CN116334057A - Enzyme assembly constructed by polyethylene glycol maleimide derivative, and preparation method and application thereof - Google Patents
Enzyme assembly constructed by polyethylene glycol maleimide derivative, and preparation method and application thereof Download PDFInfo
- Publication number
- CN116334057A CN116334057A CN202210982067.4A CN202210982067A CN116334057A CN 116334057 A CN116334057 A CN 116334057A CN 202210982067 A CN202210982067 A CN 202210982067A CN 116334057 A CN116334057 A CN 116334057A
- Authority
- CN
- China
- Prior art keywords
- polyethylene glycol
- enzyme
- mal
- assembly
- glycol maleimide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 102000004190 Enzymes Human genes 0.000 title claims abstract description 104
- 108090000790 Enzymes Proteins 0.000 title claims abstract description 104
- 229920001223 polyethylene glycol Polymers 0.000 title claims abstract description 70
- 239000002202 Polyethylene glycol Substances 0.000 title claims abstract description 63
- 125000005439 maleimidyl group Chemical class C1(C=CC(N1*)=O)=O 0.000 title claims abstract description 9
- 238000002360 preparation method Methods 0.000 title abstract description 5
- 238000000034 method Methods 0.000 claims abstract description 36
- 230000035772 mutation Effects 0.000 claims abstract description 20
- 238000004132 cross linking Methods 0.000 claims abstract description 11
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 claims abstract description 4
- 238000006467 substitution reaction Methods 0.000 claims abstract description 4
- MPDGHEJMBKOTSU-YKLVYJNSSA-N 18beta-glycyrrhetic acid Chemical compound C([C@H]1C2=CC(=O)[C@H]34)[C@@](C)(C(O)=O)CC[C@]1(C)CC[C@@]2(C)[C@]4(C)CC[C@@H]1[C@]3(C)CC[C@H](O)C1(C)C MPDGHEJMBKOTSU-YKLVYJNSSA-N 0.000 claims description 40
- 150000003923 2,5-pyrrolediones Chemical class 0.000 claims description 37
- 238000006243 chemical reaction Methods 0.000 claims description 36
- VTAJIXDZFCRWBR-UHFFFAOYSA-N Licoricesaponin B2 Natural products C1C(C2C(C3(CCC4(C)CCC(C)(CC4C3=CC2)C(O)=O)C)(C)CC2)(C)C2C(C)(C)CC1OC1OC(C(O)=O)C(O)C(O)C1OC1OC(C(O)=O)C(O)C(O)C1O VTAJIXDZFCRWBR-UHFFFAOYSA-N 0.000 claims description 34
- LPLVUJXQOOQHMX-UHFFFAOYSA-N glycyrrhetinic acid glycoside Natural products C1CC(C2C(C3(CCC4(C)CCC(C)(CC4C3=CC2=O)C(O)=O)C)(C)CC2)(C)C2C(C)(C)C1OC1OC(C(O)=O)C(O)C(O)C1OC1OC(C(O)=O)C(O)C(O)C1O LPLVUJXQOOQHMX-UHFFFAOYSA-N 0.000 claims description 34
- 229960004949 glycyrrhizic acid Drugs 0.000 claims description 34
- UYRUBYNTXSDKQT-UHFFFAOYSA-N glycyrrhizic acid Natural products CC1(C)C(CCC2(C)C1CCC3(C)C2C(=O)C=C4C5CC(C)(CCC5(C)CCC34C)C(=O)O)OC6OC(C(O)C(O)C6OC7OC(O)C(O)C(O)C7C(=O)O)C(=O)O UYRUBYNTXSDKQT-UHFFFAOYSA-N 0.000 claims description 34
- 239000001685 glycyrrhizic acid Substances 0.000 claims description 34
- 235000019410 glycyrrhizin Nutrition 0.000 claims description 34
- LPLVUJXQOOQHMX-QWBHMCJMSA-N glycyrrhizinic acid Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@H](O[C@@H]1O[C@@H]1C([C@H]2[C@]([C@@H]3[C@@]([C@@]4(CC[C@@]5(C)CC[C@@](C)(C[C@H]5C4=CC3=O)C(O)=O)C)(C)CC2)(C)CC1)(C)C)C(O)=O)[C@@H]1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O LPLVUJXQOOQHMX-QWBHMCJMSA-N 0.000 claims description 34
- 235000018417 cysteine Nutrition 0.000 claims description 33
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims description 33
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 claims description 23
- MPDGHEJMBKOTSU-UHFFFAOYSA-N Glycyrrhetinsaeure Natural products C12C(=O)C=C3C4CC(C)(C(O)=O)CCC4(C)CCC3(C)C1(C)CCC1C2(C)CCC(O)C1(C)C MPDGHEJMBKOTSU-UHFFFAOYSA-N 0.000 claims description 20
- 229960003720 enoxolone Drugs 0.000 claims description 20
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Natural products NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 16
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 claims description 9
- 235000009582 asparagine Nutrition 0.000 claims description 9
- 229960001230 asparagine Drugs 0.000 claims description 9
- 125000003827 glycol group Chemical group 0.000 claims description 9
- 239000004471 Glycine Substances 0.000 claims description 8
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 claims description 6
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 claims description 4
- 230000035484 reaction time Effects 0.000 claims description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 claims description 3
- 239000004473 Threonine Substances 0.000 claims description 3
- 235000003704 aspartic acid Nutrition 0.000 claims description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N aspartic acid group Chemical group N[C@@H](CC(=O)O)C(=O)O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 claims description 3
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 claims description 3
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 claims 3
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 claims 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical group SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 claims 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 claims 1
- 230000000694 effects Effects 0.000 abstract description 21
- 108090000623 proteins and genes Proteins 0.000 abstract description 15
- 102000004169 proteins and genes Human genes 0.000 abstract description 14
- 235000018102 proteins Nutrition 0.000 abstract description 13
- 125000003275 alpha amino acid group Chemical group 0.000 abstract 1
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 12
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 12
- 238000000429 assembly Methods 0.000 description 9
- 230000000712 assembly Effects 0.000 description 9
- 230000003197 catalytic effect Effects 0.000 description 9
- 102000053187 Glucuronidase Human genes 0.000 description 7
- 108010060309 Glucuronidase Proteins 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- 238000003917 TEM image Methods 0.000 description 6
- 238000010438 heat treatment Methods 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- 150000001413 amino acids Chemical group 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- 239000003431 cross linking reagent Substances 0.000 description 5
- 238000001338 self-assembly Methods 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- BHPSIKROCCEKQR-UHFFFAOYSA-N 3-sulfanylpyrrole-2,5-dione Chemical compound SC1=CC(=O)NC1=O BHPSIKROCCEKQR-UHFFFAOYSA-N 0.000 description 4
- 239000004971 Cross linker Substances 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 230000014759 maintenance of location Effects 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 240000006439 Aspergillus oryzae Species 0.000 description 3
- 235000002247 Aspergillus oryzae Nutrition 0.000 description 3
- 238000007259 addition reaction Methods 0.000 description 3
- 239000012154 double-distilled water Substances 0.000 description 3
- 238000001641 gel filtration chromatography Methods 0.000 description 3
- 238000004128 high performance liquid chromatography Methods 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 210000003000 inclusion body Anatomy 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 229910052751 metal Inorganic materials 0.000 description 3
- 239000002184 metal Substances 0.000 description 3
- 239000000203 mixture Substances 0.000 description 3
- 238000001426 native polyacrylamide gel electrophoresis Methods 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 238000012795 verification Methods 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Natural products CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 238000000137 annealing Methods 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 238000010170 biological method Methods 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 210000004027 cell Anatomy 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 230000009977 dual effect Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 229930027917 kanamycin Natural products 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- 229960000318 kanamycin Drugs 0.000 description 2
- 229930182823 kanamycin A Natural products 0.000 description 2
- 125000005647 linker group Chemical group 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 238000012257 pre-denaturation Methods 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 102200000909 rs7905009 Human genes 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 239000007974 sodium acetate buffer Substances 0.000 description 2
- BHZOKUMUHVTPBX-UHFFFAOYSA-M sodium acetic acid acetate Chemical compound [Na+].CC(O)=O.CC([O-])=O BHZOKUMUHVTPBX-UHFFFAOYSA-M 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- XQUPVDVFXZDTLT-UHFFFAOYSA-N 1-[4-[[4-(2,5-dioxopyrrol-1-yl)phenyl]methyl]phenyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1C(C=C1)=CC=C1CC1=CC=C(N2C(C=CC2=O)=O)C=C1 XQUPVDVFXZDTLT-UHFFFAOYSA-N 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 108050009160 DNA polymerase 1 Proteins 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical compound [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 239000001888 Peptone Substances 0.000 description 1
- 108010080698 Peptones Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 239000012505 Superdex™ Substances 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 125000000218 acetic acid group Chemical group C(C)(=O)* 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 229910052805 deuterium Inorganic materials 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000003480 eluent Substances 0.000 description 1
- 238000001952 enzyme assay Methods 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 230000017730 intein-mediated protein splicing Effects 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 235000019319 peptone Nutrition 0.000 description 1
- 229920003192 poly(bis maleimide) Polymers 0.000 description 1
- 108010094020 polyglycine Proteins 0.000 description 1
- 229920000232 polyglycine polymer Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 150000008130 triterpenoid saponins Chemical class 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/96—Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P15/00—Preparation of compounds containing at least three condensed carbocyclic rings
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01031—Beta-glucuronidase (3.2.1.31)
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02P—CLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
- Y02P20/00—Technologies relating to chemical industry
- Y02P20/50—Improvements relating to the production of bulk chemicals
- Y02P20/55—Design of synthesis routes, e.g. reducing the use of auxiliary or protecting groups
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Enzymes And Modification Thereof (AREA)
Abstract
The invention discloses an enzyme assembly constructed by polyethylene glycol maleimide derivative, a preparation method and application thereof, wherein the method comprises the following steps: crosslinking polyethylene glycol maleimide derivative with enzyme to obtain enzyme assembly; wherein: the enzyme consists of SEQ ID NO:1 by a single mutation of the amino acid sequence shown in (a) by substitution with a cysteine residue. The invention also relates to an enzyme assembly constructed by the method and application thereof. The invention realizes the assembly of protein at specific sites by a simple and efficient method, and successfully prepares the enzyme assembly with controllable relative spatial positioning. The enzyme assembly formed by the method can further improve the thermal stability of the enzyme on the basis of not affecting the activity of the enzyme basically.
Description
Technical Field
The invention relates to the field of biotechnology, in particular to the field of enzyme assembly, and more particularly relates to an enzyme assembly constructed by using polyethylene glycol maleimide derivatives, and a preparation method and application thereof.
Background
In the related art, methods for improving enzyme stability are as follows: cross-linked enzyme aggregation technology or active inclusion body technology; the cross-linking enzyme aggregate technology is a carrier-free immobilization method in which enzyme protein is precipitated by using a precipitant such as salt, an organic solvent or nonionic polymer to obtain an enzyme aggregate, and then cross-linking is performed by using a cross-linking agent. Active inclusion body technology refers to the fusion expression of hydrophobic or amphiphilic polypeptides at the sequence ends of enzyme molecules, wherein nonspecific actions between polypeptides lead to the formation of active aggregates, i.e. active inclusion bodies, of the enzyme during expression. Both of the above techniques can improve the stability of the enzyme, but because they merely aggregate the enzyme molecules together in a disordered manner, the overall activity of the enzyme aggregate is reduced.
Therefore, how to accurately design the enzyme assembly, so that the enzyme assembly can improve the stability of the enzyme on the basis of not influencing the catalytic activity of the enzyme, and has great application value. At present, many design strategies related to protein assemblies have been developed, and acting force for driving protein assembly mainly comprises biological methods such as isopeptidic bond formed by SpyTag-SpyCatcher, connection of N-terminal polyglycine and C-terminal LPXTG label catalyzed by sortase, splicing reaction catalyzed by split intein, domain exchange and the like, however, the biological methods not only require a large amount of genetic manipulation, but also have the problems of low protein assembly rate, low assembly efficiency, incapacity of controlling relative spatial positioning of proteins in the assemblies and the like. In addition, chemical methods of interaction of a host and a guest, glutaraldehyde crosslinking and metal coordination are introduced, however, the chemical methods have the defects of low specificity of non-covalent interaction, low assembly efficiency, complex separation and purification and the like, and the practical application of enzyme assembly is hindered.
The information disclosed in this background section is only for enhancement of understanding of the general background of the invention and should not be taken as an acknowledgement or any form of suggestion that this information forms the prior art already known to a person of ordinary skill in the art.
Disclosure of Invention
The present invention aims to solve at least one of the technical problems in the related art to some extent.
To this end, embodiments of the present invention provide a method of driving enzyme assembly with polyethylene glycol maleimide derivatives, the method comprising: crosslinking polyethylene glycol maleimide derivative with enzyme to obtain enzyme assembly; wherein:
the enzyme consists of SEQ ID NO:1, wherein the single mutation is a substitution with a cysteine residue;
the polyethylene glycol maleimide derivative contains at least two maleimide terminal groups.
The embodiment of the invention provides a method for driving self-assembly of Aspergillus oryzae-derived beta-glucuronidase (PGUS) (the amino acid sequence of which is shown as SEQ ID NO: 1) by using a polyethylene glycol maleimide derivative. The click addition reaction (sulfhydryl-maleimide addition) of the mutation-introduced cysteine and the polyethylene glycol maleimide derivative realizes the assembly of the protein at a specific site by a simple and efficient method, and successfully prepares the enzyme assembly with controllable relative spatial positioning. The enzyme assembly formed by the method can further improve the thermal stability of the enzyme on the basis of not affecting the activity of the enzyme basically.
Preferably, the polyethylene glycol maleimide derivative contains two or four maleimide end groups.
The structural formula of the polyethylene glycol maleimide derivative is as follows: PEG-X-MAL; wherein,,
PEG is polyethylene glycol residue, MAL is maleimide group;
x is a PEG-MAL linking group selected from: - (CH) 2 ) r -、-(CH 2 ) r O-、-(CH 2 ) r CO-、-(CH 2 ) r NH-、-(CH 2 ) r CONH-、-(CH 2 ) r NHCO-、-(CH 2 ) r S-、-(CH 2 ) r COO-and- (CH) 2 ) r OCO-, r is an integer of 0 to 10. Preferably, r is an integer from 0 to 5.
In some embodiments, the PEG is one of a linear polyethylene glycol residue, a four-arm branched polyethylene glycol residue, a six-arm branched polyethylene glycol residue.
In some embodiments, the single mutation is any one of the following:
(1) Asparagine (Asn) at position 28 to cysteine (Cys);
(2) Threonine (Thr) at position 34 is mutated to cysteine (Cys);
(3) Asparagine (Asn) at position 100 is mutated to cysteine (Cys);
(4) Glutamine (gin) at position 180 is mutated to cysteine (Cys);
(5) Glycine (Gly) at position 194 is mutated to cysteine (Cys);
(6) Aspartic acid (Asp) at position 220 to cysteine (Cys);
preferably, the single mutation is any one of the following:
mutation of asparagine (Asn) at position 28 to cysteine (Cys), or
Glycine (Gly) at position 194 is mutated to cysteine (Cys), or
Glutamine (Gln) at position 180 is mutated to cysteine (Cys).
More preferably, the single mutation is a glycine (Gly) to cysteine (Cys) mutation at position 194.
In some embodiments, the polyethylene glycol maleimide derivative is a dual arm polyethylene glycol maleimide (Mal) 2 ) Or four-arm polyethylene glycol maleimide (Mal) 4 ). Preferably, it is: compared with the double-arm polyethylene glycol maleimide, the four-arm polyethylene glycol maleimide can further improve the enzyme self-assembly efficiency.
In some embodiments, the polyethylene glycol maleimide derivative has a molecular weight of 2000-3400Da.
In some embodiments, the polyethylene glycol maleimide derivative to enzyme molar ratio is 1 (1.5-2.5), preferably a molar ratio of 1:2.
in some embodiments, the conditions of crosslinking are: the pH value is 6.8-7.4, the reaction temperature is 0-10 ℃, and the reaction time is 2-12 hours.
The embodiment of the invention also provides an enzyme assembly prepared by the method. The enzyme assembly prepared by the embodiment of the invention has the advantages of high catalytic activity, high thermal stability, mild reaction conditions, high efficiency, green and safe performance and the like.
The embodiment of the invention also provides application of the enzyme assembly in converting glycyrrhizic acid into glycyrrhetinic acid.
The invention has the following advantages and beneficial effects:
(1) The invention uses polyethylene glycol maleimide cross-linking agent to drive the self-assembly of Aspergillus oryzae-derived beta-glucuronidase (PGUS) (the amino acid sequence of which is shown as SEQ ID NO: 1). The click addition reaction (sulfhydryl-maleimide addition) of the mutation-introduced cysteine and the polyethylene glycol maleimide derivative (cross-linking agent) realizes the assembly of the protein at a specific site by a simple and efficient method, and successfully prepares the enzyme assembly with controllable relative spatial positioning. The enzyme assembly formed by the method can further improve the thermal stability of the enzyme on the basis of not affecting the activity of the enzyme basically.
(2) The enzyme assembly provided by the invention has the advantages of rapid reaction, quantitative conversion of sulfhydryl-maleimide reaction as driving force, simplicity in operation, high assembly efficiency and easiness in expanded production.
(3) The beta-glucuronidase assembly has the advantages of high catalytic activity, high thermal stability, mild reaction conditions, high efficiency, green safety and the like.
Drawings
The foregoing and/or additional aspects and advantages of the invention will become apparent and may be better understood from the following description of embodiments taken in conjunction with the accompanying drawings in which:
FIG. 1 shows Native-PAGE verification of N28C, T C, N100C, Q180C, G194C, D220C by double arm crosslinker Mal 2 Feasibility of assembly.
FIG. 2 shows Native-PAGE verification of N28C, T C, N100C, Q180C, G194C, D220C by four arm crosslinker Mal 4 Feasibility of assembly.
FIG. 3 shows the gel filtration chromatography ratioCompared with G194C-Mal 2 、G194C-Mal 4 Degree of assembly with PGUS and efficiency of assembly.
FIG. 4 is a TEM image of PGUS free enzyme.
FIG. 5 is G194C-Mal 2 TEM image of assembled enzyme.
FIG. 6 is G194C-Mal 4 TEM image of assembled enzyme.
FIG. 7 shows the relative activities of mutant N28C, T C, N100C, Q180C, G194C, D C and corresponding assemblies.
FIG. 8 is an assembly N28C-Mal 2 、T34C-Mal 2 、N100C-Mal 2 、Q180C-Mal 2 、G194C-Mal 2 、D220C-Mal 2 Thermal stability at 70 ℃.
FIG. 9 is an assembly N28C-Mal 4 、T34C-Mal 4 、N100C-Mal 4 、Q180C-Mal 4 、G194C-Mal 4 、D220C-Mal 4 Thermal stability at 70 ℃.
FIG. 10 shows the assembly G194C-Mal at various temperatures 2 、G194C-Mal 4 And PGUS catalyzes the change in glycyrrhetinic acid concentration of glycyrrhizic acid conversion.
FIG. 11 shows the assembly G194C-Mal at various temperatures 2 、G194C-Mal 4 And PGUS catalyzes the conversion change of glycyrrhizic acid.
FIG. 12 shows the assembly G194C-Mal at various temperatures 2 、G194C-Mal 4 And PGUS catalyzes changes in glycyrrhizic acid yield from glycyrrhizic acid conversion.
Detailed Description
The following detailed description of embodiments of the invention is exemplary and intended to be illustrative of the invention and not to be construed as limiting the invention. The specific conditions were not specified in the examples and the procedure was carried out under conventional conditions.
The experimental methods used in the examples below are conventional methods unless otherwise specified.
The materials, reagents, devices and the like used in the following examples, unless otherwise specified, were prepared commercially or according to the methods of the publications.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.
The embodiment of the invention provides a method for driving enzyme assembly by using polyethylene glycol maleimide derivatives, which comprises the following steps: crosslinking polyethylene glycol maleimide derivative with enzyme to obtain enzyme assembly; wherein:
the enzyme consists of SEQ ID NO:1, wherein the single mutation is a substitution with a cysteine residue;
the polyethylene glycol maleimide derivative contains at least two maleimide terminal groups.
The embodiment of the invention provides a method for driving self-assembly of Aspergillus oryzae-derived beta-glucuronidase (PGUS) (the amino acid sequence of which is shown as SEQ ID NO: 1) by using a polyethylene glycol maleimide derivative. The click addition reaction (sulfhydryl-maleimide addition) of the mutation-introduced cysteine and the polyethylene glycol maleimide derivative realizes the assembly of the protein at a specific site by a simple and efficient method, and successfully prepares the enzyme assembly with controllable relative spatial positioning. The enzyme assembly formed by the method can further improve the thermal stability of the enzyme on the basis of not affecting the activity of the enzyme basically.
Preferably, the polyethylene glycol maleimide derivative contains two or four maleimide end groups.
The structural formula of the polyethylene glycol maleimide derivative is as follows: PEG-X-MAL; wherein,,
PEG is polyethylene glycol residue, MAL is maleimide group;
x is a PEG-MAL linking group selected from: - (CH) 2 ) r -、-(CH 2 ) r O-、-(CH 2 ) r CO-、-(CH 2 ) r NH-、-(CH 2 ) r CONH-、-(CH 2 ) r NHCO-、-(CH 2 ) r S-、-(CH 2 ) r COO-and- (CH) 2 ) r OCO-, r is an integer of 0 to 10. PreferablyAnd r is an integer of 0 to 5. Non-limiting examples are: r is 0, 1, 2, 3, 4, 5.
By way of non-limiting example, the X is selected from: single bond, -CH 2 -、-CH 2 CH 2 -、-CH 2 CH 2 CH 2 -、-CH 2 O-、-CH 2 CH 2 O-、-CO-、-CH 2 CO-、-CH 2 CH 2 CO-、-CH 2 CH 2 CH 2 CO-、-NH-、-CH 2 NH-、-CH 2 CH 2 NH-、-CH 2 CH 2 CH 2 NH-、-CONH-、-CH 2 CONH-、-CH 2 CH 2 CONH-、-CH 2 CH 2 CH 2 CONH-、-CH 2 S-、-CH 2 CH 2 S-、-COO-、-CH 2 COO-、-CH 2 CH 2 COO-、-NHCO-、-CH 2 NHCO-、-CH 2 CH 2 NHCO-、-CH 2 OCO-、-CH 2 CH 2 OCO-、-CH 2 CH 2 CH 2 One or a combination of two or more of OCO-.
In some embodiments, the PEG is one of a linear polyethylene glycol residue, a four-arm branched polyethylene glycol residue, a six-arm branched polyethylene glycol residue.
In some embodiments, the single mutation is any one of the following:
(1) Asparagine (Asn) at position 28 to cysteine (Cys);
(2) Threonine (Thr) at position 34 is mutated to cysteine (Cys);
(3) Asparagine (Asn) at position 100 is mutated to cysteine (Cys);
(4) Glutamine (gin) at position 180 is mutated to cysteine (Cys);
(5) Glycine (Gly) at position 194 is mutated to cysteine (Cys);
(6) Aspartic acid (Asp) at position 220 to cysteine (Cys);
preferably, the single mutation is any one of the following:
mutation of asparagine (Asn) at position 28 to cysteine (Cys), or
Glycine (Gly) at position 194 is mutated to cysteine (Cys), or
Glutamine (Gln) at position 180 is mutated to cysteine (Cys).
More preferably, the single mutation is a glycine (Gly) to cysteine (Cys) mutation at position 194.
In some embodiments, the polyethylene glycol maleimide derivative is a dual arm polyethylene glycol maleimide (Mal) 2 ) Or four-arm polyethylene glycol maleimide (Mal) 4 ). Preferably, it is: compared with the double-arm polyethylene glycol maleimide, the four-arm polyethylene glycol maleimide can further improve the enzyme self-assembly efficiency.
In some embodiments, the polyethylene glycol maleimide derivative has a molecular weight of 2000-3400Da.
In some embodiments, the polyethylene glycol maleimide derivative to enzyme molar ratio is 1 (1.5-2.5), such as, by way of non-limiting example, a molar ratio of 1:1.5, 1:1.7, 1:1.8, 1:2, 1:2.2, 1:2.5. Preferably, the molar ratio is 1:2.
in some embodiments, the conditions of crosslinking are: the pH value is 6.8-7.4, the reaction temperature is 0-10 ℃, and the reaction time is 2-12 hours.
The embodiment of the invention also provides an enzyme assembly prepared by the method. The enzyme assembly prepared by the embodiment of the invention has the advantages of high catalytic activity, high thermal stability, mild reaction conditions, high efficiency, green and safe performance and the like.
The embodiment of the invention also provides application of the enzyme assembly in converting glycyrrhizic acid into glycyrrhetinic acid.
Embodiments of the present invention are described in further detail below.
Materials: primer synthesis: the primers used in the examples of the present invention were all prepared synthetically by Jin Weizhi Biotechnology Co. Fastpfu high-fidelity polymerase is purchased from full gold company; restriction enzymes were purchased from Thermo Fisher company; the plasmid miniprep kit and the yeast genome kit used were purchased from Tiangen corporation.
The inventionIn the illustrative embodiment, two arms polyethylene glycol maleimide (Mal) 2 ) Available from Bio Inc., bismaleimide PEG, cat# PS2-M-2K, having a molecular weight of 2K.
In the specific embodiment of the invention, four-arm polyethylene glycol maleimide (Mal) 4 ) Available from Bio Inc., four-arm-PEG-maleimide, cat# PS4-M-2K, having a molecular weight of 2K.
Example 1 plasmid construction
The vector is pET28a (+) -PGUS stored in a laboratory, and the amino acid sequence of the PGUS is shown as SEQ ID NO:1 (gene of PGUS: genbank registration sequence number EU 095019), 28, 34, 100, 180, 194, 220 sites are mutated into cysteine to construct single point mutant N28C, T34C, N100C, Q180C, G194C, D220C, respectively, and primers for the mutation are shown in Table 1. The vector was sequenced by the airlida company using Bomaide TOP10 competent enrichment plasmid and Bomaide BL21 competent as expression host.
The amplification system is as follows: fastpfu Buffer (5X) 10.0. Mu. L, dNTP (2.5 mM) 4. Mu. L, pET28a (+) -PGUS template 1. Mu.L, upstream and downstream primers (5. Mu.M) 1. Mu.L each of 1. Mu. L, fastPfu Hi-Fi DNA polymerase 1. Mu.L, and double distilled water was supplemented to 50. Mu.L. The amplification conditions were 95℃for 3 min of pre-denaturation; denaturation at 95℃for 20 sec, annealing at 60℃for 20 sec, extension at 72℃for 3 min (30 cycles); extension was carried out at 72℃for 10 minutes.
Restriction endonuclease Dpn I digests the methylation template: 5. Mu.L of the amplified product of the point mutation, 10x digest buffer1. Mu.L of restriction endonuclease Dpn I1. Mu.L was used to make up 10. Mu.L of the cleavage system with double distilled water under the cleavage conditions of 37℃for 1 hour, followed by reaction at 80℃for 20 minutes to inactivate the enzyme.
The digested product was transformed into E.coli TOP10 competent cells by heat shock, plated on solid LB medium (peptone 10g/L, yeast extract 5g/L, sodium chloride 10g/L, agarose 20 g/L) containing 50mg/L kanamycin, and cultured at 37℃for about 16 hours.
Transformants were identified by colony PCR and sequencing methods. Colony PCR system: template LB plates were single-colony, 1. Mu.L each of T7 promoter and terminator universal primer, 10. Mu.L of 2 XTaq mix (America Biolabs.), and 20. Mu.L of double distilled water was made up. PCR conditions: pre-denaturation at 94℃for 5min, denaturation at 94℃for 30s, annealing at 60℃for 30s, extension at 72℃for 1min for 30s, circulation for 30 times, 10min at 72℃and preservation at 4 ℃. The transformants containing the target bands were confirmed by colony PCR to be subjected to DNA sequencing, and the success of plasmid construction was confirmed.
TABLE 1 primers for mutation
| Primer | Sequence(5’--3’) |
| N28C-F | ATCCGACGACTGCAATACGCAACCATGGACAAG |
| N28C-R | GTCGTCGGATGCTAGGGCAAATTTC |
| T34C-F | GCAACCATGGTGCAGCCAACTAAAAACGTCCCTG |
| T34C-R | CCATGGTTGCGTATTGTTGTCG |
| N100C-F | CGTCAATGGATGCCTGGTCGCGGACCATGTG |
| N100C-R | TCCATTGACGTAGATCCGGCC |
| Q180C-F | ATTCTGTGCCATGCCAGCACATTCAGGATATCACTGTTCG |
| Q180C-R | TGGCACAGAATACAGCCACACC |
| G194C-F | GGATGTGCAGTGCACCACCGGGCTG |
| G194C-R | CTGCACATCCGTCCGAACAGTG |
| D220C-F | GATAGATGAGTGTGGCACAACCGTAGCGACAAG |
| D220C-R | CTCATCTATCACGGCAACCTG |
The amino acid sequence of PGUS is as follows:
MLKPQQTTTRDLISLDGLWKFALASDDNNTQPWTSQLKTSLECPVPASYNDIFADSKIHDHVGWVYYQRDVIVPKGWSEERYLVRCEAATHHGRIYVNGNLVADHVGGYTPFEADITDLVAAGEQFRLTIAVDNELTYQTIPPGKVEILEATGKKVQTYQHDFYNYAGLARSVWLYSVPQQHIQDITVRTDVQGTTGLIDYNVVASTTQGTIQVAVIDEDGTTVATSSGSNGTIHIPSVHLWQPGAAYLYQLHASIIDSSKKTIDTYKLATGIRTVKVQGTQFLINDKPFYFTGFGKHEDTNIRGKGHDDAYMVHDFQLLHWMGANSFRTSHYPYAEEVMEYADRQGIVVIDETPAVGLAFSIGAGAQTSNPPATFSPDRINNKTREAHAQAIRELIHRDKNHPSVVMWSIANEPASNEDGAREYFAPLPKLARQLDPTRPVTFANVGLATYKADRIADLFDVLCLNRYFGWYTQTAELDEAEAALEEELRGWTEKYDKPIVMTEYGADTVAGLHSVMVTPWSEEFQVEMLDMYHRVFDRFEAMAGEQVWNFADFQTAVGVSRVDGNKKGVFTRDRKPKAAAHLLRKRWTNLHNGTAEGGKTFQ
(SEQ ID NO：1)
EXAMPLE 2 protein expression and purification
400mL of LB medium was added with 50. Mu.g/mL kanamycin at a final concentration, 1% of inoculation amount, cultured at 37℃for 5h until OD600 = 0.8, added with IPTG at a final concentration of 1mM, and induced overnight at 16℃for 16h. The cells were collected by centrifugation at 9000rpm, resuspended in 50mM PBS (pH 7.0,0.15M NaCl), broken at 1200bar under low temperature and ultra high pressure, the supernatant and the pellet were separated at 13000rpm, the pellet was discarded, and the supernatant was subjected to a 0.45 μm water film. Purified by AKTA system and HisTrap HP affinity column, loaded with 50mM PBS (pH 7.0,0.15M NaCl), eluted with 50mM PBS (pH 7.0,0.15M NaCl,200mM imidazole), and the target component protein was collected and desalted by Millipore (30 kDa) ultrafiltration tube.
Example 3 verification of Assembly and Structure
Crosslinking agent Mal 2 、Mal 4 The solution was dissolved in sterile deionized water to prepare a final concentration of 20mM, and diluted to 10mM and 1mM for ready use.
Mal was performed according to the concentration of protein measured by Nanodrop 2 、Mal 4 Mixing with protein (mutant) in a molar ratio of 1:2, the protein being in excess such that as much assembly as possible is formed between the cross-linker and the protein.
Reaction conditions: 50mM PBS buffer, pH7.0, reaction temperature 4℃and reaction time 10 hours.
Constructing to obtain N28C-Mal 2 、T34C-Mal 2 、N100C-Mal 2 、Q180C-Mal 2 、G194C-Mal 2 、D220C-Mal 2 、N28C-Mal 4 、T34C-Mal 4 、N100C-Mal 4 、Q180C-Mal 4 、G194C-Mal 4 、D220C-Mal 4 。
Wherein PGUS (PDB ID:5C 71) is used as a control group, PGUS is a homotetrameric structure composed of two symmetry planes, and the tetrameric interface of PGUS is formed by TIM barrel-shaped domains. ( The specific structure is as follows: bo Lv, et al Structure-guided engineering of the substrate specificity of a fungal beta-glucuronidase toward triterpenoid saponins [ J ]. Journal of Biological chemistry.2018;293 (2):433-443 )
(1) Native-PAGE results (10% concentration of seperate and 5% concentration of concentrate) as shown in FIGS. 1 and 2, using PGUS tetramer as a control, bands with slower migration rate than tetramer were observed for all assemblies, and the molecular weight of the bands was heterogeneous, indicating that all mutants were able to match Mal 2 、Mal 4 And (5) crosslinking and assembling.
(2) Gel filtration chromatography: purification and analysis were performed using a Superdex 200Increase 10/300GL (GE Healthcare) column using PBS buffer as eluent for gel filtration chromatography at a flow rate and detection wavelength of 0.65mL/min and 280nm, respectively.
FIG. 3 shows PGUS, G194C-Mal 2 And G194C-Mal 4 The retention time of the assembly of different assembly degrees of PGUS tetramer was 12min, G194C-Mal 2 Two distinct peaks can be observed for the assemblies, corresponding to the assembled and unassembled tetramers, respectively, with a retention time of about 8.5min for the assemblies. G194C-Mal 4 Two distinct peaks were also observed, with an assembly retention time of about 9min, with G194C-Mal 2 The retention time of the assembly is close. Assembly efficiency = S a /(S a +S f ) X 100, wherein S a Representing peak area of assembled enzyme, S f Representing the peak area of unassembled free enzyme. Comparing peak areas of the assemblies and tetramers can yield G194C-Mal 2 And G194C-Mal 4 The assembly efficiencies of (2) were 13.4% and 71.5%, respectively, so that four-arm crosslinker Mal was used 4 Is beneficial to improving the assembly efficiency.
Fig. 4 is a TEM image of PGUS free enzyme, and it can be seen from fig. 4 that PGUS is in a uniformly distributed free state.
FIG. 5 is G194C-Mal 2 TEM image of assembled enzyme, as can be seen from FIG. 5, G194C-Mal 2 The one-dimensional linear assembly structure is presented, so that the rigidity of the enzyme structure can be increased, and the activity loss caused by subunit dissociation is avoided, thereby improving the thermal stability.
FIG. 6 is G194C-Mal 4 TEM image of assembled enzyme. As can be seen from FIG. 6, G194C-Mal 4 Exhibits a one-dimensional linear and branched mixed structure, and is a four-arm crosslinking agent Mal 4 The added maleimide group can be crosslinked with a plurality of enzyme molecules, so that the assembly efficiency and the assembly molecular weight are improved, and the structural rigidity and the thermal stability of the assembled enzyme are further improved.
Example 4 enzyme activity assay
The reverse phase high performance chromatography establishes a quantitative determination bioconversion glycyrrhizic acid analysis method. The main parameters of the instrument are as follows: shimadzu LC-10A, chromatographic column: ASC Accurasil (4.6X105 mm,5 μm), detector: SPD-10AVP deuterium lamp detector, detection wavelength: 254nm, mobile phase A is methanol, mobile phase B is acetic acid solution of 6 per mill, and the sample injection amount is as follows: 10 μl, flow rate: 1mL/min, column incubator: 40 ℃, workstation: LCsolution. Beta-glucuronidase activity is defined as: each activity unit consumes 1nmol of glycyrrhizic acid per minute under the above conditions.
40. Mu.g of the assembled enzyme was added to 400. Mu.L of 2g/L glycyrrhizic acid solution prepared in 50mM pH 5.0 acetic acid-sodium acetate buffer. After reacting for 10min at 40 ℃, adding 1000 mu L of methanol, mixing uniformly, filtering by a 0.22 mu m water-based filter membrane, and detecting the content of the substrate glycyrrhizic acid and the product glycyrrhetinic acid by HPLC.
Fig. 7 shows the relative activities of mutant N28C, T34C, N100C, Q180C, G194C, D C and the corresponding assemblies. As can be seen from FIG. 7, the activity of both the mutant and the assembly is substantially improved relative to PGUS, e.g., G194C-Mal 4 The activity of (C) was increased by approximately 45% compared with PGUS, and it was found that Mal was used in the present invention 2 、Mal 4 The enzyme activity is not affected.
Example 5 thermal stability determination
400. Mu.L of the assembly enzyme at a concentration of 1mg/mL was incubated in a metal bath at 70℃and 5. Mu.L of the enzyme was added to 100. Mu.L of 1.25mM pNPG in 50mM pH 5.0 acetic acid-sodium acetate buffer at regular intervals. After 5min of reaction in a metal bath at 40 ℃, 200. Mu.L of 0.4M Na was added 2 CO 3 The reaction was terminated and absorbance of pNP at 405nm was measured by a microplate reader. The enzyme activity was measured by the pNPG method, and the residual enzyme activity at different incubation times was calculated with the enzyme activity at time zero as 100% reference, and was determined as the temperature stability of the beta-glucuronidase. 1 enzyme activity unit is defined as the amount of enzyme required to release 1. Mu. Mol of pNP under the above reaction conditions.
Upon incubation at 70 ℃, the residual activity of the assembly enzyme gradually decreased with incubation time, and FIG. 8 shows the assembly N28C-Mal 2 、T34C-Mal 2 、N100C-Mal 2 、Q180C-Mal 2 、G194C-Mal 2 、D220C-Mal 2 Thermal stability at 70 ℃. By passing throughFIG. 8 shows that free PGUS has a half-life of 43.2min, passing Mal 2 After assembly, N28C-Mal 2 、T34C-Mal 2 、Q180C-Mal 2 And G194C-Mal 2 After the heat treatment for more than 1 hour, the enzyme activity is almost not lost, and after the heat treatment time is prolonged, the result shows that more than 80% of enzyme activity is still available for four assemblies after the heat treatment for 2 hours, and the half lives of 155.2 minutes, 133.5 minutes, 169.2 minutes and 163.7 minutes are respectively obtained, so that the heat stability is improved by 2.6 times, 2.1 times, 2.9 times and 2.8 times compared with the free enzyme. N100C-Mal 2 And D220C-Mal 2 The thermal stability is also significantly improved, the half-life is 2.7 and 2.4 times that of the free PGUS, respectively.
FIG. 9 shows an assembly N28C-Mal 4 、T34C-Mal 4 、N100C-Mal 4 、Q180C-Mal 4 、G194C-Mal 4 、D220C-Mal 4 Thermal stability at 70 ℃. As can be seen from FIG. 9, via Mal 4 Post-assembly N28C-Mal 4 、Q180C-Mal 4 And G194C-Mal 4 The enzyme activity is almost not lost after the heat treatment for more than 2 hours, and the half lives of 158.7min, 198min and 200.8min are respectively obtained, and the heat stability is respectively improved by 2.67 times, 3.58 times and 3.65 times compared with the free enzyme. T34C-Mal 4 、N100C-Mal 4 And D220C-Mal 4 Thermal stability is also significantly improved, half-life is 2.6, 3.0 and 2.7 times that of free PGUS, respectively.
EXAMPLE 6 hydrolysis Process of catalytic glycyrrhizic acid
Catalytic glycyrrhizic acid conversion at 40 ℃): 70mL of 2g/L glycyrrhizic acid is placed on a heating magnetic stirrer to be heated in a water bath, so that the temperature is kept constant to 40 ℃. 8.51mL of the enzyme solution at a concentration of 2.35mg/mL was aspirated, diluted to 10mL with PBS buffer (50 mM PBS, 150mM NaCl), the whole enzyme solution was added to glycyrrhizic acid, 97. Mu.L was sampled at regular intervals, and the reaction was stopped with 3. Mu.L of 1M NaOH. Adding 0.14g glycyrrhizic acid at 40min, 140min, 240 min. 1mL of methanol was added to the reaction-terminated system, and after shaking, the mixture was subjected to an organic filter membrane of 0.22. Mu.m, and the amounts of GAMG and GA were measured by HPLC.
Catalytic glycyrrhizic acid conversion at 50 ℃): 70mL of 2g/L glycyrrhizic acid is placed on a heating magnetic stirrer to be heated in a water bath, so that the temperature is kept constant to 50 ℃. 8.51mL of the enzyme solution at a concentration of 2.35mg/mL was aspirated, diluted to 10mL with PBS buffer (50 mM PBS, 150mM NaCl), the whole enzyme solution was added to glycyrrhizic acid, 97. Mu.L was sampled at regular intervals, and the reaction was stopped with 3. Mu.L of 1M NaOH. Adding 0.14g glycyrrhizic acid at 40min, 140min, 240 min. 1mL of methanol is added into a reaction terminating system, the mixture is uniformly shaken and then is subjected to sample preparation through a 0.22 mu m organic filter membrane, and the contents of a substrate glycyrrhizic acid and a product glycyrrhetinic acid are detected by HPLC.
Glycyrrhizic acid conversion= (S 0 -S t )/S t X 100, wherein S 0 Represents the total glycyrrhizic acid concentration provided, S t Represents the glycyrrhizic acid concentration at time t. Glycyrrhetinic acid yield = S GA /S GL X 100, wherein S GA And S is GL Representing the molar concentrations of glycyrrhetinic acid and glycyrrhizic acid, respectively.
FIG. 10 shows the assembly G194C-Mal at various temperatures 2 、G194C-Mal 4 And PGUS catalyzes the change in glycyrrhetinic acid concentration of glycyrrhizic acid conversion. As can be seen from FIG. 10, the concentration of glycyrrhetinic acid of PGUS hardly increased after 80min at a reaction temperature of 40℃and G194C-Mal 2 And G194C-Mal 4 Still shows higher catalytic activity after 140 min. G194C-Mal 2 The final glycyrrhetinic acid concentration is 2.24G/L, G194C-Mal 4 The final glycyrrhetinic acid concentration was 1.9g/L. When the reaction temperature is 50 ℃, the PGUS has lower stability, the concentration of the glycyrrhetinic acid is hardly increased after 10 minutes, and the concentration of the glycyrrhetinic acid finally obtained is 0.25g/L. And G194C-Mal 4 Shows high catalytic activity and stability at 50 ℃, and the yield of glycyrrhetinic acid increases slowly after 80min, and the final concentration of the glycyrrhetinic acid is 1.1g/L.
FIG. 11 shows the assembly G194C-Mal at various temperatures 2 、G194C-Mal 4 And PGUS catalyzes the conversion change of glycyrrhizic acid. As can be seen from FIG. 11, PGUS (40 ℃ C.), G194C-Mal 2 (40℃)、G194C-Mal 4 (40℃)、G194C-Mal 4 The change of the glycyrrhizic acid conversion rate is basically consistent within 140 minutes at the beginning (50 ℃), the glycyrrhizic acid conversion rate is kept at about 60% in 10-40 minutes, and the glycyrrhizic acid conversion rate is kept at about 80% in 60-140 minutes. With the addition of more to the reaction systemThe conversion of PGUS (40 ℃) gradually decreases, possibly with a decrease in stability. While G194C-Mal at different temperatures 2 And G194C-Mal 4 Higher conversion is still maintained at higher glycyrrhizic acid concentrations. PGUS was substantially inactivated at 50 ℃.
FIG. 12 shows the assembly G194C-Mal at various temperatures 2 、G194C-Mal 4 And PGUS catalyzes changes in glycyrrhizic acid yield from glycyrrhizic acid conversion. As can be seen from FIG. 12, 0-40min, PGUS (40 ℃ C.), G194C-Mal 2 (40℃)、G194C-Mal 4 (40℃)、G194C-Mal 4 The yield of glycyrrhetinic acid (50 ℃) is close to that of G194C-Mal after 40min 2 (40℃)、G194C-Mal 4 The yield of glycyrrhetinic acid (40 ℃) was maintained at about 60%, and after 260min the yield of glycyrrhetinic acid could be significantly increased. Whereas the yield of glycyrrhizic acid from PGUS (40 ℃) stabilized at 40%, the yield of glycyrrhetinic acid gradually decreased after 140 min.
For purposes of this disclosure, the terms "one embodiment," "some embodiments," "example," "a particular example," or "some examples," etc., mean that a particular feature, structure, material, or characteristic described in connection with the embodiment or example is included in at least one embodiment or example of the invention. In this specification, schematic representations of the above terms are not necessarily directed to the same embodiment or example. Furthermore, the particular features, structures, materials, or characteristics described may be combined in any suitable manner in any one or more embodiments or examples. Furthermore, the different embodiments or examples described in this specification and the features of the different embodiments or examples may be combined and combined by those skilled in the art without contradiction.
While embodiments of the present invention have been shown and described above, it will be understood that the above embodiments are illustrative and not to be construed as limiting the invention, and that variations, modifications, alternatives and variations may be made to the above embodiments by one of ordinary skill in the art within the scope of the invention.
Claims (10)
1. A method of driving enzyme assembly with polyethylene glycol maleimide derivatives, the method comprising: crosslinking polyethylene glycol maleimide derivative with enzyme to obtain enzyme assembly; wherein:
the enzyme consists of SEQ ID NO:1, wherein the single mutation is a substitution with a cysteine residue;
the polyethylene glycol maleimide derivative contains at least two maleimide terminal groups.
2. A method of driving enzyme assembly with polyethylene glycol maleimide derivatives according to claim 1, wherein the single mutation is any of the following:
(1) Asparagine at position 28 is mutated to cysteine;
(2) Threonine at position 34 is mutated to cysteine;
(3) Asparagine at position 100 is mutated to cysteine;
(4) Glutamine at position 180 is mutated to cysteine;
(5) Glycine at position 194 is mutated to cysteine;
(6) Aspartic acid at position 220 is mutated to cysteine.
3. A method of driving enzyme assembly with polyethylene glycol maleimide derivatives according to claim 2, wherein the single mutation is any of the following:
mutation of asparagine at position 28 to cysteine, or
The glycine at position 194 is mutated to cysteine, or
Glutamine at position 180 is mutated to cysteine.
4. The method of driving enzyme assembly with polyethylene glycol maleimide derivatives according to claim 1, wherein the polyethylene glycol maleimide derivatives have the structural formula: PEG-X-MAL; wherein,,
PEG is polyethylene glycol residue, MAL is maleimide group;
x is the connection of PEG and MALA linker selected from: - (CH) 2 ) r -、-(CH 2 ) r O-、-(CH 2 ) r CO-、-(CH 2 ) r NH-、-(CH 2 ) r CONH-、-(CH 2 ) r NHCO-、-(CH 2 ) r S-、-(CH 2 ) r COO-and- (CH) 2 ) r One or more than two of OCO-, r is an integer of 0-10; preferably, r is an integer from 0 to 5.
5. A method of driving enzyme assembly with a polyethylene glycol maleimide derivative according to any of claims 1-4, wherein said polyethylene glycol maleimide derivative is a double arm polyethylene glycol maleimide, or a four arm polyethylene glycol maleimide; preferably a four-arm polyethylene glycol maleimide.
6. The method of driving enzyme assembly with polyethylene glycol maleimide derivatives according to claim 5, wherein the polyethylene glycol maleimide derivatives have a molecular weight of 2000-3400Da.
7. The method of driving enzyme assembly with polyethylene glycol maleimide derivatives according to claim 5, wherein the molar ratio of polyethylene glycol maleimide derivatives to enzyme is 1 (1.5-2.5), preferably the molar ratio is 1:2.
8. the method of driving enzyme assembly with polyethylene glycol maleimide derivatives according to claim 5, wherein the crosslinking conditions are: the pH value is 6.8-7.4, the reaction temperature is 0-10 ℃, and the reaction time is 2-12 hours.
9. An enzyme assembly prepared by the method of any one of claims 1-8.
10. Use of the enzyme assembly of claim 9 for converting glycyrrhizic acid to glycyrrhetinic acid.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202210982067.4A CN116334057B (en) | 2022-08-16 | 2022-08-16 | Enzyme assembly constructed by polyethylene glycol maleimide derivative, and preparation method and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202210982067.4A CN116334057B (en) | 2022-08-16 | 2022-08-16 | Enzyme assembly constructed by polyethylene glycol maleimide derivative, and preparation method and application thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN116334057A true CN116334057A (en) | 2023-06-27 |
| CN116334057B CN116334057B (en) | 2024-07-19 |
Family
ID=86890352
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202210982067.4A Active CN116334057B (en) | 2022-08-16 | 2022-08-16 | Enzyme assembly constructed by polyethylene glycol maleimide derivative, and preparation method and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN116334057B (en) |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1912115A (en) * | 2005-08-11 | 2007-02-14 | 上海医药工业研究院 | Venomous snake thrombin sample enzyme modified by polyethylene glycol |
| US20080200657A1 (en) * | 2005-07-20 | 2008-08-21 | Mogam Biotechnology Research Institute | Mutant of Granulocyte-Colony Stimulating Factor (G-Csf) and Chemically Conjugated Polypeptide Thereof |
| CN103184209A (en) * | 2011-12-27 | 2013-07-03 | 拜奥生物科技（上海）有限公司 | Homosapiensarginase and pegylation homosapiensarginase as well as applications thereof |
| CN103626831A (en) * | 2012-08-22 | 2014-03-12 | 中国科学院过程工程研究所 | Method used for selective modification of protein carbon terminal carboxyl groups with polyethylene glycol |
| CN104894091A (en) * | 2015-06-19 | 2015-09-09 | 北京理工大学 | Method of improving enzymatic thermostability via artificially designed glycosylation modification |
| CN108410839A (en) * | 2018-01-24 | 2018-08-17 | 北京理工大学 | A kind of beta-glucuronidase enzyme mutant that thermal stability improves |
| US20180282707A1 (en) * | 2015-09-29 | 2018-10-04 | Shanghai Institute Of Biological Products Co., Ltd. | Mutant-type uricase, peg modified mutant-type uricase, and application thereof |
-
2022
- 2022-08-16 CN CN202210982067.4A patent/CN116334057B/en active Active
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080200657A1 (en) * | 2005-07-20 | 2008-08-21 | Mogam Biotechnology Research Institute | Mutant of Granulocyte-Colony Stimulating Factor (G-Csf) and Chemically Conjugated Polypeptide Thereof |
| CN1912115A (en) * | 2005-08-11 | 2007-02-14 | 上海医药工业研究院 | Venomous snake thrombin sample enzyme modified by polyethylene glycol |
| CN103184209A (en) * | 2011-12-27 | 2013-07-03 | 拜奥生物科技（上海）有限公司 | Homosapiensarginase and pegylation homosapiensarginase as well as applications thereof |
| CN103626831A (en) * | 2012-08-22 | 2014-03-12 | 中国科学院过程工程研究所 | Method used for selective modification of protein carbon terminal carboxyl groups with polyethylene glycol |
| CN104894091A (en) * | 2015-06-19 | 2015-09-09 | 北京理工大学 | Method of improving enzymatic thermostability via artificially designed glycosylation modification |
| US20180282707A1 (en) * | 2015-09-29 | 2018-10-04 | Shanghai Institute Of Biological Products Co., Ltd. | Mutant-type uricase, peg modified mutant-type uricase, and application thereof |
| CN108410839A (en) * | 2018-01-24 | 2018-08-17 | 北京理工大学 | A kind of beta-glucuronidase enzyme mutant that thermal stability improves |
Non-Patent Citations (3)
| Title |
|---|
| QIBIN WANG等: "Site‐specific crosslinking and assembly of tetrameric β‐glucuronidase improve glycyrrhizin hydrolysis", 《BIOTECHNOL BIOENG.》, vol. 120, no. 12, 14 September 2023 (2023-09-14), pages 3570 * |
| 卢鼎元等: "计算模拟在蛋白组装研究中的应用", 《中国生物工程杂志》, vol. 43, no. 7, 9 March 2023 (2023-03-09), pages 60 - 76 * |
| 矫丽媛;吕波;王金娜;李春;: "重组β-葡萄糖醛酸苷酶转化甘草酸的定向性改造", 石河子大学学报(自然科学版), no. 05, 15 October 2013 (2013-10-15), pages 640 - 644 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN116334057B (en) | 2024-07-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| KR101891455B1 (en) | Soluble intein fusion proteins and methods for purifying biomolecules | |
| CN110343689B (en) | Streptomyces trypsin GM2938 and heterologous expression thereof in bacillus subtilis | |
| CN109613240B (en) | Kit for detecting HIV | |
| EP2970953B1 (en) | Improved surface display of functional proteins in a broad range of gram negative bacteria | |
| CN116334057B (en) | Enzyme assembly constructed by polyethylene glycol maleimide derivative, and preparation method and application thereof | |
| Carlsson et al. | Affinity precipitation and site‐specific immobilization of proteins carrying polyhistidine tails | |
| CN106520733B (en) | Beta-xylosidase enzyme aggregate and preparation method thereof | |
| CN116355872B (en) | Galactose oxidase mutant GAO-5F/AR, plasmid, recombinant bacterium and application thereof | |
| CN108048494A (en) | A kind of method using biological enzymatic synthesis 1,3- propylene glycol | |
| CN112481320B (en) | Method for preparing (-) gamma-lactam with high catalytic efficiency | |
| CN112941123A (en) | Method for biologically synthesizing droxidopa based on L-threonine aldolase | |
| CN106636019B (en) | High-efficiency catalytic synthesis of (S) -phenyl glycol by using (S) -carbonyl reductase oligomer mediated by Sortase A | |
| CN112442474B (en) | Preparation method of (-) gamma-lactam | |
| CN1204257C (en) | New peptide fragments for protein purification | |
| KR102693635B1 (en) | Method for synthesizing a biocatalyst of formaldehyde using a multi-enzyme-catalyzed fusion protein scaffold and its use | |
| Gao et al. | Preparation of novel magnetic cellulose microspheres via cellulose binding domain–streptavidin linkage and use for mRNA isolation from eukaryotic cells and tissues | |
| JP5284804B2 (en) | New expression vector | |
| JP5724194B2 (en) | Mutant reductase | |
| CN116286766A (en) | T4 phage capsid-based L-threonine aldolase immobilization and recyclable biocatalysis method | |
| CN117701609A (en) | Protein molecular weight standard reference substance and preparation method thereof | |
| US20220002353A1 (en) | Dextran affinity tag and use thereof | |
| CN117925564A (en) | 3-Acetyl vomitoxin hydrolase and application thereof | |
| CN116286902A (en) | Recombinant cholesterol esterase and preparation method thereof | |
| CN116396949A (en) | Fusion protein with double PET hydrolase activity and method for degrading PET | |
| CN116042588A (en) | Preparation method and application of recombinant creatine enzyme |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant |