CN116425857B - Glycosylation-free modified IL-15 and preparation method thereof - Google Patents
Glycosylation-free modified IL-15 and preparation method thereof Download PDFInfo
- Publication number
- CN116425857B CN116425857B CN202310683428.XA CN202310683428A CN116425857B CN 116425857 B CN116425857 B CN 116425857B CN 202310683428 A CN202310683428 A CN 202310683428A CN 116425857 B CN116425857 B CN 116425857B
- Authority
- CN
- China
- Prior art keywords
- cell
- glycosylation
- cells
- modified
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 108090000172 Interleukin-15 Proteins 0.000 title claims abstract description 90
- 102000003812 Interleukin-15 Human genes 0.000 title claims abstract description 89
- 238000002360 preparation method Methods 0.000 title abstract description 8
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 50
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 39
- 230000035772 mutation Effects 0.000 claims abstract description 8
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 17
- 239000013612 plasmid Substances 0.000 claims description 14
- 150000001413 amino acids Chemical class 0.000 claims description 10
- 238000000034 method Methods 0.000 claims description 10
- 239000013604 expression vector Substances 0.000 claims description 8
- 239000012096 transfection reagent Substances 0.000 claims description 8
- 239000002773 nucleotide Substances 0.000 claims description 7
- 125000003729 nucleotide group Chemical group 0.000 claims description 7
- 239000013598 vector Substances 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 1
- 238000004519 manufacturing process Methods 0.000 claims 1
- 210000004027 cell Anatomy 0.000 abstract description 44
- 210000000822 natural killer cell Anatomy 0.000 abstract description 34
- 238000006206 glycosylation reaction Methods 0.000 abstract description 18
- 230000013595 glycosylation Effects 0.000 abstract description 16
- 238000004113 cell culture Methods 0.000 abstract description 11
- 230000014509 gene expression Effects 0.000 abstract description 9
- 230000004048 modification Effects 0.000 abstract description 8
- 238000012986 modification Methods 0.000 abstract description 8
- 230000004071 biological effect Effects 0.000 abstract description 6
- 239000002158 endotoxin Substances 0.000 abstract description 6
- 230000008901 benefit Effects 0.000 abstract description 4
- 241001465754 Metazoa Species 0.000 abstract description 2
- 235000018102 proteins Nutrition 0.000 description 26
- 230000000694 effects Effects 0.000 description 21
- 230000002147 killing effect Effects 0.000 description 8
- 239000002609 medium Substances 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 230000022534 cell killing Effects 0.000 description 6
- 238000001514 detection method Methods 0.000 description 6
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- 238000002835 absorbance Methods 0.000 description 5
- 238000005349 anion exchange Methods 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 238000003786 synthesis reaction Methods 0.000 description 5
- 238000001890 transfection Methods 0.000 description 5
- 230000009471 action Effects 0.000 description 4
- 230000003321 amplification Effects 0.000 description 4
- 238000005342 ion exchange Methods 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 238000003199 nucleic acid amplification method Methods 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 235000001014 amino acid Nutrition 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 239000006143 cell culture medium Substances 0.000 description 3
- 230000010261 cell growth Effects 0.000 description 3
- 230000004663 cell proliferation Effects 0.000 description 3
- 239000006285 cell suspension Substances 0.000 description 3
- 238000012258 culturing Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 238000004255 ion exchange chromatography Methods 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 238000011068 loading method Methods 0.000 description 3
- 210000004698 lymphocyte Anatomy 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 230000009465 prokaryotic expression Effects 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 2
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 2
- 108010077544 Chromatin Proteins 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 2
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 2
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 2
- 102000000588 Interleukin-2 Human genes 0.000 description 2
- 108010002350 Interleukin-2 Proteins 0.000 description 2
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 2
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 2
- 239000012124 Opti-MEM Substances 0.000 description 2
- 102000044159 Ubiquitin Human genes 0.000 description 2
- 108090000848 Ubiquitin Proteins 0.000 description 2
- 230000004518 activated T cell apoptosis Effects 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 230000003833 cell viability Effects 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 210000003483 chromatin Anatomy 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 230000030279 gene silencing Effects 0.000 description 2
- 238000012226 gene silencing method Methods 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 230000001766 physiological effect Effects 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- IZTQOLKUZKXIRV-YRVFCXMDSA-N sincalide Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](N)CC(O)=O)C1=CC=C(OS(O)(=O)=O)C=C1 IZTQOLKUZKXIRV-YRVFCXMDSA-N 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 101001055157 Homo sapiens Interleukin-15 Proteins 0.000 description 1
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- 230000004988 N-glycosylation Effects 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- 108010087230 Sincalide Proteins 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 230000034196 cell chemotaxis Effects 0.000 description 1
- 238000010609 cell counting kit-8 assay Methods 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000003501 co-culture Methods 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 238000000432 density-gradient centrifugation Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 208000009190 disseminated intravascular coagulation Diseases 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 102000056003 human IL15 Human genes 0.000 description 1
- 102000055277 human IL2 Human genes 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000013394 immunophenotyping Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000031700 light absorption Effects 0.000 description 1
- GZQKNULLWNGMCW-PWQABINMSA-N lipid A (E. coli) Chemical group O1[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@@H](NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)[C@@H]1OC[C@@H]1[C@@H](O)[C@H](OC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](NC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O1 GZQKNULLWNGMCW-PWQABINMSA-N 0.000 description 1
- 229920006008 lipopolysaccharide Polymers 0.000 description 1
- 210000003810 lymphokine-activated killer cell Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000004089 microcirculation Effects 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 238000012946 outsourcing Methods 0.000 description 1
- 238000012856 packing Methods 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 238000001814 protein method Methods 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 239000000523 sample Substances 0.000 description 1
- 239000012488 sample solution Substances 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 239000004017 serum-free culture medium Substances 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 230000002476 tumorcidal effect Effects 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5443—IL-15
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/10—Plasmid DNA
- C12N2800/106—Plasmid DNA for vertebrates
- C12N2800/107—Plasmid DNA for vertebrates for mammalian
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Abstract
The invention relates to the technical field of IL-15 preparation, in particular to an IL-15 modified by glycosylation and a preparation method thereof. The glycosylation-free modified IL-15 is characterized in that 3N-glycosylation sites in an IL-15 sequence are mutated, glycosylation modification can not be generated even if 293 cells are used for expression after mutation, the biological activity of the glycosylation-free modified IL-15 is 2-3 times higher than that of glycosylation-modified proteins, and the glycosylation-free modified IL-15 has the advantages of no animal source component, low endotoxin content, high biological activity and the like when being used for NK cell culture.
Description
Technical Field
The invention relates to the technical field of IL-15 preparation, in particular to an IL-15 modified by glycosylation and a preparation method thereof.
Background
IL-15, interleukin-15, is composed of 114 amino acids and is produced by monocytes and macrophages, and it can stimulate and activate B cells, induce NK cell differentiation, and chemotaxis T lymphocytes. Besides, IL-15 can exert a wide variety of roles in various tissues and cells outside the immune system, and it has been demonstrated that IL-15 can promote lymphocyte and NK cell proliferation and enhance its biological activity, and can also transform peripheral blood and spleen lymphocytes into LAK cells with high tumoricidal effect in vitro. IL-15 functions similarly to IL-2 but IL-2 causes T cells to excessively differentiate, forming aged T cells that have a weak killing capacity, and may induce activated T cell apoptosis, whereas IL-15 has an advantage in immune cell therapy in that it does not cause activated T cell apoptosis, and therefore IL-15 is often an important component in immune cell culture media. It has been reported that IL-15 itself has 3 glycosylation sites, and the physiological activity after glycosylation modification is lower than that of non-glycosylation modified IL-15 expressed by prokaryotes, but the prokaryotic expressed IL-15 has the following problems: endotoxin is lipopolysaccharide in cell wall of gram negative bacteria, and its toxic component is lipid A, which can cause fever, microcirculation disturbance, endotoxin shock and disseminated intravascular coagulation. The introduction of endotoxin is difficult to avoid when using prokaryotic cell expression purification. Accordingly, those skilled in the art have been working on a purification method for expression of non-glycosylation modified IL-15, which can obtain IL-15 expression with high purity, high activity, low endotoxin and meeting the requirements of GMP standards and clinical use standards.
Disclosure of Invention
Aiming at the problems and the defects existing in the prior art, the invention aims to provide the glycosylation-free modified IL-15 and the preparation method thereof, which can ensure high activity rate when being used for NK cell culture, can enable NK cells to be rapidly activated and greatly amplified, and is easier to ensure the quality and the bioactivity compared with prokaryotic expression IL-15, thereby being beneficial to controlling the quality of cell medicines.
In order to solve the technical problems, the invention provides the following technical scheme:
an aglycosylation-free modified IL-15, the amino acid mutation site of said IL-15 being N119D, N D and N160D, the signal peptide of said IL-15 being altered to an IgG heavy chain signal peptide.
Preferably, the amino acid sequence of IL-15 is shown in SEQ ID NO: 4.
Nucleotide sequences encoding the above IL-15.
Preferably, a Kozak sequence is added to the front end.
Preferably, the nucleotide sequence of IL-15 is shown in SEQ ID NO: shown at 5.
The preparation method of the IL-15 uses a transfection reagent PEI to transfect a target protein plasmid capable of expressing the IL-15 into 293 cells.
Preferably, the carrier used by the target protein plasmid is UCOE ® An expression vector.
Preferably, the final concentration of the target protein plasmid is 1.0. Mu.g/mL and the final concentration of the transfection reagent PEI is 3. Mu.g/mL.
Compared with the prior art, the invention has the following beneficial effects: the glycosylation-free modified IL-15 is characterized in that 3N-glycosylation sites in an IL-15 sequence are mutated, glycosylation modification can not be generated even if 293 cells are used for expression after mutation, the biological activity of the glycosylation-free modified IL-15 is 2-3 times higher than that of glycosylation-modified proteins, and the glycosylation-free modified IL-15 has the advantages of no animal-derived components, low endotoxin content, high biological activity and the like when being used for NK cell culture.
The non-glycosylation modified IL-15 has obvious promotion effect on the purity, amplification efficiency and killing potential of NK cells, can reduce the residual risk of host residual protein/nucleic acid possibly existing in prokaryotic expression by using human 293 cell expression, and adopts UCOE ® The expression vector can obtain continuous, stable and high-level expression of the target gene, makes the following mutations N119D, N D and N160D on the natural sequence of IL-15, and converts the original signal peptide (1-48) of the protein into the heavy chain signal peptide of the IgG antibody, thereby improving the secretion efficiency of the protein.
The action mechanism of the invention is as follows: such risks can be reduced by using prokaryotic expression where there may be residues of host residual protein/nucleic acid and 293 cell expression of human origin.
The potential 3 glycosylation site residues of IL-15 were mutated to render them incapable of glycosylation modification. Then, gene synthesis is carried out according to the designed sequence, and the gene synthesis is constructed to UCOE ® The expression vector contains a ubiquitin-like opening element, and the gene can effectively prevent gene silencing, and the target gene can be continuously and stably expressed at a high level no matter where the gene is integrated into chromatin.
The natural sequence of IL-15 is mutated into N119D, N D and N160D as follows, and the original signal peptide (1-48) of the protein is converted into the heavy chain signal peptide of the IgG antibody, so that the secretion efficiency of the protein can be improved.
The plasmid was transfected into 293 cells using PEI transfection, IL-15 in the supernatant was collected after cultivation and purified using ion exchange chromatography, after which the final protein purity was checked by SDS-PAGE and its effect on its viability and activity when used in NK cell culture was examined. Compared with commercial IL-15, the glycosylation-free modified IL-15 has obvious promotion effect on the purity, amplification efficiency and killing potential of NK cells.
Drawings
The accompanying drawings are included to provide a further understanding of the invention and are incorporated in and constitute a part of this specification, illustrate the invention and together with the embodiments of the invention, serve to explain the invention. In the drawings:
FIG. 1 is a diagram showing the result of SDS-PAGE of the protein according to example 1 of the present invention;
FIG. 2 is a chart showing the gray scale analysis of SDS-PAGE detection protein according to example 1 of the present invention;
FIG. 3 is a graph of total cells obtained from IL-15 of example 2 of the present invention;
FIG. 4 is a bar graph of the proportion of NK cells harvested by D14 in example 2 of the present invention;
FIG. 5 is a graph showing NK cell killing activity of example 2 of the present invention;
FIG. 6 is a graph of total cells obtained from IL-15 of example 3 of the invention;
FIG. 7 is a bar graph of the proportion of NK cells harvested by D14 in example 3 of the present invention;
FIG. 8 is a graph showing NK cell killing activity of example 3 of the present invention;
FIG. 9 is a graph of total cells obtained from IL-15 of example 4 of the present invention;
FIG. 10 is a bar graph of the proportion of NK cells harvested by D14 in example 4 of the present invention;
FIG. 11 is a graph showing NK cell killing activity of example 4 of the present invention;
FIG. 12 is an SDS-PAGE gel of the detection protein according to example 1 of the present invention.
Detailed Description
The following description of the embodiments of the present invention will be made clearly and completely with reference to the accompanying drawings, in which it is apparent that the embodiments described are only some embodiments of the present invention, but not all embodiments. All other embodiments, which can be made by those skilled in the art based on the embodiments of the invention without making any inventive effort, are intended to be within the scope of the invention.
And (3) a step of: experimental materials:
Opti-MEM Medium (Thermofiser Siemens, cat. No. A4124802), HEK 293 cells (Thermofiser Siemens, cat. No. A14527), transfection reagent PEI (Sigma, cat. No. 919012), UCOE ® Expression vector (Merck Merck, cat. No. 5048670001), anion exchange packing (Cytiva Situo, cat. No. 17531610), IL-15 gene synthesis, vector construction and plasmid extraction services were performed by Nanjin Kirschner Biotechnology, monoclonal CD16 antibody (Biolegend Barceix, cat. No. 302002), CD3 antibody (Biolegend Barceix, cat. No. 300439), CD56 antibody (Biolegend Barceix, cat. No. 362508), K562 cell line (ATCC (American type culture collection library), cat. No. CCL-243), RPMI-1640 medium (Prime, cat. No. PM 150110), CCK-8 reagent (MedChemexpress (Shanghai Hao's) and cat. No. HY-K0301), SCGM NK cell medium (CellGenix (Sadolis), cat. No. 20802-0500), well KBM581 lymphocyte serum-free medium (Corning (kaning) No. 88-243), CD-5-K-5, CD-15G-15 (GmbH-35), and CD-15-35 (GmbH-15).
And II: the experimental method comprises the following steps:
(1) Design of non-glycosylation modified IL-15 amino acid sequence and construction of expression vector:
the potential 3 glycosylation site residues of IL-15 were mutated to render them incapable of glycosylation modification. Then, gene synthesis is carried out according to the designed sequence, and the gene synthesis is constructed to UCOE ® The expression vector contains a ubiquitin-like opening element, and the gene can effectively prevent gene silencing, and the target gene can be continuously and stably expressed at a high level no matter where the gene is integrated into chromatin.
The natural sequence of IL-15 was mutated N119D, N D and N160D as follows, and the original signal peptide of the protein (amino acids 1-48 of the natural sequence of IL-15) was converted into the heavy chain signal peptide of the IgG antibody to increase the secretion efficiency of the protein.
IL-15 natural amino acid sequence is shown as SEQ ID NO:1 is shown as follows:
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS；
the amino acid sequence of IL-15 after mutation is shown as SEQ ID NO:2 is shown as follows:
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILADNSLSSNGNVTESGCKECEELEEKDIKEFLQSFVHIVQMFIDTS；
the amino acid sequence of the heavy chain signal peptide of the IgG antibody is shown as SEQ ID NO:3, shown in the following:
MEWSWVFLFFLSVTTGVHS；
the amino acid sequence of the IL-15 mutation of the original signal peptide of the protein converted into the heavy chain signal peptide of the IgG antibody is shown as SEQ ID NO:4, as follows:
MEWSWVFLFFLSVTTGVHSNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILADNSLSSNGNVTESGCKECEELEEKDIKEFLQSFVHIVQMFIDTS；
the nucleotide sequence of the Kozak+IgG heavy chain signal peptide+IL-15 after mutation is shown in SEQ ID NO:5, as follows: 5'-gccaccatggaatggagctgggtgttcctgttctttctgtccgtgaccacaggcgtgcattctaactgggtgaatgtaataagtgatttgaaaaaaattgaagatcttattcaatctatgcatattgatgctactttatatacggaaagtgatgttcaccccagttgcaaagtaacagcaatgaagtgctttctcttggagttacaagttatttcacttgagtccggagatgcaagtattcatgatacagtagaaaatctgatcatcctagcagataacagtttgtcttctaatgggaatgtaacagaatctggatgcaaagaatgtgaggaactggaggaaaaagatattaaagaatttttgcagagttttgtacatattgtccaaatgttcatcgatacttcttga-3', wherein the 1 st to 6 th nucleotide sequence is a Kozak sequence and the 7 th to 63 th nucleotide sequence is an IgG heavy chain signal peptide nucleotide sequence.
(2) HEK 293 cell subculture: suspension of HEK 293 cells at 0.6X10 6 The density of each living cell/mL is inoculated in a 125mL shaking flask, the culture system is 30 mL HEK 293 cell culture medium, and the incubator is set at 37 ℃ and 8% CO 2 The rotation speed was 95rpm (50 mm diameter-varying bed) or 125rpm (19 mm diameter-varying bed), and samples were taken every 72 hours, counted and passaged.
(3) Transient protein method: transfecting HEK 293 cells which are passaged for 3 times and have the activity rate of more than 90%, and adjusting the cell density to 2 multiplied by 10 before transfection 6 Each living cell/mL. Transfection testThe PEI agent is dissolved by injection water, the concentration is 1mg/mL, the PEI agent is used after being sterilized and filtered by a 0.22 mu M membrane, and the plasmid solution with known concentration is obtained by amplifying and purifying by outsourcing service after the target protein plasmid is obtained. And respectively adding target protein plasmid and transfection reagent PEI into 1200 mu L of Opti-MEM culture medium or sterile PBS for dilution, standing for 5 minutes at room temperature after mixing, slowly adding transfection reagent PEI diluent into the dilution containing target protein plasmid, mixing, incubating for 10-20 minutes at room temperature, adding the mixture of the two into suspension HEK 293 cell culture solution, wherein the final concentration of target protein plasmid is 1.0 mu g/mL, and the final concentration of transfection reagent PEI is 3 mu g/mL. Finally, transferring the cell culture mixture into an incubator for culture without changing liquid, and harvesting the protein after 72 hours. Protein production in the supernatant was detected by SDS-PAGE.
(4) Ion exchange chromatography: the protein purifier pump head was placed in buffers QA and QB and then first pumped, after which 3 column volumes of QB were used to rinse the anion exchange column, wash off the possibly remaining impurities on the column, and then 5 column volumes of QA were used to equilibrate the anion exchange column. The a pump was then placed into the collected supernatant protein sample to begin loading until the protein was fully bound to the ion exchange column, and care was taken to observe the a280 absorbance value and conductivity value of the uv detector during loading to ensure that the protein was bound to the ion exchange column. After loading, the pump A is placed in QA again, and the residual protein in the pump A is completely flushed into the ion exchange column, the absorption value of the ultraviolet detector A280 is kept stable, and then the target protein is ready to be eluted from the ion exchange column.
(5) Activity detection and NK cell culture: performing activity identification on the purified IL-15 according to a general rule 3524 recombinant human interleukin-2 biological activity assay in pharmacopoeia 2020 edition; NK cell culture and cell activity detection were performed according to the industry general methods. CTLL-2 cells were cultured in complete medium at 37℃in 5% CO 2 Culturing under conditions sufficient to collect CTLL-2 cells by centrifugation, washing 3 times with RPMI-1640 culture solution, and re-suspending in basic culture solution to give a culture solution containing 6.0X10 per 1ml 5 Cell suspension of individual cells at 37℃in 5% CO 2 And (5) standby under the condition. Adding standard solutionAnd a sample solution in 96-well cell culture plate, 50. Mu.L of cell suspension was added to each well, and the mixture was subjected to 5% CO at 37 ℃ 2 Culturing for 18-24 hours under the condition; then 20. Mu.L of MTT solution was added to each well, and the mixture was heated to 37℃with 5% CO 2 After culturing for 4-6 hours under the condition, 150 mu L of lysate is added into each hole, and the temperature is 37 ℃ and the concentration of CO is 5% 2 And preserving heat for 18-24 hours under the condition. All of the above operations are performed under aseptic conditions. Mixing the liquid in the cell plate, placing the liquid in an enzyme-labeled instrument, taking 630nm as a reference wavelength, measuring absorbance at the wavelength of 570nm, and recording the measurement result; fresh PBMCs were isolated from human whole blood using density gradient centrifugation for activated expansion of NK cells, and the isolated autologous plasma was kept for NK cell culture after inactivation at 56 ℃ for 30 min. On day 0, the isolated PBMC cell suspension was transferred to a prepared monoclonal CD16 antibody coated T75 flask and cell density was adjusted to 2X 10 using SCGM NK medium 6 Inoculating cells per mL, adding commercial IL-15-1 with a final concentration of 500IU/mL or commercial IL-15-2 with the same concentration or IL-15 obtained by the purification method of the invention with the same concentration, 10% heat-inactivated autologous plasma, placing into 37 ℃ and 5% CO 2 Cell activation was performed in the incubator. Transferring cells into new T75 culture flask 5 days after activation, adding NK culture medium containing IL-15 and 10% heat-inactivated autologous plasma, testing cell viability and density every 2-3 days, and maintaining cell density at 1-1.5X10 6 NK cells were harvested and examined on day 14 of culture at each/mL.
(6) NK cell viability and proliferation efficiency detection: total cell proliferation curve data were obtained by sampling and counting on days 0,5,7,9, 11, 14 of culture, respectively.
(7) NK cell identification: cell immunophenotyping assays were performed on day 8 and day 14 of cell culture. About 1.0X10 respectively 6 The individual cells were centrifuged at 2000rpm for 5 minutes, the supernatant removed and resuspended in PBS, and the fluorescently labeled CD3 antibody and CD56 antibody were used to incubate the PBS-resuspended cells under the following conditions: at 4℃for 15 min, then washed 2 times with 1mL of PBS, the supernatant discarded, and resuspended in 0.5 mL of PBS. And detecting and analyzing the treated cells by using a flow cytometer.
(8) NK fineCell killing activity assay (CCK 8 method): taking K562 cell strain with vigorous growth as target cell, washing with RPMI-1640 culture solution for 2 times, and adjusting cell density to 1×10 6 /ml. 50 μl of each well was plated in a 96-well plate. The NK cells cultured until day 14 were collected and the cell density was adjusted to 1X 10 6 Per mL, 2X 10 6 Per mL, 5X 10 6 Per mL, 1X 10 7 50 mu L of each/mL is taken and added into a 96-well plate, so that the effective target ratios are respectively as follows: 1:1, 2:1, 5:1, 10:1, into four groups, respectively experimental group (K562 + NK), control group (NK + RPMI-1640), maximum release group (K562 + RPMI-1640) and blank group (RPMI-1640), wherein the control group does not contain K562 cells, and the obtained absorbance is the value of K562 cell 0 killing; the maximum release group was subjected to K562 cell lysis, and the absorbance obtained was a value of 100% killing; the blank is medium, no cells are contained, and the absorbance obtained is the background value. Each group had 3 duplicate wells. After the inoculated cells are placed in an incubator for co-culture for 12 hours, 10 mu LCCK-8 reagent is added into each hole, and the cells are uniformly shaken for continuous culture for 3 hours. The enzyme label instrument detects the light absorption value at the wavelength of 450nm, and the killing rate is calculated according to the calculation mode: 1- [ experimental group (OD value) -control group (OD value) -blank group (OD value) ]/[ maximum release group (OD value) -blank group (OD value) ]. Times.100.
The present invention will be specifically described with reference to the following examples.
Example 1: expression purification of the aglycosylated modified rhIL-15 protein was performed entirely according to the above experimental procedure.
The potential three N-glycosylation residues N119, N143 and N160 in the human IL-15 sequence (SEQ ID No. 1) are mutated into aspartic acid (SEQ ID No. 2), the original signal peptide is changed into IgG heavy chain signal peptide (SEQ ID No. 3), and the sequence of Kozak is added to construct the UCOE ® In an expression vector.
The experimental results are shown in FIGS. 1-2: plasmid transfection experiments were performed as described above, and the proteins in the supernatant were collected and purified using ion exchange chromatography after 72 hours of transfection. IL-15 has a theoretical isoelectric point of 4.4, and when the pH of the environment in which the protein is positioned is greater than 4.4, the protein is negatively charged and can be combined with anion exchange with positive chargeAnd (3) a chromatographic column, wherein after the protein is combined to the anion exchange chromatographic column, the salt concentration is increased so as to elute the target protein from the chromatographic column, and finally, the non-glycosylation modified IL-15 with higher purity is obtained. As shown in FIG. 12, the molecular weight of the protein obtained by SDS-PAGE was about 12kDa, which is consistent with the theoretical molecular weight; the purity of the gray level analysis is more than 95 percent; IL-15 bioactivity is about 4.3X10 7 IU/mg, meets GMP requirements.
Example 2: to ensure consistent experimental conditions, the activity of IL-15 of the invention and two commercial IL-15 were tested simultaneously using the same pharmacopoeia method.
The activity of the IL-15 obtained by the invention is as follows: 4.3X10 7 IU/mg, commercial IL-15-1 Activity is 2.6X10 7 IU/mg, commercial IL-15-2 Activity is 2.1X10 7 In this example, the final concentration of each IL-15 addition was adjusted to be 500IU/mL based on the results of activity detection. Under the same conditions, the IL-15 provided by the invention has advantages of NK cell amplification, NK proportion and killing property, because the removal of glycosylation modification improves the physiological activity of IL-15 on NK activation and amplification.
The experimental results are shown in fig. 3: the final total cell expansion obtained by adding the IL-15 of the invention is slightly higher than that of the commercial IL-15-1 and the commercial IL-15-2.
The experimental results are shown in fig. 4: the addition of the IL-15 can increase the NK cell proportion (namely the proportion of the obtained D14 harvested CD3-CD56+ cells) by at least 10 percent, so that the NK cell proportion is obviously increased.
The experimental results are shown in fig. 5: the tumor cell killing activity of the IL-15 is higher than that of the control commercial IL-15 under the conditions that the effective target ratio is 1:1, 2:1 and 5:1.
Example 3: other experimental conditions were unchanged, and only the NK cell medium was replaced with corning KBM581 NK medium.
The experimental results are shown in fig. 6: the final total cell expansion obtained by adding the IL-15 of the invention is slightly higher than that of the commercial IL-15-1 and the commercial IL-15-2.
The experimental results are shown in fig. 7: the addition of the IL-15 can increase the NK cell proportion (namely the proportion of the obtained D14 harvested CD3-CD56+ cells) by at least 10 percent, so that the NK cell proportion is obviously increased.
The experimental results are shown in fig. 8: the tumor cell killing activity of the IL-15 is higher than that of the control commercial IL-15 under the conditions that the effective target ratio is 1:1, 2:1 and 5:1.
Example 4: other experimental conditions are unchanged, and only the NK cell culture medium is replaced by the Bao Ri Yi NK cell serum-free culture medium.
The experimental results are shown in fig. 9: the final total cell expansion obtained by adding the IL-15 of the invention is slightly higher than that of the commercial IL-15-1 and the commercial IL-15-2.
The experimental results are shown in fig. 10: the addition of the IL-15 can increase the NK cell proportion (namely the proportion of the obtained D14 harvested CD3-CD56+ cells) by at least 10 percent, so that the NK cell proportion is obviously increased.
The experimental results are shown in fig. 11: the tumor cell killing activity of the IL-15 is higher than that of the control commercial IL-15 under the conditions that the effective target ratio is 1:1, 2:1 and 5:1.
It is noted that relational terms such as first and second, and the like are used solely to distinguish one entity or action from another entity or action without necessarily requiring or implying any actual such relationship or order between such entities or actions. Moreover, the terms "comprises," "comprising," or any other variation thereof, are intended to cover a non-exclusive inclusion, such that a process, method, article, or apparatus that comprises a list of elements does not include only those elements but may include other elements not expressly listed or inherent to such process, method, article, or apparatus.
Finally, it should be noted that: the foregoing description is only a preferred embodiment of the present invention, and the present invention is not limited thereto, but it is to be understood that modifications and equivalents of some of the technical features described in the foregoing embodiments may be made by those skilled in the art, although the present invention has been described in detail with reference to the foregoing embodiments. Any modification, equivalent replacement, improvement, etc. made within the spirit and principle of the present invention should be included in the protection scope of the present invention.
Claims (5)
1. An aglycosylation modified IL-15, wherein the amino acid mutation site of said IL-15 is N119D, N D and N160D, and the signal peptide of said IL-15 is changed to an IgG heavy chain signal peptide;
the front end of the nucleotide sequence of the IL-15 is added with a Kozak sequence;
the nucleotide sequence of the IL-15 is shown as SEQ ID NO: shown at 5.
2. The aglycosylated modified IL-15 according to claim 1, wherein the amino acid sequence of said IL-15 is as set forth in SEQ ID NO: 4.
3. The method for preparing IL-15 according to claim 1, wherein the target protein plasmid capable of expressing the IL-15 is transfected into 293 cells using the transfection reagent PEI.
4. The method for preparing IL-15 according to claim 3, wherein the vector used in the target protein plasmid is UCOE ® An expression vector.
5. The method for producing IL-15 according to claim 4, wherein the final concentration of the target protein plasmid is 1.0. Mu.g/mL and the final concentration of the transfection reagent PEI is 3. Mu.g/mL.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202310683428.XA CN116425857B (en) | 2023-06-09 | 2023-06-09 | Glycosylation-free modified IL-15 and preparation method thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202310683428.XA CN116425857B (en) | 2023-06-09 | 2023-06-09 | Glycosylation-free modified IL-15 and preparation method thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN116425857A CN116425857A (en) | 2023-07-14 |
| CN116425857B true CN116425857B (en) | 2023-08-18 |
Family
ID=87094696
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202310683428.XA Active CN116425857B (en) | 2023-06-09 | 2023-06-09 | Glycosylation-free modified IL-15 and preparation method thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN116425857B (en) |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020236655A1 (en) * | 2019-05-17 | 2020-11-26 | Xencor, Inc. | Il-7-fc-fusi0n proteins |
| CN113501884A (en) * | 2021-06-30 | 2021-10-15 | 徐州医科大学 | Fully human chimeric antigen receptor targeting B7H3, iNKT cell and application thereof |
| CN116209459A (en) * | 2020-06-26 | 2023-06-02 | 美国安进公司 | IL-10 muteins and fusion proteins thereof |
-
2023
- 2023-06-09 CN CN202310683428.XA patent/CN116425857B/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020236655A1 (en) * | 2019-05-17 | 2020-11-26 | Xencor, Inc. | Il-7-fc-fusi0n proteins |
| CN116209459A (en) * | 2020-06-26 | 2023-06-02 | 美国安进公司 | IL-10 muteins and fusion proteins thereof |
| CN113501884A (en) * | 2021-06-30 | 2021-10-15 | 徐州医科大学 | Fully human chimeric antigen receptor targeting B7H3, iNKT cell and application thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CN116425857A (en) | 2023-07-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP5908016B2 (en) | Methods for growing monocytes | |
| US4406830A (en) | Regulatory glycoprotein for immune response and the use thereof in the production of T-cell growth factor | |
| JPS5813397A (en) | Immune interferon and production of mrna | |
| CN111394308B (en) | Method for culturing cord blood lymphocyte CIK | |
| CN113583952B (en) | Culture solution for increasing yield of exosomes of stem cells | |
| Stevenson et al. | Characterization of biological response modifier release by human monocytes cultured in suspension in serum-free medium | |
| CN116425857B (en) | Glycosylation-free modified IL-15 and preparation method thereof | |
| GB2121053A (en) | Production of interleukin and its analogous immune regulating factors | |
| CN112300992B (en) | NK cell culture solution and multistage activated NK cell culture method | |
| US4760021A (en) | Biological response modifier having cell differentiation-induction activity and process for production thereof | |
| CN110499291A (en) | The method of free serum culture preparation Chimeric antigen receptor T cell | |
| US4681844A (en) | Process for producing an Interleukin-1 preparation | |
| US4661447A (en) | Regulatory glycoprotein for immune response and the use there of in the production of T-cell growth factor | |
| EP0672684A1 (en) | Novel megakaryocyte colony stimulating factor and production thereof | |
| US6331403B1 (en) | Use of mCRP to slow cell growth and to promote maturation of cells | |
| CN112675201B (en) | Application of macrophage subgroup and regulator thereof in acute graft-versus-host disease | |
| US5093479A (en) | Regulatory glycoprotein for immune response and the use, thereof in the production of t-cell growth factor | |
| US4808533A (en) | Method of preventing T-cell blastogenesis | |
| JPH03145499A (en) | Human monocyto growth factor | |
| CN117286102A (en) | Cell culture medium for improving NK cell purity and culture method | |
| EP0136375A1 (en) | A regulatory glycoprotein for immune response in the production of T-cell growth factor | |
| CN115161280A (en) | Gamma delta T cell culture solution and gamma delta T cell amplification culture method | |
| KR20230158102A (en) | In vitro proliferation of human phagocytic cells | |
| CN115353556A (en) | Fusion protein-based anti-NK cell senescence method and culture medium containing fusion protein | |
| CN110938113A (en) | Application of immunoregulation peptide in preparing immunopotentiation medicine |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant |