005486 vaccine Drugs 0.000 description 4
- 230000000259 anti-tumor effect Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 230000002147 killing effect Effects 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 230000004614 tumor growth Effects 0.000 description 3
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 2
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 2
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 2
- 108091054437 MHC class I family Proteins 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 210000000612 antigen-presenting cell Anatomy 0.000 description 2
- 230000005975 antitumor immune response Effects 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 229910052802 copper Inorganic materials 0.000 description 2
- 239000010949 copper Substances 0.000 description 2
- 230000000139 costimulatory effect Effects 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 231100000517 death Toxicity 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 238000001493 electron microscopy Methods 0.000 description 2
- 238000007667 floating Methods 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 238000011134 hematopoietic stem cell transplantation Methods 0.000 description 2
- 238000003317 immunochromatography Methods 0.000 description 2
- 230000001506 immunosuppresive effect Effects 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000015788 innate immune response Effects 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 210000001700 mitochondrial membrane Anatomy 0.000 description 2
- 230000000877 morphologic effect Effects 0.000 description 2
- 238000005457 optimization Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 238000002271 resection Methods 0.000 description 2
- 239000000523 sample Substances 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 238000002054 transplantation Methods 0.000 description 2
- 206010003445 Ascites Diseases 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 1
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 1
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 1
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 description 1
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 1
- 101000991061 Homo sapiens MHC class I polypeptide-related sequence B Proteins 0.000 description 1
- 206010062016 Immunosuppression Diseases 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102000000589 Interleukin-1 Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 101150030732 KLRK1 gene Proteins 0.000 description 1
- 239000000232 Lipid Bilayer Substances 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 102100030300 MHC class I polypeptide-related sequence B Human genes 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 206010027480 Metastatic malignant melanoma Diseases 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 230000006051 NK cell activation Effects 0.000 description 1
- 108010019160 Pancreatin Proteins 0.000 description 1
- COQLPRJCUIATTQ-UHFFFAOYSA-N Uranyl acetate Chemical compound O.O.O=[U]=O.CC(O)=O.CC(O)=O COQLPRJCUIATTQ-UHFFFAOYSA-N 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 230000004721 adaptive immunity Effects 0.000 description 1
- 238000009098 adjuvant therapy Methods 0.000 description 1
- 238000011467 adoptive cell therapy Methods 0.000 description 1
- 238000005054 agglomeration Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000006023 anti-tumor response Effects 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 238000010009 beating Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 238000007664 blowing Methods 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 239000012888 bovine serum Substances 0.000 description 1
- 230000005773 cancer-related death Effects 0.000 description 1
- 229910002091 carbon monoxide Inorganic materials 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 230000007882 cirrhosis Effects 0.000 description 1
- 208000019425 cirrhosis of liver Diseases 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000012136 culture method Methods 0.000 description 1
- 238000009109 curative therapy Methods 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 238000011393 cytotoxic chemotherapy Methods 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 230000005860 defense response to virus Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 230000001066 destructive effect Effects 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 102000038379 digestive enzymes Human genes 0.000 description 1
- 108091007734 digestive enzymes Proteins 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 244000000015 environmental pathogen Species 0.000 description 1
- 238000009093 first-line therapy Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 239000006260 foam Substances 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 210000004251 human milk Anatomy 0.000 description 1
- 235000020256 human milk Nutrition 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000037451 immune surveillance Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000006058 immune tolerance Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 230000001024 immunotherapeutic effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 230000035992 intercellular communication Effects 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 230000021633 leukocyte mediated immunity Effects 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 238000007726 management method Methods 0.000 description 1
- 231100000682 maximum tolerated dose Toxicity 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 208000021039 metastatic melanoma Diseases 0.000 description 1
- 238000012737 microarray-based gene expression Methods 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 239000003147 molecular marker Substances 0.000 description 1
- 238000012243 multiplex automated genomic engineering Methods 0.000 description 1
- 230000031942 natural killer cell mediated cytotoxicity Effects 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 244000309459 oncolytic virus Species 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- JMANVNJQNLATNU-UHFFFAOYSA-N oxalonitrile Chemical compound N#CC#N JMANVNJQNLATNU-UHFFFAOYSA-N 0.000 description 1
- 229940055695 pancreatin Drugs 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000008447 perception Effects 0.000 description 1
- 238000009520 phase I clinical trial Methods 0.000 description 1
- 238000009521 phase II clinical trial Methods 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 108090000623 proteins and genes Proteins 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 210000002536 stromal cell Anatomy 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 210000004243 sweat Anatomy 0.000 description 1
- 238000009121 systemic therapy Methods 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- 210000001138 tear Anatomy 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 230000005909 tumor killing Effects 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0646—Natural killers cells [NK], NKT cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2502/00—Coculture with; Conditioned medium produced by
- C12N2502/30—Coculture with; Conditioned medium produced by tumour cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2509/00—Methods for the dissociation of cells, e.g. specific use of enzymes
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biomedical Technology (AREA)
- Immunology (AREA)
- Zoology (AREA)
- Diabetes (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Hematology (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- Endocrinology (AREA)
- Obesity (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Virology (AREA)
- Microbiology (AREA)
- Developmental Biology & Embryology (AREA)
- Epidemiology (AREA)
- Emergency Medicine (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Rheumatology (AREA)
- Physical Education & Sports Medicine (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
The invention relates to an NKG2D positive exosome, a preparation method and application, belonging to the field of exosomes. According to the invention, by utilizing the characteristic of innovative tumor source exosomes on NK cell culture, activated NK cell NKG2GD positive exosomes are extracted in a large scale, so that the aim of treating liver cancer is fulfilled.
Description
Technical Field
The invention belongs to the technical field of biology, and relates to an exosome, in particular to an NKG2D positive exosome, a preparation method and application.
Background
Liver cancer is a cancer that originates in the liver and is an invasive tumor, often occurring in the context of chronic liver disease and cirrhosis. Primary liver cancer or hepatocellular carcinoma (HCC) is the fifth most common cancer in men and the seventh most common cancer in women, the third leading cause of cancer-related death worldwide. Liver cancer is a high-incidence malignant tumor, and the incidence rate of malignant tumors in the world is 6 th, and the death number of liver cancer patients is 3 rd in all cancers in 83 ten thousand deaths.Although in spite ofMethods of treating liver cancer have advanced, but it remains one of the most difficult cancers to treat. For early HCC patients, surgery, local destructive therapy, and liver transplantation offer therapeutic potential. However, recurrence of HCC after curative treatment remains a major problem, with morbidity exceeding 70% after 5 years. Even small liver cancer (3 cm) patients in early stages of surgery have unsatisfactory survival rates for 5 years. Often, diagnosis of HCC is often in an advanced stage, and many advanced patients are not eligible to receive treatment. At present, liver cancer is treated by interdisciplinary and multi-mode treatment schemes are generally selected individually according to complex interactions such as tumor stage, degree of liver basic diseases and overall health condition of patients. In the United states (national Integrated cancer network [ NCCN)]) European (European liver research institute-European cancer research and treatment organization [ EASLERTTC ]]) And asia (consensus statement of asian tumor peak society in 2009 [ AOS)]) There is also a difference in management of liver cancer among different guidelines. Current strategies for treating liver cancer include systemic therapy, standard first-line therapy, cytotoxic chemotherapy, immunotherapy, oncolytic virus therapy, new targeted therapies being developed, surgical resection, liver transplantation, local area therapy, adjuvant therapy after surgical resection, etc., while strategies for treatment with exosomes remain in the research stage.
The evolutionary dynamics of the immune system are mainly due to the stress exerted by environmental pathogens. However, both innate and adaptive immunity can utilize different complementary mechanisms to control and prevent tumor growth and spread. For example, cytolytic T lymphocytes recognize tumor-derived polypeptides in the context of MHC class I molecules, thus requiring MHC expression on tumor cells, whereas natural killer cells (NK) are perceived and activated in the absence of MHC molecules. These different properties provide important clues to the development of cancer treatment strategies. Thus, the identification of tumor antigens and immunogenic tumor peptides enables the development of tumor vaccines that better target tumor cells. On the other hand, the ability of NK cells to kill MHC class I deficient tumors has been exploited by different adoptive cell therapies, including infusion of lymphokine activated NK cells, hematopoietic Stem Cell Transplantation (HSCT), especially HLA-haplotype homoHSCT (hard-HSCT), to treat high-risk leukemia. T cells and more recently NK cells engineered to express Chimeric Antigen Receptors (CARs) also represent a new strategy of particular interest for the treatment of blood and solid tumors.
NK cells are key elements of innate immunity, capable of mediating strong anti-tumor and antiviral responses, directly killing cancer or infected cells, and indirectly improving antibody and T cell mediated responses. Indeed, NK cell mediated cytotoxicity and cytokine release can affect the activity of additional innate immune cells (dendritic cells, macrophages and neutrophils) and confer NK cell modulating functions that can affect subsequent antigen-specific, HLA-restricted T and B cell responses. NK cells express a single self iKIR offer advantages to the host because it allows the perception of loss of a single HLA class I allotype or peptide-induced changes, thereby killing damaged cells by a "lost self-recognition" mechanism. By the same mechanism, when cultured NK cells express only iKIR(s) which is not involved in HLA class I molecules, a heterologous reaction can occur. This provides a breakthrough therapeutic regimen for the treatment of heterologous diseases. NK is, however, after all self-replicating, susceptible to tumor microenvironment in vivo, and of uncertain variability.
The exosomes are subcellular vesicles with an average diameter of 100nm surrounded by a lipid bilayer membrane. They are found in almost all body fluids, including blood, sweat, tears, urine, saliva, breast milk, ascites fluid and cerebrospinal fluid. Exosomes are a novel intercellular communication system that carry and transmit signaling molecules that regulate the physiological state of cells, closely related to the occurrence and development of various diseases. Many studies have shown that exosomes have a close relationship with the occurrence and progression of cancer. In tumor microenvironments, exosomes can transfer bioactive molecules between tumor cells, immune cells and stromal cells, helping cancer cells to escape immune surveillance, inducing immune tolerance. In contrast, exosomes from immune cells can inhibit tumor growth, proliferation and metastasis. Thus, exosomes play a role in cancer immunity.
The primary goal of tumor immunotherapy is to stimulate immunosuppressive hosts to recognize and eradicate cancer cells. Exosomes can be used as delivery systems for immunotherapeutic drugs, antigens or genes by modifying the cells that secrete the exosomes. Both immature and mature dendritic cells can produce exosomes, and DC-Derived Exosomes (DEXs) can overcome tumor-induced immunosuppression by direct and indirect means. The level of MHC I, MHC II and costimulatory molecules in the exosomes released by mature DCs is higher than that of immature DCs, with stronger immunostimulation. The DEXs surface has MHC/peptide complex, can promote proliferation and activation of IL-15Ra and NKG2D dependent NK cells, and can enhance the T cell dependent antitumor activity. DeXs also activates T cells, enhances T cell mediated immune responses, and inhibits the growth of breast cancer cells. Anti-tumor vaccines based on DEXs have entered phase I and phase II clinical trials after animal model trials. Studies have shown that in 15 metastatic melanoma patients, exosomes are not secondarily toxic at the maximum tolerated dose, suggesting the safety of DEXs as a tumor vaccine. In treating non-small cell lung cancer patients, DEX may carry the melanoma antigen gene MAGE, which demonstrates the feasibility and potential effectiveness of DEX vaccines. In addition, exosomes from the mouse cell line expressing hMUC1 promote immune responses and anti-tumor activity to combat the growth of tumor cells expressing hMUC1 in vivo. CAR-T cell derived exosomes can replace CAR-T cells as a method of tumor immunotherapy. Exosomes secreted by antigen-presenting cells (APCs) are capable of stimulating proliferation of T cells in vitro and inducing anti-tumor immune responses in vivo. TEXs contain tumor-associated antigens, costimulatory molecules, MHC I and MHC II molecules, potentially inducing potent anti-tumor immune responses. Tex can cross-present to cytotoxic T lymphocytes via APC, thereby exerting tumor killing effects. This may provide a valuable new direction for immunotherapy for cancer treatment.
The application number is CN 202011196500.9 discloses an exosome sorting method in the NK cell activation stage, and the method mainly solves the problem that no technology for directionally sorting umbilical cord blood specific exosomes exists at present. The specific stimulation is adopted to separate the extracellular secretion of the activated umbilical cord blood NK cell period, the IL-2 is utilized to proliferate NK cells, and IL-12, IL-15, GM-SCF and Fit3-L can promote the activation of NK cells and induce CD34+ stem cells to differentiate into NK cells. And sorting and collecting NK cells in about 10d of in vitro culture to obtain more amount of exosomes secreted by the NK cells. The invention focuses on a sorting strategy and a culture method of NK cells of an umbilical cord blood source; sorting the exosomes by means of anion exchange chromatography columns. And (5) a heavy preparation process.
The application number is CN 202110021453.2 discloses a preparation method and application of NK cell exosomes, wherein the method comprises the following steps: NK cell culture preparation NK cell exosomes (NKE) were prepared from NKEM. The NKEM and NKE prepared by the invention not only have antiviral and anticancer effects, but also have the effect of beautifying the skin. NKEM production is higher than NKE; the same NK cells were cultured in half, NKE and NKEM were prepared separately, and the yield of the latter was about 15 times higher than that of the former. Not only overcomes the bottleneck that NKE cannot be produced in large quantities, but also has certain reference value for industrialization of other extracellular secretion products. The present invention lyses NK cells and uses the cell contents to expand the amount of exosomes. The cell contains a large amount of lysosomes, digestive enzymes and the like which easily cause inflammatory reaction after entering the human body, and the corresponding safety detection is not carried out.
Disclosure of Invention
In view of the above problems, the present invention employs exosomes derived from a liver cancer cell line to specifically treat umbilical cord blood NK cells/adult NK cells during the culture period, and collects exosomes containing specific NKG2G markers to inhibit proliferation of liver cancer cells. According to the invention, by utilizing the characteristic of innovative tumor source exosomes on NK cell culture, activated NK cell NKG2GD positive exosomes are extracted in a large scale, so that the aim of treating liver cancer is fulfilled.
The invention adopts the following specific scheme:
a method for preparing an NKG2D positive exosome comprising the steps of:
step one, removing the exosomes of the fetal bovine serum: removing exosomes in the fetal calf serum by adopting an ultracentrifugation combined immunoadsorption column method;
culturing HepG2 cells: the method comprises cell resuscitating and cell passaging, wherein the completely cultured cells are resuscitated by a complete culture medium, and then subculture is carried out; the complete medium is alpha-MEM+10% FBS without exosomes removed;
step three, collecting HepG2 cell exosomes: taking cell supernatant, adopting ultracentrifugation to separate exosomes, discarding the supernatant, and re-suspending the precipitate with PBS, so that the exosomes exist in the re-suspension;
step four, NK cell separation and culture:
(1) Centrifuging fresh blood at 2900r/min for 10min, sucking the upper layer pale yellow blood plasma and a 50ml centrifuge tube, carrying out water bath at 40 ℃ for 30min, centrifuging at 1500r/min for 10min to remove sediment, transferring the upper layer blood plasma to a new 50ml centrifuge tube, and placing the new 50ml centrifuge tube in a refrigerator at 4 ℃ for standby;
(2) On day 0, initial culture: initial culture volume was 20ml, cell seeding density 1×10 6 Per ml, the culture fluid is: GT-561;
(3) Supplementing liquid: the number of cells increases on day 1, the culture solution turns yellow, and 10ml GT-561 is added; if the cell density is not obviously increased, postponing until the 2 nd day fluid replacement;
(4) On day 3, the culture broth obtained in step (3) was centrifuged at 300 Xg for 8min, the supernatant was discarded, the pellet was suspended with fresh GT-561, and the cell density was adjusted to 1X 10 6 Culturing in incubator;
(5) Observing cells on the 4 th day, and if the cell state is good and the culture solution does not have obvious yellowing, not performing treatment; if the cell density is significantly increased, GT-561 is added to make the cell density 1×10 6 /ml;
(6) Day 5, if day 4Untreated, good cell state, high density, yellowing culture solution, and adding GT-561 to give cell density of 1×10 6 /ml;
(7) Transfer culture bag: counting on days 6-7, adding 5 feeder cells (1 ml) when the number of the cells is greater than 100M, and adding feeder cells when the number of the cells is 30-60 million, and adding the feeder cells until the 8 th day; GT-561 was added to give a total cell concentration of 1.0X10 6 /ml; transferring to T175 culture when the culture solution volume is larger than 100ml or the cell number is larger than 100M, gradually transferring to a cell culture bag for culture when the culture volume is increased;
(8) GT-561 was added to give a cell concentration of 1.0X10 when observed daily on days 8-11 6 /ml;
(9) GT-561 was added to give a cell concentration of 2.0X10 when observed daily on days 12-14 6 /ml;
(10) Harvesting the cells at 14-15 days;
step five, collecting and identifying NKG2D positive exosomes: coating an adsorption column with an anti-NKG2D biotin-labeled antibody to obtain an anti-NKG2D antibody-loaded adsorption column, collecting NKG2D positive exosomes by adopting the anti-NKG2D antibody-loaded adsorption column, and obtaining the NKG2D positive exosomes after identification is correct.
As a further optimization of the preparation method, in the first step, the immune adsorption column is filled with exosome adsorption material, the adsorption material is loaded with a polyclonal antibody with the specificity of CD9/CD963/CD81, and the antibody is attached to the surface of porous silica gel microspheres or high molecular porous microspheres. Further, the removal of the fetal bovine serum exosomes comprises the following steps:
(1) Subjecting FBS to high-speed centrifugation at 10000 Xg at 4deg.C for 30min, and collecting supernatant;
(2) Ultracentrifugation of the supernatant at 120000Xg, 4deg.C for 90min, and collecting the supernatant;
(3) The supernatant of the isolated FBS was filtered using a porous silica gel microsphere immunoadsorption column coated with a polyclonal antibody specific for CD9/CD963/CD 81.
As a further optimization of the above preparation method, in step five, the collection of NKG2D positive exosomes comprises the following steps:
(1) Taking cell supernatant, adding the cell supernatant into a 250ml sterile centrifuge tube, and centrifuging at 300 Xg and 4 ℃ for 10min;
pouring the supernatant into a new 250ml centrifugal bottle, putting into a floor-type centrifugal machine, and centrifuging at 4 ℃ for 30min at 2000 Xg;
(3) Connecting a suction filter with a suction filter pump with a diameter of 0.45 μm, and suction-filtering the centrifuged supernatant to obtain a suction filtrate;
(4) Transferring the filtrate into a 50ml centrifuge tube, centrifuging at 10000 Xg and 4 ℃ for 30min;
(5) Coating an adsorption column with an anti-NKG2D biotin-labeled antibody;
(6) Washing the adsorption column with PBS buffer containing 5% ABS;
(7) Eluting exosomes from the adsorption column with eluent, and centrifuging at 110000Xg and 4deg.C for 90min; resuspended in PBS.
NKG2D positive exosomes prepared by the above preparation method.
A preparation comprising the above NKG2D positive exosomes. Preferably, the preparation is an NK cell culture nourishing activator prepared by taking exosomes or genetically engineered exosomes as carriers.
Use of the NKG2D positive exosomes described above for the manufacture of a medicament for the treatment of a disease, including cancer, diabetes, arthritis or hypertension. Further, the disease is liver cancer.
The beneficial effects are that: (1) Compared with the conventional method for extracting the NK cell exosomes at present, the NK cell exosomes have more pertinence in application effector aspect. The exosome stimulation of liver cancer cell line (exosome contains some special surface marks and plasma membrane contains several special nucleic acids and protein components) can make NK cell produce special correspondence to release exosome with specific function so as to implement inhibition effect.
(2) Research shows that liver cancer cells can express MICA and MICB molecules, which are important ligands of NKG 2D; increasing NKG2D screening performance of NK cell exosomes can improve targeting binding of exosomes to liver cancer cells, thereby improving therapeutic effect.
Drawings
FIG. 1 is a flow chart of exosome preparation according to the present invention;
FIG. 2 is a diagram of NKG 2D-positive exosome immunochromatography process;
FIG. 3 is a graph showing the results of electron microscopy of NK exosomes;
FIG. 4 is a graph showing the detection result of CD314 surface marker of NK exosomes;
FIG. 5 is a graph showing cytotoxicity of NK exosomes against hepatoma cells HepG2 cells.
Detailed Description
The invention provides a therapeutic or inhibitory exosome preparation of liver cancer cells, which can reduce or inhibit the progress of liver cancer. The invention adopts exosomes derived from liver cancer cell lines to carry out specific treatment on umbilical cord blood NK cells/adult NK cells in a culture period, and collects exosomes containing specific NKG2G markers to inhibit proliferation of liver cancer cells. According to the invention, by utilizing the characteristic of innovative tumor source exosomes on NK cell culture, activated NK cell NKG2GD positive exosomes are extracted in a large scale, so that the aim of treating liver cancer is fulfilled.
Nkg2d positive exosomes:
(1) The source is as follows: NK cells, NK92 cell lines and other cell lines capable of producing NKG2D or genetically engineered cell lines or cell lines capable of targeting NKG 2D.
(2) NKG2D expression positive exosomes: inhibit chimeric application of the following sequences or partial sequences of NKG2D in exosomes; chimeric applications of the following sequences or the following partial sequences of NKG2D in exosomes are prohibited and the application of the scope of the present patent is distinguished by the inclusion of other components.
mgwrgrrsrhswmshnyndkksdstrwkrcvvkskcrnasccavamgrmvawsavnsnvtsycgcknwcyknncydsknwysascmsnaskvyskddkvksyhwmgvhtngswwdgssntmkgdcayasskgyncstntycmrtv
(3) The application of the exosomes positive to the NKG2D expression in the treatment of diseases comprises the application of the exosomes which take the NKG2D as a main component or an auxiliary component, such as cancers, diabetes, arthritis, hypertension and the like in the diseases.
Sorting technique of nkg2d positive exosomes:
(1) An adsorption column loaded with an anit-NKG2D antibody is protected.
(2) Sorting technology step of protecting NKG2D positive exosome.
Sorting identification of NKG 2D-positive exosomes
(1) Protecting an immunomagnetic bead loaded with CD 63.
(2) And (3) an immunomagnetic bead separation technology step for protecting NKG2D positive exosomes.
Exosome stimulation of NK cells
(1) Protecting the application of HepG2 cell-derived exosomes in NK cell culture.
(2) All commercial applications of NK cells following stimulation of exosomes derived from HepG2 cells were protected.
(3) All commercial applications of NK cell culture supernatants following stimulation of HepG2 cell-derived exosomes were protected.
(4) All commercial applications of protecting all extracellular vesicles in NK cell culture supernatants after stimulation of HepG2 cell-derived exosomes.
(5) Protecting any NK cell culture nourishing activator prepared by taking exosomes or genetically engineered exosomes as carriers.
The technical scheme of the invention will be clearly and completely described below with reference to the embodiments of the invention and the accompanying drawings.
Example 1
A preparation for specifically inducing exosome for treating liver cancer is shown in figure 1.
1. Removal of bovine serum exosomes
The purpose of the process is as follows: reducing the content of exosomes in the treated serum so as to reduce the influence of exosomes in the animal serum on NK cells. At present, the method for removing the exosomes in the serum mainly adopts an ultracentrifugation method, an immunomagnetic bead method and the like, the ultracentrifugation method needs to be operated continuously for a plurality of times, and the ultracentrifugation method needs to be kept stand for a long time, but part of exosomes still remain in the obtained serum. The immunomagnetic beads method has high cost, can only treat a small amount of serum in one operation, and can only remove part of exosomes in the serum. When the serum is treated by the existing method, more exosomes still exist in the treated serum, and the research on downstream cell exosomes still can be influenced to a certain extent, so that there is room for improvement. The method adopts a method of combining ultracentrifugation with an immunoadsorption column to achieve the efficient removal effect.
1. High-speed centrifugation is carried out on FBS for 10000 Xg, 4 ℃ and 30min; the supernatant was collected under sterile conditions.
2. Ultracentrifugation of the supernatant at 120000 Xg, 4℃for 90min; the supernatant was collected under sterile conditions.
3. The supernatant of the isolated FBS was filtered using a porous silica gel microsphere adsorption column coated with a polyclonal antibody specific for CD9/CD963/CD 81.
The technology provides an exosome adsorption column, wherein exosome adsorption materials are filled in the exosome adsorption column, and the adsorption materials are loaded with CD9/CD963/CD81 specific polyclonal antibodies; a molecular marker capable of specifically recognizing transmembrane protein CD9/CD963/CD81 on the surface of exosomes; the antibodies in the three are attached to the surfaces of the full-porous silica gel microspheres or the high-molecular porous microspheres, and can be specifically adsorbed when the supernatant containing the exosomes passes through the packed column. The porous structure of the full porous silica gel microsphere has adsorption property, and the larger specific surface area enables the full porous silica gel microsphere to load more exosomes, so that serum and exosomes can be separated more efficiently. The three antibodies are adopted, so that the screening leakage phenomenon caused by the heterogeneity of exosomes can be prevented.
2. Culture of HepG2 cells
1. Cell resuscitation
1) Preparing a complete culture medium: alpha-mem+10% FBS (no exosomes removed);
2) Cell resuscitation: taking 9ml of complete culture based on a 15ml centrifuge tube, rapidly taking out frozen cells from liquid nitrogen, placing the frozen cells into a 37 ℃ metal bath, shaking to rapidly defrost the frozen cells, then transferring the thawed cells into an ultra-clean workbench, adding the thawed cells into the 15ml centrifuge tube, and centrifuging at 300 Xg for 5min;
3) The supernatant was discarded to give a cell pellet, and the cells were gently resuspended in 2ml of complete mediumAdding into T25 culture flask, marking, adding 37deg.C and 5% CO 2 Culturing in a saturated moderate incubator);
4) After 24h, the cell attachment was observed, the old medium was aspirated off, and fresh pre-warmed complete medium was added to continue the culture.
2. Cell passage
1) When the cells grow to 80-90% fusion degree, sucking old culture medium, washing once with PBS to remove residual culture medium and serum, adding 0.125% pancreatin, digesting in a 37 ℃ incubator, taking out the cells, and observing the cells under the mirror until the cells shrink and become round;
2) Adding a culture medium containing FBS, gently beating to enable cells to fall off to form single cell suspension, collecting cells in a 15ml sterile centrifuge tube, centrifuging at 1000rpm for 5min;
3) Cell pellet was collected, resuspended in complete medium, and finally inoculated into 5-10 fine layers of cell factory for continued culture using alpha-mem+10% FBS (no exosomes removed).
3. Collection of HepG2 cell exosomes
Centrifugal forces generated by ultracentrifugation, up to 1,000,000×g, are the best process for separating small particles including bacteria, viruses and organelles. Ultracentrifugation is therefore easily converted into isolation of exosomes and contributes to many open exosome searches.
1. Taking cell supernatant, adding into a 250ml sterile centrifuge tube, and centrifuging at 300 Xg and 4 ℃ for 10min;
2. pouring the supernatant into a new 250ml centrifugal bottle, putting into a floor type centrifugal machine, and centrifuging at 4 ℃ for 30min at 2000 Xg;
3. the centrifuged supernatant was filtered by a 0.45 μm filter pump connected to a filter pump.
4. The above filtrate was transferred to 10000 Xg in 50ml centrifuge tube and centrifuged at 4℃for 30min.
5. Transferring the liquid into a 38ml super-separation tube, balancing, and centrifuging at 110000 Xg and 4 ℃ for 90min;
6. discarding the supernatant, re-suspending the sediment with 200 μl PBS, repeatedly blowing the bottom of the super-release tube with a gun head, taking care to avoid too much foam, and allowing exosomes to exist in the re-suspension;
4. isolation and culture of NK cells
1. Fresh blood is centrifuged at 2900r/min for 10min, the upper pale yellow blood plasma and a 50ml centrifuge tube are sucked, water bath is carried out at 40 ℃ for 30min, sediment is removed after centrifugation at 1500r/min for 10min, the upper blood plasma is transferred to a new 50ml centrifuge tube, and the fresh blood plasma is placed in a refrigerator at 4 ℃ for storage (if sediment is separated out after the fresh blood plasma is placed in the refrigerator for two days, the fresh blood plasma is centrifuged again).
2. On day 0, initial culture (T75 square bottle): initial culture volume was 20ml, cell seeding density 1×10 6 /ml (initial procedure may be appropriate to increase cell seeding density). The culture solution is as follows: GT-561 (containing lymphocyte activating factor).
3. In general, the number of cells increases on day 1, the cell density increases significantly or the phenomenon of agglomeration occurs, and the culture solution turns yellow, and 10ml of GT-561 (containing lymphocyte activator) can be added. If the increase in cell density is not significant, the fluid replacement can be delayed until day 2.
4. On day 3, the culture broth obtained in the above step was centrifuged at 300g for 8min, the supernatant was discarded, and the supernatant was precipitated by suspension with fresh GT-561 (containing lymphocyte activator) and the cell density was adjusted to 1X 10 6 /ml (initial procedure may suitably increase cell density), in culture in an incubator.
5. On day 4, cells were observed, if the cell status was good, the culture medium was not significantly yellowing, and if the cell density was significantly increased, GT-561 (containing lymphocyte activator) was added as appropriate to give a cell density of 1×10 6 /ml (initial procedure may suitably increase cell density).
6. On day 5, if the cells are not treated on day 4 and the cell state is good and the density is high, GT-561 (containing lymphocyte activator) may be added as appropriate to give a cell density of 1×10 6 /ml (initial procedure may suitably increase cell density).
7. Transfer culture bag: counting on day 6-7, and adding 5 feeder cells (note centrifuging to remove lyophilized solution) with cell number greater than 100M, such as 3-6X10 6 Then the nourishment fine is added until the 8 th dayAnd (5) cells. GT-561 (containing lymphocyte activator) was added to give a total cell concentration of 1.0X10 6 /ml. The culture solution with the volume of more than 100ml or the cell number of more than 100M can be transferred to T175 for culture, and then gradually transferred to a cell culture bag for culture along with the increase of the culture volume.
8. On day 8-11, the GT-561 (containing lymphocyte activator) can be estimated empirically to give a cell concentration of 1.0X10 when the operator is skilled 6 About/ml. If the method is used for the first time, the culture medium is preferably added by counting so that the cell concentration is 1.0X10 6 /ml。
9. Day-to-day observations on days 12-14, GT-561 (containing lymphocyte activator) can be estimated empirically to give a cell concentration of 2.0X10 if the operator is skilled 6 About/ml. If the method is used for the first time, the culture medium is preferably added by counting so that the cell concentration is 2.0X10 6 /ml。
10. Cells are typically harvested at 14-15 days, when they are in the log phase, and the cell state is best, and slowly slides down further.
5. Collection of NKG2D positive exosomes.
1. Taking cell supernatant, adding into a 250ml sterile centrifuge tube, and centrifuging at 300 Xg and 4 ℃ for 10min;
2. pouring the supernatant into a new 250ml centrifugal bottle, putting into a floor type centrifugal machine, and centrifuging at 4 ℃ for 30min at 2000 Xg;
3. the centrifuged supernatant was filtered by a 0.45 μm filter pump connected to a filter pump.
4. The above filtrate was transferred to 10000 Xg in 50ml centrifuge tube and centrifuged at 4℃for 30min.
5. The adsorption column was coated with anti-NKG2D biotin-labeled antibody.
6. The column was washed once with 5% abs in PBS buffer.
7. Eluting exosomes from the adsorption column with eluent, and centrifuging at 110000×g, 4deg.C for 90min; resuspended in PBS.
A diagram of the NKG 2D-positive exosome immunochromatography procedure is shown in FIG. 2.
6. Morphological identification of exosomes
(1) Morphological identification of exosomes
Electron microscope detection results: taking out 10 mu L of exosomes; 10 mu L of the sample is sucked and dripped on a copper net to be deposited for 1 min, and floating liquid is sucked by filter paper; dripping 10 mu L of uranyl acetate on a copper net to precipitate for 1 min, and sucking floating liquid by filter paper; drying for several minutes at normal temperature; 100 kv was subjected to electron microscopy imaging. The results are shown in FIG. 3.
From the figure, it can be seen that Nk exosomes present a disk-like or cup-like structure, with a diameter around 100nm, with typical resulting features and dimensions of the exosomes.
Detection of surface markers: the exosomes were labeled with Beads-anti-CD63 and APC-anti-CD314 (NKG 2D) and were subjected to flow detection. The results are shown in FIG. 4. From the detection results, the selected exosomes are enriched with the specific marker NKG2D surface molecules.
7. Functional identification of exosomes
Cytotoxic effects of exosomes on hepatoma cells HepG2 cells: the mitochondrial membrane potential of tumor cells (HepG 2) was detected with JC-1 probe. Cells were seeded in 6-well plates (1X 10 per well) 5 Cells), with NK-Exo (40 g/ml), control (40 g/ml), incubation for 24h, respectively. Cells were then loaded with JC-1 (1 mg/L) at 37℃for 20min. After washing with cold PBS, the fluorescence intensities of each group were analyzed with a fluorescence confocal laser microscope. The results are shown in FIG. 5.
JC-1 staining results show that the mitochondrial membrane potential of tumor cells is obviously increased after NK-Exo treatment, which indicates that the sorted NK exosomes have obvious killing effect on liver cancer cells.
It should be noted that the above-mentioned embodiments are to be understood as illustrative, and not limiting, the scope of the invention, which is defined by the appended claims. It will be apparent to those skilled in the art that various modifications and adaptations can be made to the present invention without departing from its spirit or scope.
Claims (8)
1. A method for preparing an NKG2D positive exosome, characterized by: the method comprises the following steps:
step one, removing the exosomes of the fetal bovine serum: removing exosomes in the fetal calf serum by adopting an ultracentrifugation combined immunoadsorption column method;
culturing HepG2 cells: the method comprises cell resuscitating and cell passaging, wherein the completely cultured cells are resuscitated by a complete culture medium, and then subculture is carried out; the complete medium is alpha-MEM+10% FBS without exosomes removed;
step three, collecting HepG2 cell exosomes: taking cell supernatant, adopting ultracentrifugation to separate exosomes, discarding the supernatant, and re-suspending the precipitate with PBS, so that the exosomes exist in the re-suspension;
step four, NK cell separation and culture:
(1) Centrifuging fresh blood at 2900r/min for 10min, sucking the upper layer pale yellow blood plasma and a 50ml centrifuge tube, carrying out water bath at 40 ℃ for 30min, centrifuging at 1500r/min for 10min to remove sediment, transferring the upper layer blood plasma to a new 50ml centrifuge tube, and placing the new 50ml centrifuge tube in a refrigerator at 4 ℃ for standby;
(2) On day 0, initial culture: initial culture volume was 20ml, cell seeding density 1×10 6 Per ml, the culture fluid is: GT-561;
(3) Supplementing liquid: the number of cells increases on day 1, the culture solution turns yellow, and 10ml GT-561 is added; if the cell density is not obviously increased, postponing until the 2 nd day fluid replacement;
(4) On day 3, the culture broth obtained in step (3) was centrifuged at 300 Xg for 8min, the supernatant was discarded, the pellet was suspended with fresh GT-561, and the cell density was adjusted to 1X 10 6 Culturing in incubator;
(5) Observing cells on the 4 th day, and if the cell state is good and the culture solution does not have obvious yellowing, not performing treatment; if the cell density is significantly increased, GT-561 is added to make the cell density 1×10 6 /ml;
(6) On day 5, if the cells are not treated on day 4 and the cell state is good, the density is high, the culture solution turns yellow, and GT-561 is added to make the cell density 1×10 6 /ml;
(7) Transfer culture bag: count on day 6-7, cell numberIf the amount is more than 100M, adding 5 1ml of trophoblasts, if the number of the trophoblasts is 30-60 million, adding the trophoblasts until the 8 th day; GT-561 was added to give a total cell concentration of 1.0X10 6 /ml; transferring to T175 culture when the culture solution volume is larger than 100ml or the cell number is larger than 100M, gradually transferring to a cell culture bag for culture when the culture volume is increased;
(8) GT-561 was added to give a cell concentration of 1.0X10 when observed daily on days 8-11 6 /ml;
(9) GT-561 was added to give a cell concentration of 2.0X10 when observed daily on days 12-14 6 /ml;
(10) Harvesting the cells at 14-15 days;
step five, collecting and identifying NKG2D positive exosomes: coating an adsorption column with an anti-NKG2D biotin-labeled antibody to obtain an anti-NKG2D antibody-loaded adsorption column, collecting NKG2D positive exosomes by adopting the anti-NKG2D antibody-loaded adsorption column, and obtaining the NKG2D positive exosomes after identification is correct.
2. The method of manufacturing according to claim 1, characterized in that: in the first step, the immune adsorption column is filled with exosome adsorption material, the adsorption material is loaded with CD9/CD963/CD81 specific polyclonal antibody, and the antibody is attached to the surface of porous silica gel microsphere or high molecular porous microsphere.
3. The preparation method according to claim 2, characterized in that: the removal of the exosomes of the fetal bovine serum comprises the following steps:
(1) Subjecting FBS to high-speed centrifugation at 10000 Xg at 4deg.C for 30min, and collecting supernatant;
(2) Ultracentrifugation of the supernatant at 120000Xg, 4deg.C for 90min, and collecting the supernatant;
(3) The supernatant of the isolated FBS was filtered using a porous silica gel microsphere immunoadsorption column coated with a polyclonal antibody specific for CD9/CD963/CD 81.
4. The method of manufacturing according to claim 1, characterized in that: in the fifth step, the collection of NKG2D positive exosomes comprises the following steps:
(1) Taking cell supernatant, adding the cell supernatant into a 250ml sterile centrifuge tube, and centrifuging at 300 Xg and 4 ℃ for 10min;
(2) Pouring the supernatant into a new 250ml centrifugal bottle, putting into a floor-type centrifugal machine, and centrifuging at 4 ℃ for 30min at 2000 Xg;
(3) Connecting a suction filter with a suction filter pump with a diameter of 0.45 μm, and suction-filtering the centrifuged supernatant to obtain a suction filtrate;
(4) Transferring the filtrate into a 50ml centrifuge tube, centrifuging at 10000 Xg and 4 ℃ for 30min;
(5) Coating an adsorption column with an anti-NKG2D biotin-labeled antibody;
(6) Washing the adsorption column with PBS buffer containing 5% ABS;
eluting exosomes from the adsorption column with eluent, and centrifuging at 110000Xg and 4deg.C for 90min; resuspended in PBS.
5. NKG2D positive exosomes prepared according to the method of any one of claims 1-4.
6. A formulation comprising the NKG2D positive exosomes of claim 5.
7. Use of the NKG2D positive exosome according to claim 5 or the formulation according to claim 6 for the manufacture of a medicament for the treatment of a disease comprising cancer, diabetes, arthritis or hypertension.
8. The use according to claim 7, characterized in that: the disease is liver cancer.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310177680.3A CN116426473A (en) | 2023-02-28 | 2023-02-28 | NKG2D positive exosome, preparation method and application |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310177680.3A CN116426473A (en) | 2023-02-28 | 2023-02-28 | NKG2D positive exosome, preparation method and application |
Publications (1)
Publication Number | Publication Date |
---|---|
CN116426473A true CN116426473A (en) | 2023-07-14 |
Family
ID=87082168
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202310177680.3A Pending CN116426473A (en) | 2023-02-28 | 2023-02-28 | NKG2D positive exosome, preparation method and application |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN116426473A (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN116904397A (en) * | 2023-09-04 | 2023-10-20 | 山东德升细胞治疗工程技术有限公司 | Preparation and application of extracellular vesicles of NK cells |
-
2023
- 2023-02-28 CN CN202310177680.3A patent/CN116426473A/en active Pending
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN116904397A (en) * | 2023-09-04 | 2023-10-20 | 山东德升细胞治疗工程技术有限公司 | Preparation and application of extracellular vesicles of NK cells |
CN116904397B (en) * | 2023-09-04 | 2023-12-26 | 山东德升细胞治疗工程技术有限公司 | Preparation and application of extracellular vesicles of NK cells |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9844508B2 (en) | Tumor vaccine and method for producing the same | |
JP5986196B2 (en) | Means and methods for active cell carcinoma immunotherapy using tumor cells and dendritic cells killed by high hydrostatic pressure | |
CA2942557C (en) | Methods for isolating and proliferating autologous cancer antigen-specific cd8+ t cells | |
CN108379569B (en) | DC vaccine for efficiently loading tumor antigen and method for inducing and amplifying tumor antigen specific CTL (cytotoxic T lymphocyte) | |
KR20180012848A (en) | Apparatus and method for obtaining immunostimulatory antigen-presenting cells | |
JP6235085B2 (en) | Means and methods for active cell carcinoma immunotherapy using tumor cells and dendritic cells killed by high hydrostatic pressure | |
US9962433B2 (en) | Method for preparing an immunogenic lysate, the lysate obtained, dendritic cells loaded with such lysate and a pharmaceutical composition comprising the lysate or the dendritic cells | |
CN116426473A (en) | NKG2D positive exosome, preparation method and application | |
CN115521913B (en) | NK cells and CD20, CD38 and Her2 antibodies combined application | |
CN112426526B (en) | Preparation method of NK (natural killer) cells and application of NK cells in treatment of cancers | |
KR20140035102A (en) | A METHOD FOR EXPANDING NK CELLS FROM PERIPHERAL BLOOD BELOW 100ml | |
CN105802908B (en) | Method for in vitro preparation of tumor antigen specific CD8+ stem cell-like memory T lymphocytes | |
Han et al. | Biological Character of RetroNectin Activated Cytokine‐Induced Killer Cells | |
WO2017079881A1 (en) | Method for enhancing capacity to kill abnormal cell and pharmaceutical composition | |
CN109957543A (en) | Utilize the method for Cord blood massive amplification Cord Blood Natural Killer Cells: Impact | |
CN112831468A (en) | TCM/TSCM cell for improving TIL cell induction and application | |
BR112015014270B1 (en) | monocyte co-differentiation from allogeneic donors | |
CN110747167B (en) | Preparation method and application of hemizygous BAK cell | |
JP6782503B1 (en) | A method for producing a cell composition for treating cancer, a cell composition for treating cancer produced thereby, and a method for treating cancer using the cell composition for treating cancer. | |
CN115246887A (en) | Activated T cells and their use in the treatment of cancer | |
CN113980901B (en) | Method for preparing high-purity mature human dendritic cells and application | |
CN110656084B (en) | BAK cell and preparation kit and preparation method thereof | |
CN107496912B (en) | Antigen presenting signal group combining hepatitis B virus antigen peptide with liver cancer cell antigen information and application thereof | |
CN107188959B (en) | Antigenic peptide T790M-6 and application thereof in preparation of medicines for treating non-small cell lung cancer | |
CN116904400B (en) | Application of calicheamicin in optimization of in-vitro CAR/TCR-T cell product preparation process |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination |