CN116333163A - Recombinant fusion protein and application thereof - Google Patents
Recombinant fusion protein and application thereof Download PDFInfo
- Publication number
- CN116333163A CN116333163A CN202211202216.7A CN202211202216A CN116333163A CN 116333163 A CN116333163 A CN 116333163A CN 202211202216 A CN202211202216 A CN 202211202216A CN 116333163 A CN116333163 A CN 116333163A
- Authority
- CN
- China
- Prior art keywords
- unit
- fusion protein
- enzyme
- recombinant fusion
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 title claims abstract description 57
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 title claims abstract description 57
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 60
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 46
- 230000004044 response Effects 0.000 claims abstract description 46
- 102000004190 Enzymes Human genes 0.000 claims abstract description 30
- 108090000790 Enzymes Proteins 0.000 claims abstract description 30
- 241000235058 Komagataella pastoris Species 0.000 claims abstract description 15
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 claims abstract description 15
- 230000008685 targeting Effects 0.000 claims abstract description 15
- 238000002360 preparation method Methods 0.000 claims abstract description 11
- 108091006047 fluorescent proteins Proteins 0.000 claims abstract description 8
- 102000034287 fluorescent proteins Human genes 0.000 claims abstract description 8
- 235000018102 proteins Nutrition 0.000 claims description 35
- 239000013604 expression vector Substances 0.000 claims description 27
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerol Natural products OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 claims description 20
- OKKJLVBELUTLKV-UHFFFAOYSA-N methanol Natural products OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 claims description 20
- 108091008146 restriction endonucleases Proteins 0.000 claims description 20
- 108010051815 Glutamyl endopeptidase Proteins 0.000 claims description 18
- 238000012216 screening Methods 0.000 claims description 18
- 239000003910 polypeptide antibiotic agent Substances 0.000 claims description 16
- 238000003776 cleavage reaction Methods 0.000 claims description 15
- 230000007017 scission Effects 0.000 claims description 15
- 241000270295 Serpentes Species 0.000 claims description 14
- 239000000872 buffer Substances 0.000 claims description 14
- 239000008103 glucose Substances 0.000 claims description 12
- 239000001963 growth medium Substances 0.000 claims description 12
- 235000014304 histidine Nutrition 0.000 claims description 12
- 102000012410 DNA Ligases Human genes 0.000 claims description 11
- 108010061982 DNA Ligases Proteins 0.000 claims description 11
- 230000004048 modification Effects 0.000 claims description 11
- 238000012986 modification Methods 0.000 claims description 11
- 238000000034 method Methods 0.000 claims description 9
- 150000007523 nucleic acids Chemical class 0.000 claims description 9
- 230000004988 N-glycosylation Effects 0.000 claims description 8
- 108091005804 Peptidases Proteins 0.000 claims description 8
- -1 glycerol compound Chemical class 0.000 claims description 8
- 108020004707 nucleic acids Proteins 0.000 claims description 8
- 102000039446 nucleic acids Human genes 0.000 claims description 8
- 102000030431 Asparaginyl endopeptidase Human genes 0.000 claims description 7
- 102000000541 Defensins Human genes 0.000 claims description 7
- 108010002069 Defensins Proteins 0.000 claims description 7
- 239000004365 Protease Substances 0.000 claims description 7
- 108010055066 asparaginylendopeptidase Proteins 0.000 claims description 7
- 230000002538 fungal effect Effects 0.000 claims description 7
- 239000005090 green fluorescent protein Substances 0.000 claims description 7
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 claims description 6
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 claims description 6
- 108010043121 Green Fluorescent Proteins Proteins 0.000 claims description 6
- 102000004144 Green Fluorescent Proteins Human genes 0.000 claims description 6
- 240000004808 Saccharomyces cerevisiae Species 0.000 claims description 6
- 238000012258 culturing Methods 0.000 claims description 6
- 239000012634 fragment Substances 0.000 claims description 6
- 239000013600 plasmid vector Substances 0.000 claims description 6
- 206010003645 Atopy Diseases 0.000 claims description 5
- 102000013382 Gelatinases Human genes 0.000 claims description 5
- 108010026132 Gelatinases Proteins 0.000 claims description 5
- 239000002773 nucleotide Substances 0.000 claims description 5
- 125000003729 nucleotide group Chemical group 0.000 claims description 5
- 241000235648 Pichia Species 0.000 claims description 4
- 108010048367 enhanced green fluorescent protein Proteins 0.000 claims description 4
- 239000008194 pharmaceutical composition Substances 0.000 claims description 4
- 102000004225 Cathepsin B Human genes 0.000 claims description 3
- 108090000712 Cathepsin B Proteins 0.000 claims description 3
- 230000001939 inductive effect Effects 0.000 claims description 3
- 230000004989 O-glycosylation Effects 0.000 claims description 2
- 229940124350 antibacterial drug Drugs 0.000 claims description 2
- 239000003937 drug carrier Substances 0.000 claims description 2
- 230000003176 fibrotic effect Effects 0.000 claims description 2
- 230000013595 glycosylation Effects 0.000 claims description 2
- 238000006206 glycosylation reaction Methods 0.000 claims description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 2
- 108010054624 red fluorescent protein Proteins 0.000 claims description 2
- 238000001890 transfection Methods 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 5
- 101100460704 Aspergillus sp. (strain MF297-2) notI gene Proteins 0.000 claims 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 claims 1
- 230000001954 sterilising effect Effects 0.000 abstract description 12
- 230000000694 effects Effects 0.000 abstract description 10
- 238000001338 self-assembly Methods 0.000 abstract description 8
- 230000014759 maintenance of location Effects 0.000 abstract description 7
- 238000004659 sterilization and disinfection Methods 0.000 abstract description 7
- 239000003814 drug Substances 0.000 abstract description 5
- 230000004927 fusion Effects 0.000 abstract description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 18
- 230000006870 function Effects 0.000 description 17
- 239000000243 solution Substances 0.000 description 15
- 241000191967 Staphylococcus aureus Species 0.000 description 13
- 210000004027 cell Anatomy 0.000 description 13
- 150000001413 amino acids Chemical group 0.000 description 10
- 108091028043 Nucleic acid sequence Proteins 0.000 description 9
- 238000003780 insertion Methods 0.000 description 9
- 230000037431 insertion Effects 0.000 description 9
- 238000001556 precipitation Methods 0.000 description 9
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 8
- 230000005540 biological transmission Effects 0.000 description 8
- 102000035195 Peptidases Human genes 0.000 description 7
- 230000000844 anti-bacterial effect Effects 0.000 description 7
- 238000000855 fermentation Methods 0.000 description 7
- 230000004151 fermentation Effects 0.000 description 7
- 230000005764 inhibitory process Effects 0.000 description 7
- 241001506991 Komagataella phaffii GS115 Species 0.000 description 6
- 239000012154 double-distilled water Substances 0.000 description 6
- 108090000765 processed proteins & peptides Proteins 0.000 description 6
- 239000000047 product Substances 0.000 description 6
- 239000002904 solvent Substances 0.000 description 6
- 101000702488 Rattus norvegicus High affinity cationic amino acid transporter 1 Proteins 0.000 description 5
- 238000005119 centrifugation Methods 0.000 description 5
- 238000013461 design Methods 0.000 description 5
- 102000004196 processed proteins & peptides Human genes 0.000 description 5
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 5
- 244000153158 Ammi visnaga Species 0.000 description 4
- 235000010585 Ammi visnaga Nutrition 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- 239000011324 bead Substances 0.000 description 4
- 238000007865 diluting Methods 0.000 description 4
- 238000001976 enzyme digestion Methods 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 229910052759 nickel Inorganic materials 0.000 description 4
- 238000005457 optimization Methods 0.000 description 4
- 102000044503 Antimicrobial Peptides Human genes 0.000 description 3
- 108700042778 Antimicrobial Peptides Proteins 0.000 description 3
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 3
- 206010028980 Neoplasm Diseases 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 229910052802 copper Inorganic materials 0.000 description 3
- 239000010949 copper Substances 0.000 description 3
- 238000005520 cutting process Methods 0.000 description 3
- 238000010586 diagram Methods 0.000 description 3
- 238000004043 dyeing Methods 0.000 description 3
- 239000000835 fiber Substances 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 239000001888 Peptone Substances 0.000 description 2
- 108010080698 Peptones Proteins 0.000 description 2
- 235000001014 amino acid Nutrition 0.000 description 2
- 230000003698 anagen phase Effects 0.000 description 2
- 229940041514 candida albicans extract Drugs 0.000 description 2
- 102000014509 cathelicidin Human genes 0.000 description 2
- 108060001132 cathelicidin Proteins 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 238000011065 in-situ storage Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 238000001000 micrograph Methods 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 235000019319 peptone Nutrition 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 2
- 238000012795 verification Methods 0.000 description 2
- 239000012138 yeast extract Substances 0.000 description 2
- 241000972773 Aulopiformes Species 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- POIUWJQBRNEFGX-XAMSXPGMSA-N cathelicidin Chemical compound C([C@@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(C)C)C1=CC=CC=C1 POIUWJQBRNEFGX-XAMSXPGMSA-N 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000009851 immunogenic response Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 239000011259 mixed solution Substances 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- 229910000160 potassium phosphate Inorganic materials 0.000 description 1
- 239000008057 potassium phosphate buffer Substances 0.000 description 1
- 235000011009 potassium phosphates Nutrition 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 239000012474 protein marker Substances 0.000 description 1
- 238000002407 reforming Methods 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 238000005556 structure-activity relationship Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4723—Cationic antimicrobial peptides, e.g. defensins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/80—Vectors or expression systems specially adapted for eukaryotic hosts for fungi
- C12N15/81—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts
- C12N15/815—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts for yeasts other than Saccharomyces
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/60—Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/735—Fusion polypeptide containing domain for protein-protein interaction containing a domain for self-assembly, e.g. a viral coat protein (includes phage display)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/90—Fusion polypeptide containing a motif for post-translational modification
- C07K2319/91—Fusion polypeptide containing a motif for post-translational modification containing a motif for glycosylation
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/645—Fungi ; Processes using fungi
- C12R2001/84—Pichia
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Biophysics (AREA)
- Veterinary Medicine (AREA)
- Biochemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Toxicology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Gastroenterology & Hepatology (AREA)
- General Chemical & Material Sciences (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Mycology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Physics & Mathematics (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention provides a recombinant fusion protein and application thereof. The recombinant fusion protein comprises a fluorescent protein, a histidine unit, an enzyme response unit, a functional unit, an assembly unit and a targeting unit. The recombinant fusion protein can realize various effects of enzyme-collecting response, self-assembly, long-acting retention, sterilization, fluorescent tracing and the like under the condition that specific enzyme exists. The recombinant fusion protein adopts pichia pastoris expression, can realize the high-efficiency expression of target proteins and realize the fusion of various proteins. The preparation method of the recombinant fusion protein is economical and efficient, simple in preparation process and powerful in product function, and has extremely high potential and application prospect in the nano medicine industry.
Description
Technical Field
The invention belongs to the field of biological nano pharmacy, and particularly relates to a recombinant fusion protein and application thereof.
Background
In-situ self-assembly in organisms realized by assembly-induced aggregation effect has been greatly developed in the aspect of aiming at various serious diseases such as tumors, infections and the like. By designing molecules, the enrichment of nano-drugs is realized by utilizing a specific target spot at a focus position, and the molecular change and the induced assembly behavior are realized by the specific pH and enzyme environment at the focus position. The multivalent bond reaction of the assembly action can enhance the biological activity of the functional part, and the assembled large-volume assembly can realize long-time retention in organism tissues and even cells.
The size, toxicity, etc. of nanomolecular molecules have been the area of greatest concern to related researchers. On one hand, the size of the nanometer molecules and the assembly strictly limit the clearance of the assembly in long circulation and the enrichment and permeation of the assembly at focus parts; on the other hand, the functional units of the nano molecules tend to kill tumors, bacteria and normal tissue cells of the organism indiscriminately.
In vivo, proteins have a strict three-dimensional conformation and perform different functions in vivo. But for a defined protein, there are functional domains and the necessary structures for the functional domains to form a three-dimensional structure, as well as some variable sequences. These variable sequences do not affect the establishment of the three-dimensional structure of the functional protein domain in terms of structure-activity relationship. Thus, the first and second substrates are bonded together, can become ideal reforming matrix of nanometer molecules.
On the one hand, the protein comes from the homologous transformation of the organism, has no specific immunogenic reaction, and on the other hand, the functional fragment inserted into the protein can take the protein as a self protection arm, so that the protein is prevented from being hydrolyzed by nonspecific protease and the organism is prevented from being attacked by the functional unit. After the target site is reached through active or passive targeting, specific enzyme digestion can be realized due to the specific existence of specific enzymes at the focus site, and the release of the functional sequence can be realized. Thereby realizing various effects such as enzyme-collecting response, self-assembly, long-acting retention, sterilization, fluorescent tracing and the like.
The synthesis of the protein is not feasible through a chemical method, so that the biological fermentation method is more convenient and efficient. In biological fermentation, it is necessary to design and synthesize a target protein that realizes various functions by biological expression from a nucleic acid sequence. Therefore, the fusion protein capable of in-situ self-assembly in organisms and the biological fermentation method thereof are provided, and the fusion protein has important application value in the aspects of various important diseases such as tumors, infections and the like.
Disclosure of Invention
Aiming at the defects of the prior art, the invention aims to provide a recombinant fusion protein and application thereof. The recombinant fusion protein can realize various effects of enzyme-collecting response, self-assembly, long-acting retention, sterilization, fluorescent tracing and the like under the condition that specific enzyme exists. The recombinant fusion protein adopts pichia pastoris expression, can realize the high-efficiency expression of target proteins and realize the fusion of various proteins. The preparation method of the recombinant fusion protein is economical and efficient, simple in preparation process and powerful in product function, and has extremely high potential and application prospect in the nano medicine industry.
In order to achieve the aim of the invention, the invention adopts the following technical scheme:
in a first aspect, the invention provides a recombinant fusion protein comprising a fluorescent protein, a histidine unit, an enzyme response unit, a functional unit, an assembly unit and a targeting unit.
In the invention, the recombinant fusion protein can realize various effects of enzyme-collecting response, self-assembly, long-acting retention, sterilization, fluorescent tracing and the like under the condition that specific enzyme exists.
Preferably, the fluorescent protein comprises a green fluorescent protein, a red fluorescent protein or a enhanced green fluorescent protein.
In the invention, the structural schematic diagram of the green fluorescent protein of the recombinant protein parent body is shown in figure 1, the green fluorescent protein is subjected to cleavage and sequence insertion, the cleavage and insertion positions are a connecting ring 2, a connecting ring 4, a connecting ring 9, a sheet 5, a sheet 6 and an internal spiral, and the cleavage and insertion positions are preferably the connecting ring 9.
Preferably, the histidine unit comprises 3-10 histidines, which may be for example 3, 4, 5, 6, 7, 8, 9 or 10.
Preferably, the enzyme response unit is a protease cleavage sequence of an atopic enzyme comprising any one or a combination of at least two of gelatinase, legumain, V8 protease or cathepsin B.
Preferably, the atopic enzyme is a V8 protease, and the cleavage site of the V8 protease comprises FGL/F, FAL/F, FEL/F, FEL/F, FG/LF, FG/LD, F/GLP, WG/LF or FEL/F.
In the present invention, the enzyme response unit is specifically designed for intracellular infection of staphylococcus aureus, and because staphylococcus aureus must secrete some protease in the cell and in the intracellular survival. Whereas V8 protease is one of them, a specific enzyme response can be achieved. And gelatinase, legumain or cathepsin B is an enzyme which can be highly expressed at focus sites, and can also realize specific enzyme response.
Preferably, the functional unit is a protein sequence that performs a primary function, the functional unit comprising a cobra antibacterial peptide, an engineered cobra antibacterial peptide, or a fungal defensin.
In the invention, the functional units are protein sequences for realizing main functions, and the protein sequences comprise, but are not limited to, cobra antibacterial peptide Ohcat-30, modified cobra antibacterial peptide Ohcat-20, fungal defensin Scedosporisin and partial homologous peptides and derivative peptides thereof.
In the invention, the functional unit is cathelicidin family antibacterial peptide, and cathelicidin is the general term of endogenous antibacterial peptide contained in various animals. These antimicrobial peptides have a high degree of structural homology and are similarly useful in performing their functions. They also have a broad-spectrum antimicrobial function against G+, G-and fungi. And has different antibacterial activities for different microorganisms due to slight differences in sequence and structure. In particular cases it is desirable to select specific antimicrobial peptides for specific microorganisms.
Preferably, the amino acid sequence of the cobra antibacterial peptide is selected from any one of SEQ ID NO. 1-3.
In the present invention, the protein sequence of the cobra antimicrobial peptide Ohcath-30 and its partially homologous and derived peptides include, but are not limited to:
SEQ ID NO.1：OHcath-30：KFFKKLKNSVKKRAKKFFKKPRVIGVSIPF。
SEQ ID NO.2：OHcath-30：KLLKKLKNSVKKRAKKFFKKPRVIGVSIPF。
SEQ ID NO.3：OHcath-30：KFFKKLKNSVKKRAKKLLKKPRVIGVSIPF。
preferably, the amino acid sequence of the engineered cobra antibacterial peptide is selected from any one of SEQ ID NO. 4-6.
In the present invention, the modified cobra antibacterial peptide Ohcath-20 protein sequence and its partial homologous peptide and derivative peptides include but are not limited to:
SEQ ID NO.4：OHcath-20：KKRAKKFFKKPRVIGVSIPF。
SEQ ID NO.5：OHcath-20：KKRAKKFFKKPRVIGVSIPF。
SEQ ID NO.6：OHcath-20：KKRAKKLLRRPRVIGVSIPF。
preferably, the amino acid sequence of the fungal defensin is selected from any one of SEQ ID NO. 7-11.
In the present invention, the protein sequence of the fungal defensin scandosporin and its partially homologous and derived peptides include, but are not limited to:
SEQ ID NO.7：Scedosporisin1：
GFGCPGSEKKCHNHCKSVKGYKGCYCDGPYCPFVGRPRCKCY。
SEQ ID NO.8：Scedosporisin2：
GFGCPGNEKKCHNHCKSVKGYKGCYCDGPYCPFVGRPRCKCY。
SEQ ID NO.9：Scedosporisin3：
GFGCPGSEKKCHNHCKSVKGYKGCYCDGPYCPFVGRPRCKCY。
SEQ ID NO.10：Scedosporisin4：
GFGCPGNEKKCHNHCKGVKGYKGCYCDGPYCPFVGRPRCKCY。
SEQ ID NO.11：Scedosporisin5：
GFGCPGSEKKCHNHCKTIKGYKGCYCDGPYCPFVGRPRCKCY。
preferably, the assembly unit is an important fibrotic assembly fragment of the Alzheimer's related protein A.beta.42, and the amino acid sequence of the assembly unit comprises KKVVFFEED (SEQ ID NO. 12), KKLVFFAED (SEQ ID NO. 13), KKLLFFAAD (SEQ ID NO. 14) or KLLVVAADD (SEQ ID NO. 15).
In the invention, the assembly unit can form a beta-sheet structure, the central hydrophobic part stabilizes the beta-sheet structure, and the two ends are respectively provided with positively charged side chain amino acid and negatively charged side chain amino acid, so that an anti-parallel beta-sheet structure can be formed.
Preferably, the targeting unit is a pichia pastoris glycosylation sequence, and the targeting unit comprises a high mannose N-glycosylation modification sequence, a low mannose N-glycosylation modification sequence, a complex N-glycosylation modification sequence, or an O-glycosylation modification sequence.
Preferably, the targeting unit is a high mannose N-glycosylation modification sequence, the amino acid sequence of which comprises DAS, NFS, NTS, NAS, NAT or TAA.
In the invention, the targeting unit can form hyperglycosylation modification in the expression process, thereby achieving the function of targeting phagocytes, especially macrophages, and achieving the purpose of treatment.
Preferably, the recombinant fusion protein is assembled in a manner comprising:
(1) 10 histidine-enzyme response unit-targeting unit-functional unit-enzyme response unit-assembly unit-targeting unit-10 histidines;
(2) 3 histidine-targeting units-assembly units-enzyme response units-functional units-enzyme response units-3 histidine-targeting units;
(3) 6 histidine-targeting unit-enzyme response unit-assembly unit-functional unit-enzyme response unit-targeting unit-6 histidines;
(4) Assembling unit-6 histidine-targeting unit-enzyme response unit-functional unit-enzyme response unit-targeting unit-6 histidine;
or (5) 3 histidine-targeting unit-enzyme response unit-targeting unit-functional unit-assembly unit-enzyme response unit-10 histidines.
In the invention, the assembly mode is designed to be 'centrosymmetric', and the assembly mode gradually plays a role from the outer side to the core according to the sequence of entering the body and the cell and the sequence of acting, thus being a reasonable design on space and time sequence.
In the invention, the designed protein sequence is reversely translated into a DNA sequence, and after the codon optimization of Pichia pastoris, the DNA sequence is chemically synthesized.
In a second aspect, the invention provides a nucleic acid molecule encoding the recombinant fusion protein of the first aspect.
Preferably, the nucleotide sequence of the nucleic acid molecule is selected from any one of SEQ ID NOS.16-18.
In a third aspect, the present invention provides an expression vector comprising a nucleic acid molecule according to the second aspect and which is capable of allowing, after transfection of a host cell, the transfected host cell to express a recombinant fusion protein according to the first aspect.
Preferably, the host cell comprises pichia pastoris, the pichia phenotype comprises GS115, SMD1168H or KM71, preferably GS115.
In the present invention, two transformants His+mut+ and His+muts can be produced after transformation of GS115. Both recombinants mut+ and Muts are useful because one phenotype may be more favorable for protein expression than the other phenotype.
Preferably, the expression vector is a pichia expression vector comprising pPIC9K, ppic3.5k or ppiczαa, preferably pPIC9K.
In a fourth aspect, the present invention provides a recombinant cell comprising the expression vector of the third aspect, or having the nucleic acid molecule of the second aspect integrated into the genome of the recombinant cell.
In a fifth aspect, the present invention provides a method for producing a recombinant fusion protein according to the first aspect, the method comprising the steps of:
(1) Constructing an expression vector and transferring the expression vector into a host cell;
(2) Screening positive transformants;
(3) Culturing the screened positive clone, and purifying after induced expression to obtain the recombinant fusion protein.
Preferably, in step (1), the following steps are adopted: the target gene and the expression vector are ligated by a restriction enzyme and a T4 DNA ligase, the plasmid vector is linearized by the restriction enzyme, and the linearized product is introduced into the host cell by electrotransformation.
Preferably, the restriction enzyme used for linearization comprises EcoR I, not I, kpn I, bamH I, sal I or Sac I, preferably Sal I.
Preferably, in step (2), positive transformant selection is performed using the following steps: the primary screening was performed by minimum glucose plates, and positive transformants after the primary screening were inoculated onto G418-containing yeast extract-peptone-glucose plates for multicopy screening.
Preferably, the concentration of G418 is 0.25-2mg/mL, for example, 0.25mg/mL, 0.5mg/mL, 0.75mg/mL, 1mg/mL, 2mg/mL, etc., preferably 0.5mg/mL.
Preferably, in the step (3), the culture medium used for inducing the expression is a glycerol complex buffer culture medium and a methanol complex buffer culture medium.
Preferably, in step (3), the time for inducing expression is 2 to 10 days, and may be, for example, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, or 10 days, etc.
As a preferable technical scheme of the invention, the preparation method comprises the following steps:
(1) Constructing an expression vector and transferring the expression vector into a host cell;
connecting a target gene and an expression vector pPIC9K through restriction enzyme and T4 DNA ligase, respectively double-enzyme cutting the target gene and the expression vector pPIC9K through restriction enzyme EcoR I/Not I, connecting by using T4 DNA ligase, linearizing a plasmid vector by using restriction enzyme Sal I, and introducing the target gene into Pichia pastoris GS115 through electrotransformation;
(2) Screening positive transformants;
the transformants are subjected to primary screening through a minimum glucose plate, positive transformants after primary screening are subjected to multi-copy screening by aseptic toothpick dibbling onto a G418-containing yeast extract-peptone-glucose plate, wherein the concentration of G418 is 0.25-2mg/mL;
(3) Culturing the screened positive clone, and purifying after induced expression to obtain the recombinant fusion protein.
Performing induced expression for 2-10 days by using a glycerol compound buffer culture medium and a methanol compound buffer culture medium; centrifuging to collect fermentation broth under 1000-10000rpm (e.g. 1000rpm, 2000rpm, 4000rpm, 5000rpm, 6000rpm, 8000rpm, 10000 rpm), centrifuging at 0-15deg.C (e.g. 0deg.C, 4deg.C, 6deg.C, 8deg.C, 10deg.C, 12deg.C, 14deg.C or 15deg.C) for 1-10min (e.g. 1min, 2min, 4min, 5min, 8min or 10min, etc.); the proteins were extracted and purified using nickel magnetic beads.
In a sixth aspect, the invention provides a pharmaceutical composition comprising a recombinant fusion protein according to the first aspect.
Preferably, the pharmaceutical composition further comprises a pharmaceutically acceptable carrier.
In a seventh aspect, the present invention provides the use of the recombinant fusion protein according to the first aspect for the preparation of a nano-antibacterial drug.
The numerical ranges recited herein include not only the recited point values, but also any point values between the recited numerical ranges that are not recited, and are limited to, and for the sake of brevity, the invention is not intended to be exhaustive of the specific point values that the recited range includes.
Compared with the prior art, the invention has the following beneficial effects:
(1) The recombinant fusion protein can be efficiently expressed in pichia pastoris and realize various effects such as enzyme-collecting response, self-assembly, long-acting retention, sterilization, fluorescent tracing and the like;
(2) The preparation method of the recombinant fusion protein is economical and efficient, simple in preparation process and powerful in product function, and has extremely high potential and application prospect in the nano medicine industry.
Drawings
FIG. 1 is a schematic diagram of the structure of a green fluorescent protein as a parent of a recombinant protein;
FIG. 2 is a schematic diagram of plasmid expression vector construction;
FIG. 3 is an SDS-PAGE electrophoresis of recombinant fusion proteins;
FIG. 4 is a transmission electron microscope image of the recombinant fusion protein assembled into fibers after treatment with an enzyme response unit;
FIG. 5A is a zone of inhibition of the expressed target protein against Staphylococcus aureus;
FIG. 5B is a zone of inhibition of V8 protease against Staphylococcus aureus;
FIG. 5C is a zone of inhibition by Amp against Staphylococcus aureus;
fig. 5D is a zone of inhibition of staphylococcus aureus after V8 protease treatment of the target protein.
Detailed Description
The technical scheme of the invention is further described by the following specific embodiments. It will be apparent to those skilled in the art that the examples are merely to aid in understanding the invention and are not to be construed as a specific limitation thereof.
The specific techniques or conditions are not identified in the examples and are described in the literature in this field or are carried out in accordance with the product specifications. The reagents or apparatus used were conventional products commercially available through regular channels, with no manufacturer noted.
The sources of reagents used in the following embodiments are as follows:
expression vector pPIC9K: shanghai bioengineering parts, inc.;
t4 DNA ligase: shanghai bioengineering parts, inc.;
restriction enzyme EcoR I/Not I: shanghai bioengineering parts, inc.;
restriction enzyme Sal I: beijing Hua Bode Yi Biotechnology Co., ltd;
pichia pastoris GS115: beijing culvert Yiyang Biotechnology Co., ltd;
pichia pastoris KM71: beijing culvert Yiyang Biotechnology Co., ltd;
glycerol/methanol complex buffer medium: 1% yeast extract, 2% peptone, 100mM potassium phosphate, pH6.0,1.34% YNB, 4X 10 -5 % biotin;
1% glycerol or 0.5% methanol;
1. dissolving 10g yeast extract, 20g peptone in 700mL water;
2. sterilizing for 20min;
3. cooled to room temperature, and the following mixed solution was added:
100mL of 1M potassium phosphate buffer pH6.0;
100mL 10×YNB
2mL 500 Xbiotin
100mL of 10 Xglycerol;
v8 protease: shanghai Bohr chemical Co., ltd;
gelatinase: beijing Aozhen science and technology Co., ltd;
legumain enzyme: guangzhou Baihui biotechnology Co., ltd.
Example 1 expression of recombinant fusion proteins in Pichia pastoris GS115
The embodiment provides a recombinant fusion protein, wherein the assembly sequence of the insertion sequence of the recombinant protein is as follows: 6 histidine-targeting unit-enzyme response unit-assembly unit-functional unit-enzyme response unit-targeting unit-6 histidines;
the fluorescent protein contained in the recombinant fusion protein is enhanced green fluorescent protein, and the position where the cleavage occurs and the sequence insertion is a connecting ring 9;
the enzyme response unit is V8 protease, and the protease cleavage sequence and the cleavage site are FEL/F;
the functional unit is cobra antibacterial peptide Ohcath-30, and the amino acid sequence is shown as follows:
KFFKK LKNSV KKRAK KFFKK PRVIG VSIPF；
the assembled unit protein sequence is KKLVFFAED;
the targeting unit is NAS.
The protein sequence according to the design is translated into a DNA sequence, and after the optimization of the codon of Pichia pastoris, the DNA sequence is synthesized chemically according to SEQ ID NO. 16. The nucleotide sequence of SEQ ID NO.16 is shown below:
tacgtacatcatcatcatcatcacagcagcggcctggtgccgcgcggcagcatggtgagcaagggcgaggagctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacggccacaagttcagcgtgtccggcgagggcgagggcgatgccacctacggcaagctgaccctgaagttcatctgcaccaccggcaagctgcccgtgccctggcccaccctcgtgaccaccctgacctacggcgtgcagtgcttcagccgctaccccgaccacatgaagcagcacgacttcttcaagtccgccatgcccgaaggctacgtccaggagcgcaccatcttcttcaaggacgacggcaactacaagacccgcgccgaggtgaagttcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaaggaggacggcaacatcctggggcacaagctggagtacaactacaacagccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaacttcaagatccgccacaacatcgaggacggcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgctgctgcccgacaaccactacctgagcacccagtccgccctgagcaaagaccccaacgagaagcgcgatcacatggtcctgctggagttcgtgaccgccgccgggatcactctcggcatggacgagctgtacaaggaattcggtggtaccggcggtaacgcatccggtggattcgaactgtttgttctggttttcttcgcgggcggcaaattcttcaaaaaactgaaaaacagcgttaaaaaacgtgcgaaaaaattcttcaaaaaaccgcgtgttatcggcgttagcatcccgttctaagcggccgc。
the gene of interest and the expression vector pPIC9K were ligated by restriction endonucleases and T4 DNA ligase. The construction scheme of the plasmid expression vector is shown in FIG. 2, and the target gene and the expression vector pPIC9K are respectively digested with restriction enzymes EcoR I/Not I and ligated by using T4 DNA ligase. The plasmid vector was linearized using the restriction enzyme Sal I. The gene of interest was introduced into pichia pastoris GS115 by an electrotransport.
Transformants were primary screened by minimal glucose plates and positive transformants after primary screening were spotted onto yeast extract-peptone-glucose plates of different concentrations (0.25-2 mg/mL) of G418 by sterile toothpick for multicopy screening.
Induced expression was performed by glycerol and methanol complex buffer media for 8 days. The fermentation broth was collected by centrifugation at 5000rpm for 5min at 4 ℃. The proteins were extracted and purified using nickel magnetic beads. The purified proteins were characterized by SDS-PAGE, and the SDS-PAGE patterns of the recombinant fusion proteins are shown in FIG. 3, lane M: protein marker 5 μl, lane GFP LOOP: 15. Mu.L of the target protein.
V8 protease cleavage treatment:
the split-packed V8 protease (enzyme activity 10U) was treated with recombinant fusion protein (final concentration 10 mg/mL) in buffer, incubated at 37℃for 5h, the lower pellet was obtained by centrifugation and dried, and stored to-20℃for further use.
And (5) observing the assembly morphology by a transmission electron microscope:
the precipitation solution was prepared at 10. Mu.M with DMSO and was dropped into 2 volumes of poor solvent (sterile double distilled water) with a pipette and allowed to stand at room temperature for 2h. Then the mixture is dripped on a copper net, and is observed by a transmission electron microscope after dyeing. The transmission electron microscope image of the recombinant fusion protein assembled into the fiber after the enzyme response unit treatment is shown in fig. 4, and it can be seen from fig. 4 that the assembled functional fragments form fibers with similar diameters and different lengths and have the characteristic of clustering. Indicating that the assembly can be realized after the target protease is cut.
And verifying and sterilizing functions of the inhibition zone:
the precipitation solution was prepared at 10. Mu.M with DMSO and was dropped into 2 volumes of poor solvent (sterile double distilled water) with a pipette and allowed to stand at room temperature for 2h. Dilution of Staphylococcus aureus cultured to logarithmic growth phase to OD 600 Diluting by 1000 times, taking 500 mu L of coated TSB plate, placing oxford cup at the center of the plate, taking 500 mu L of precipitation solution, adding into oxford cup, placing in a refrigerator at 4 ℃ for 2 hours, transferring to an incubator at 37 ℃ for culturing for 4 hours, and observing a bacteriostasis zone. The verification result graph of the sterilization function of the recombinant fusion protein showing the active fragment after the enzyme response unit treatment is shown in fig. 5A, 5B, 5C and 5D, wherein fig. 5A is the antibacterial zone of the expressed target protein to staphylococcus aureus, fig. 5B is the antibacterial zone of the V8 protease to staphylococcus aureus, fig. 5C is the antibacterial zone of the Amp to staphylococcus aureus, and fig. 5D is the antibacterial zone of the V8 protease to staphylococcus aureus after the target protein treatment. According to the sterilizing function verification resultThe figure shows that the expression protein and the V8 protease can not realize the antibacterial function independently, and only the expression protein and the V8 protease exist simultaneously, the core functional fragment is exposed by enzyme digestion, so that the antibacterial function is realized.
Example 2 expression of recombinant fusion proteins in Pichia pastoris KM71
The embodiment provides a recombinant fusion protein, wherein the assembly sequence of the insertion sequence of the recombinant protein is as follows: 3 histidine-targeting units-assembly units-enzyme response units-functional units-enzyme response units-3 histidine-targeting units;
the fluorescent protein contained in the recombinant fusion protein is green fluorescent protein, and the position where the cleavage occurs and the sequence insertion is a connecting ring 4;
the enzyme response unit is gelatinase, protease cleavage sequence and cleavage site GPLG/VRG;
the functional unit is fungal defensin Scedosporisin5, and the amino acid sequence is as follows:
GFGCP GSEKK CHNHC KTIKG YKG CYCDG PYCPFV GRP RCKCY；
the assembled unit protein sequence is KLLVVAADD;
the targeting unit is NTS.
The protein sequence according to the design is translated into a DNA sequence, and after the optimization of the codon of Pichia pastoris, the DNA sequence is synthesized chemically according to SEQ ID NO. 17. The nucleotide sequence of SEQ ID NO.17 is shown below:
catcatcatatgtccaaaggtgaagaactgttcactggtgtcgtaccaatcctagtcgaattggatggagatgttaacggacacaaattttccgtttctggagaaggagagggagacgccacttacggtaagttgactcttaaatttatctgtactactggaaagttgccagtaccttggccaaccttggttaccaccttgacttacggtgtccagtgtttttctagataccctgatcacatgaaaagacatgacttcttcaagagtgccatgccagaaggttatgttcaagagagaaccatttctttcaaagatgacggaaattataagacacgtgctgaagtcaaattcgagggtgacacattggtcaacaggatcgaattgaaaggtatagatttcaaagaggatggcaacattctgggacacaagctggaatataattataactcccataatgtatatattacagcagataagcaaaagaacggaattaaagctaactttaagattcgacacaatatcgagggtaacacctctggaggtaaattgttagtggttgcagctgatgacggtggcccacttggtgtgagaggaggtttcggatgtccaggctcagagaagaagtgtcacaatcattgtaagacaattaaaggttacaaaggatgttattgtgacggtccttattgtccattcgttggacgaccaaggtgtaagtgctacggaccacttggtgttagaggcggaaatacatccggtgatggtagtgtacagcttgcagaccattatcagcaaaacactcctatcggtgatggccctgtattattgccagataatcactatttatcaacccaatcagccttgtcaaaggacccaaacgaaaagagagatcacatggttttgcttgaattcgtcacagctgccggtattacccatggtatggacgagctttacaaacaccatcaccaccatcatcaccatcatcac。
the gene of interest and the expression vector ppic3.5k were ligated by restriction endonucleases and T4 DNA ligase. The target gene and the expression vector pPIC3.5K were double digested with restriction enzymes EcoRI/Not I, respectively, and ligated using T4 DNA ligase. Plasmid vectors were linearized using restriction enzyme Sac I. The target gene was introduced into Pichia pastoris KM71 by an electrotransfer.
Transformants were primary screened by minimal glucose plates and positive transformants after primary screening were spotted onto yeast extract-peptone-glucose plates of different concentrations (0.25-2 mg/mL) of G418 by sterile toothpick for multicopy screening.
The induction expression is carried out for 2-10 days through the glycerol compound buffer culture medium and the methanol compound buffer culture medium. The fermentation broth was collected by centrifugation at 1000rpm for 10min at 0deg.C. The proteins were extracted and purified using nickel magnetic beads. The purified proteins were characterized by SDS-PAGE.
And (3) performing gelatin enzyme digestion treatment:
treating recombinant fusion protein (final concentration of 200 mg/mL) with subpackaged V8 protease (enzyme activity of 50U) in buffer solution, incubating at 37deg.C for 1 hr, centrifuging to obtain lower precipitate, drying, and preserving to-20deg.C for use
And (5) observing the assembly morphology by a transmission electron microscope:
the precipitation solution was prepared with DMSO at 300. Mu.M, and was dropped into 20 volumes of poor solvent (sterile double distilled water) with a pipette and left at room temperature for 2 hours. Then the mixture is dripped on a copper net, and is observed by a transmission electron microscope after dyeing.
And verifying and sterilizing functions of the inhibition zone:
the precipitation solution was prepared with DMSO at 300. Mu.M, and was dropped into 20 volumes of poor solvent (sterile double distilled water) with a pipette and left at room temperature for 2 hours. Diluting Staphylococcus aureus cultured to logarithmic phase toOD 600 Diluting by 100 times, taking 10 mu L of a coated TSB plate, placing an oxford cup in the center of the plate, taking 10 mu L of a precipitation solution, adding the solution into the oxford cup, placing the solution in a refrigerator at 4 ℃ for 24 hours, transferring the solution into an incubator at 37 ℃ for culturing for 48 hours, and observing a bacteriostasis zone.
EXAMPLE 3 expression of recombinant fusion proteins in Pichia pastoris GS115
The embodiment provides a recombinant fusion protein, wherein the assembly sequence of the insertion sequence of the recombinant protein is as follows: 6 histidine-targeting unit-enzyme response unit-assembly unit-functional unit-enzyme response unit-targeting unit-6 histidines;
the fluorescent protein contained in the recombinant fusion protein is enhanced green fluorescent protein, and the position where the cleavage occurs and the sequence insertion is a connecting ring 9;
the enzyme response unit is legumain, protease enzyme cutting sequence and enzyme cutting site A/NN;
the functional unit is cobra antibacterial peptide Ohcath-20, and the amino acid sequence is shown as follows:
KKRAK KFFKK PRVIG VSIPF；
the assembly cell protein sequence KKLVFFAED;
the targeting unit is a NAT.
The protein sequence according to the design is translated into a DNA sequence, and after the optimization of the codon of Pichia pastoris, the DNA sequence is synthesized chemically according to SEQ ID NO. 18. The nucleotide sequence of SEQ ID NO.18 is shown below:
catcaccatcaccatcatatgtcaaaaggtgaagaactatttactggtgtggttcctattttggttgaactggacggtgatgttaacggccataaattttctgtttctggagagggcgaaggtgacgcaacgtatggcaaattgacgcttaaatttatctgtacaaccggaaagttgcccgtgccctggcctactctagtaaccactctgacatacggagttcagtgcttcagtagatatcctgaccatatgaaaagacacgatttttttaaatctgccatgcccgagggttacgtccaagaaaggaccatttctttcaaagacgacggaaattataagacacgtgccgaggttaagtttgagggagatactttggtgaacagaatcgagttgaagggtatcgacttcaaggaagatggtaacatcttgggtcataagcttgaatataattataactctcacaacgtttatattactgcagataagcagaaaaatggaataaaagcaaactttaagattagacataacattgagggtaatgccacgggtggagctaataacggaggtaagaagttggttgttttcttcgaggatggcggcaaaaaaagggccaaaaagtttttcaaaaaaccaagagtcatcggagtatctatcccttttggaggtgctaacaatggaggtaatgctactggtgatggttcagttcaacttgccgatcactaccaacaaaacactcctatcggcgatggaccagttctgctgccagacaaccactacctttctacccaatccgctttgtctaaggatccaaatgaaaagagagatcacatggtcctgcttgaatttgtaacagcagccggtatcacccacggaatggatgaactgtacaagcatcaccaccatcatcac。
the gene of interest and the expression vector pPIC9K were ligated by restriction endonucleases and T4 DNA ligase. The target gene and the expression vector pPIC9K were double digested with restriction enzymes EcoR I/Not I, respectively, and ligated using T4 DNA ligase. Linearization of the plasmid vector with the restriction enzyme Sal I the gene of interest was introduced into Pichia pastoris GS115 by chemical methods.
The chemical conversion reagent is aqueous solution of 2-20% PEG and 1-50 mu M salmon sperm DNA.
Transformants were primary screened by minimal glucose plates and positive transformants after primary screening were spotted onto yeast extract-peptone-glucose plates of different concentrations (0.25-2 mg/mL) of G418 by sterile toothpick for multicopy screening.
The induction expression is carried out for 2-10 days through the glycerol compound buffer culture medium and the methanol compound buffer culture medium. The fermentation broth was collected by centrifugation at 10000rpm at 10℃for 1min. The proteins were extracted and purified using nickel magnetic beads. The purified proteins were characterized by SDS-PAGE.
And (3) legumain enzyme digestion treatment:
the split-packed legumain (enzyme activity is 30U) is treated with recombinant fusion protein (final concentration 100 mg/mL) in buffer, incubated at 37℃for 3h, the lower pellet obtained by centrifugation is dried and stored to-20℃for further use.
And (5) observing the assembly morphology by a transmission electron microscope:
the precipitation solution was prepared with DMSO at 200. Mu.M, and was dropped into 10 volumes of poor solvent (sterile double distilled water) with a pipette and left at room temperature for 2 hours. Then the mixture is dripped on a copper net, and is observed by a transmission electron microscope after dyeing.
And verifying and sterilizing functions of the inhibition zone:
the precipitation solution was prepared with DMSO at 200. Mu.M and was dropped into 10 volumes of poor solvent (sterile double distilled water) using a pipetteThe mixture was left at room temperature for 2 hours. Dilution of Staphylococcus aureus cultured to logarithmic growth phase to OD 600 Diluting by 500 times, taking 300 mu L of a coated TSB plate, placing an oxford cup in the center of the plate, taking 300 mu L of a precipitation solution, adding the solution into the oxford cup, placing the solution in a refrigerator at 4 ℃ for 12 hours, transferring the solution into an incubator at 37 ℃ for culturing for 24 hours, and observing a bacteriostasis zone.
In conclusion, the modularized protein sequence related to pichia pastoris exogenesis expression can realize multiple effects of enzyme-collecting response, self-assembly, long-acting retention, sterilization, fluorescent tracing and the like under the existence of specific enzymes. Can realize the high-efficiency expression of target proteins and realize the fusion of various proteins. The preparation method of the recombinant fusion protein is economic and efficient, has simple preparation process and strong product functions, and has extremely high potential and application prospect in the nano medicine industry.
The applicant declares that the above is only a specific embodiment of the present invention, but the scope of the present invention is not limited thereto, and it should be apparent to those skilled in the art that any changes or substitutions that are easily conceivable within the technical scope of the present invention disclosed by the present invention fall within the scope of the present invention and the disclosure.
Claims (10)
1. A recombinant fusion protein comprising a fluorescent protein, a histidine unit, an enzyme response unit, a functional unit, an assembly unit, and a targeting unit.
2. The recombinant fusion protein of claim 1, wherein the fluorescent protein comprises a green fluorescent protein, a red fluorescent protein, or a enhanced green fluorescent protein;
preferably, the histidine unit comprises 3-10 histidines;
preferably, the enzyme response unit is a protease cleavage sequence of an atopic enzyme, the atopic enzyme comprising any one or a combination of at least two of gelatinase, legumain, V8 protease or cathepsin B;
preferably, the atopic enzyme is a V8 protease, and the cleavage site of the V8 protease comprises FGL/F, FAL/F, FEL/F, FEL/F, FG/LF, FG/LD, F/GLP, WG/LF or FEL/F;
preferably, the functional unit is a protein sequence that performs a primary function, the functional unit comprising a cobra antibacterial peptide, an engineered cobra antibacterial peptide, or a fungal defensin;
preferably, the amino acid sequence of the cobra antibacterial peptide is selected from any one of SEQ ID NO. 1-3;
preferably, the amino acid sequence of the modified cobra antibacterial peptide is selected from any one of SEQ ID NO. 4-6;
preferably, the amino acid sequence of the fungal defensin comprises any one selected from the group consisting of SEQ ID nos. 7-11;
preferably, the assembly unit is an important fibrotic assembly fragment in the Alzheimer's related protein A beta 42, and the amino acid sequence of the assembly unit comprises KKVVFFEED, KKLVFFAED, KKLLFFAAD or KLLVVAADD;
preferably, the targeting unit is a pichia pastoris glycosylation sequence, the targeting unit comprising a high mannose N-glycosylation modification sequence, a low mannose N-glycosylation modification sequence, a complex N-glycosylation modification sequence, or an O-glycosylation modification sequence;
preferably, the targeting unit is a high mannose N-glycosylation modification sequence, the amino acid sequence of which comprises DAS, NFS, NTS, NAS, NAT or TAA.
3. The recombinant fusion protein of claim 1 or 2, wherein the recombinant fusion protein is assembled in a manner comprising:
(1) 10 histidine-enzyme response unit-targeting unit-functional unit-enzyme response unit-assembly unit-targeting unit-10 histidines;
(2) 3 histidine-targeting units-assembly units-enzyme response units-functional units-enzyme response units-3 histidine-targeting units;
(3) 6 histidine-targeting unit-enzyme response unit-assembly unit-functional unit-enzyme response unit-targeting unit-6 histidines;
(4) Assembling unit-6 histidine-targeting unit-enzyme response unit-functional unit-enzyme response unit-targeting unit-6 histidine;
or (5) 3 histidine-targeting unit-enzyme response unit-targeting unit-functional unit-assembly unit-enzyme response unit-10 histidines.
4. A nucleic acid molecule encoding the recombinant fusion protein of any one of claims 1-3;
preferably, the nucleotide sequence of the nucleic acid molecule is selected from any one of SEQ ID NOS.16-18.
5. An expression vector comprising the nucleic acid molecule of claim 4, and which is capable of allowing the transfected host cell to express the recombinant fusion protein of any one of claims 1-3 after transfection of the host cell;
preferably, the host cell comprises pichia pastoris, the pichia phenotype comprising GS115, SMD1168H or KM71, preferably GS115;
preferably, the expression vector is a pichia expression vector comprising pPIC9K, ppic3.5k or ppiczαa, preferably pPIC9K.
6. A recombinant cell comprising the expression vector of claim 5 or having incorporated into its genome the nucleic acid molecule of claim 4.
7. A method of preparing a recombinant fusion protein according to any one of claims 1-3, comprising the steps of:
(1) Constructing an expression vector and transferring the expression vector into a host cell;
(2) Screening positive transformants;
(3) Culturing the screened positive clone, and purifying after induced expression to obtain the recombinant fusion protein.
8. The method of claim 7, wherein in step (1), the following steps are used: connecting a target gene and an expression vector by using restriction enzymes and T4 DNA ligase, linearizing a plasmid vector by using the restriction enzymes, and introducing a linearization product into a host cell by electrotransformation;
preferably, the restriction enzyme used for linearization comprises EcoRI, notI, kpnI, bamH I, salI or SacI, preferably SalI;
preferably, in step (2), positive transformant selection is performed using the following steps: primary screening is carried out through a minimum glucose plate, and positive transformants after primary screening are inoculated on a yeast extract-peptone-glucose plate containing G418 for multi-copy screening;
preferably, the concentration of G418 is 0.25-2mg/mL, preferably 0.5mg/mL;
preferably, in the step (3), the culture medium adopted for the induced expression is a glycerol compound buffer culture medium and a methanol compound buffer culture medium;
preferably, in step (3), the time for inducing expression is 2 to 10 days.
9. A pharmaceutical composition comprising the recombinant fusion protein of any one of claims 1-3;
preferably, the pharmaceutical composition further comprises a pharmaceutically acceptable carrier.
10. Use of the recombinant fusion protein of any one of claims 1-3 for the preparation of a nano-antibacterial drug.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202211202216.7A CN116333163A (en) | 2022-09-29 | 2022-09-29 | Recombinant fusion protein and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202211202216.7A CN116333163A (en) | 2022-09-29 | 2022-09-29 | Recombinant fusion protein and application thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN116333163A true CN116333163A (en) | 2023-06-27 |
Family
ID=86880929
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202211202216.7A Pending CN116333163A (en) | 2022-09-29 | 2022-09-29 | Recombinant fusion protein and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN116333163A (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN116396372A (en) * | 2023-02-18 | 2023-07-07 | 青岛农业大学 | Peptide-loaded nanoparticle and application thereof in treatment of eye infection of pets |
-
2022
- 2022-09-29 CN CN202211202216.7A patent/CN116333163A/en active Pending
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN116396372A (en) * | 2023-02-18 | 2023-07-07 | 青岛农业大学 | Peptide-loaded nanoparticle and application thereof in treatment of eye infection of pets |
| CN116396372B (en) * | 2023-02-18 | 2024-05-24 | 青岛农业大学 | Peptide-loaded nanoparticle and application thereof in treatment of eye infection of pets |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN110845603B (en) | Human collagen 17-type polypeptide, production method and use thereof | |
| US20170101634A1 (en) | Extracellular hyaluronidase from streptomyces koganeiensis | |
| CN103897032A (en) | Novel cell-penetrating peptide | |
| WO2017126984A1 (en) | A method for producing insulin and insulin derivatives, and hybrid peptide used in this method | |
| CN116333163A (en) | Recombinant fusion protein and application thereof | |
| CN113121704B (en) | Nanoparticle-based coronavirus vaccines | |
| KR20200121248A (en) | Method for preparing Botulinum Toxin | |
| JPS62174026A (en) | Remedy for leukpenia | |
| CN116102640A (en) | Recombinant lactoferrin derived peptides and their use in enhancing immunity | |
| CN114616241A (en) | Ferritin heavy chain subunit-based drug vectors | |
| JP2023527093A (en) | rhFGF21 fusion proteins, polynucleotides encoding rhFGF21 fusion proteins, compositions containing rhFGF21 fusion proteins, and uses of rhFGF21 fusion proteins | |
| CN110156875B (en) | Antibacterial peptide H5-p5, and preparation method and application thereof | |
| CN110468143B (en) | Preparation method and application of antibacterial peptide NZX | |
| WO2023165467A1 (en) | Ferritin nanocage vector loaded with small nucleic acid drug in inner cavity and use | |
| CN109627286B (en) | Novel broad-spectrum antibacterial peptide SAMP1-A4 and preparation method thereof | |
| CN116554309A (en) | Recombinant human III type collagen and preparation method and application thereof | |
| CN116196393A (en) | Application of antibacterial peptide AP138 in preparation of antibacterial drugs | |
| CN110055202A (en) | For the Escherichia coli of high expression foreign protein and its construction method and application | |
| CN115969956A (en) | Application of antibacterial peptide A24 in preparation of antibacterial drugs | |
| CN115850467A (en) | Specific beta-glucan nano antibody and application thereof | |
| CN102584975A (en) | Nucleolar targeting signal peptide as well as coding gene and application thereof | |
| CN108823193B (en) | Efficient streptococcus pneumoniae chimeric lyase, and mutant and application thereof | |
| CN114404614B (en) | Immune liposome targeting pseudomonas aeruginosa and preparation method and application thereof | |
| CN101831452B (en) | Method for efficiently expressing and producing T4 lysozyme through recombinant trichoderma reesei in inductive mode | |
| CN112359066B (en) | Application of lipid-binding small peptide SSIP1 in mediating fusion protein of lipid-binding small peptide to enter cells |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination |