CN116284417A - Thrombin-antithrombin complex antibody, its preparation method and application - Google Patents
Thrombin-antithrombin complex antibody, its preparation method and application Download PDFInfo
- Publication number
- CN116284417A CN116284417A CN202310089381.4A CN202310089381A CN116284417A CN 116284417 A CN116284417 A CN 116284417A CN 202310089381 A CN202310089381 A CN 202310089381A CN 116284417 A CN116284417 A CN 116284417A
- Authority
- CN
- China
- Prior art keywords
- antibody
- thrombin
- antithrombin complex
- reverse primer
- heavy chain
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 108010072035 antithrombin III-protease complex Proteins 0.000 title claims abstract description 19
- 238000002360 preparation method Methods 0.000 title claims abstract description 15
- 238000000034 method Methods 0.000 claims abstract description 14
- 238000000338 in vitro Methods 0.000 claims abstract description 5
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 4
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 21
- 239000003153 chemical reaction reagent Substances 0.000 claims description 13
- 239000004816 latex Substances 0.000 claims description 12
- 229920000126 latex Polymers 0.000 claims description 12
- 210000004027 cell Anatomy 0.000 claims description 10
- 210000004978 chinese hamster ovary cell Anatomy 0.000 claims description 9
- 230000003053 immunization Effects 0.000 claims description 8
- 238000004321 preservation Methods 0.000 claims description 8
- 230000009471 action Effects 0.000 claims description 7
- 239000006285 cell suspension Substances 0.000 claims description 7
- 238000012163 sequencing technique Methods 0.000 claims description 7
- 210000004989 spleen cell Anatomy 0.000 claims description 7
- QYYMDNHUJFIDDQ-UHFFFAOYSA-N 5-chloro-2-methyl-1,2-thiazol-3-one;2-methyl-1,2-thiazol-3-one Chemical compound CN1SC=CC1=O.CN1SC(Cl)=CC1=O QYYMDNHUJFIDDQ-UHFFFAOYSA-N 0.000 claims description 6
- 239000000427 antigen Substances 0.000 claims description 6
- 102000036639 antigens Human genes 0.000 claims description 6
- 108091007433 antigens Proteins 0.000 claims description 6
- 238000002649 immunization Methods 0.000 claims description 6
- 108091003079 Bovine Serum Albumin Proteins 0.000 claims description 5
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 5
- 229940098773 bovine serum albumin Drugs 0.000 claims description 5
- 230000004927 fusion Effects 0.000 claims description 5
- 230000014509 gene expression Effects 0.000 claims description 5
- 201000000050 myeloid neoplasm Diseases 0.000 claims description 5
- 239000002671 adjuvant Substances 0.000 claims description 4
- 230000007910 cell fusion Effects 0.000 claims description 4
- 210000004408 hybridoma Anatomy 0.000 claims description 4
- 210000000952 spleen Anatomy 0.000 claims description 4
- 108020004414 DNA Proteins 0.000 claims description 3
- 238000009007 Diagnostic Kit Methods 0.000 claims description 3
- 102100024375 Gamma-glutamylaminecyclotransferase Human genes 0.000 claims description 3
- 101710201613 Gamma-glutamylaminecyclotransferase Proteins 0.000 claims description 3
- 229920002684 Sepharose Polymers 0.000 claims description 3
- 101710120037 Toxin CcdB Proteins 0.000 claims description 3
- 239000003795 chemical substances by application Substances 0.000 claims description 3
- 238000010276 construction Methods 0.000 claims description 3
- 238000012216 screening Methods 0.000 claims description 3
- 239000013604 expression vector Substances 0.000 claims description 2
- 238000010353 genetic engineering Methods 0.000 claims description 2
- 238000003757 reverse transcription PCR Methods 0.000 claims description 2
- 230000010473 stable expression Effects 0.000 claims description 2
- 239000013598 vector Substances 0.000 claims description 2
- 238000004519 manufacturing process Methods 0.000 claims 4
- 238000001514 detection method Methods 0.000 abstract description 11
- 238000012795 verification Methods 0.000 abstract description 4
- 238000003745 diagnosis Methods 0.000 abstract description 2
- 238000006243 chemical reaction Methods 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- 238000002965 ELISA Methods 0.000 description 9
- 239000004793 Polystyrene Substances 0.000 description 8
- 150000001413 amino acids Chemical group 0.000 description 8
- 229920002223 polystyrene Polymers 0.000 description 8
- 239000000872 buffer Substances 0.000 description 7
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 7
- 239000011324 bead Substances 0.000 description 6
- 239000008363 phosphate buffer Substances 0.000 description 6
- 239000008213 purified water Substances 0.000 description 5
- 238000003756 stirring Methods 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 239000011734 sodium Substances 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- 101710149951 Protein Tat Proteins 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 108090000190 Thrombin Proteins 0.000 description 3
- 239000004019 antithrombin Substances 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 230000037029 cross reaction Effects 0.000 description 3
- 238000004090 dissolution Methods 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 229960004072 thrombin Drugs 0.000 description 3
- XCBLFURAFHFFJF-UHFFFAOYSA-N 3-[bis(2-hydroxyethyl)azaniumyl]-2-hydroxypropane-1-sulfonate Chemical compound OCCN(CCO)CC(O)CS(O)(=O)=O XCBLFURAFHFFJF-UHFFFAOYSA-N 0.000 description 2
- 108010008286 DNA nucleotidylexotransferase Proteins 0.000 description 2
- 102100033215 DNA nucleotidylexotransferase Human genes 0.000 description 2
- 238000001712 DNA sequencing Methods 0.000 description 2
- 206010051055 Deep vein thrombosis Diseases 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 239000007987 MES buffer Substances 0.000 description 2
- 208000010378 Pulmonary Embolism Diseases 0.000 description 2
- 208000007536 Thrombosis Diseases 0.000 description 2
- 206010047249 Venous thrombosis Diseases 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 230000015271 coagulation Effects 0.000 description 2
- 238000005345 coagulation Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 238000010839 reverse transcription Methods 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- YABFPHSQTSFWQB-UHFFFAOYSA-N 2-(4-fluorophenyl)-1-(1,2,4-triazol-1-yl)-3-(trimethylsilyl)propan-2-ol Chemical compound C=1C=C(F)C=CC=1C(O)(C[Si](C)(C)C)CN1C=NC=N1 YABFPHSQTSFWQB-UHFFFAOYSA-N 0.000 description 1
- SXGZJKUKBWWHRA-UHFFFAOYSA-N 2-(N-morpholiniumyl)ethanesulfonate Chemical compound [O-]S(=O)(=O)CC[NH+]1CCOCC1 SXGZJKUKBWWHRA-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- ISILBGFTARENPI-UHFFFAOYSA-N 3-amino-1,4-dihydroxypentane-3-sulfonic acid Chemical compound CC(O)C(N)(S(O)(=O)=O)CCO ISILBGFTARENPI-UHFFFAOYSA-N 0.000 description 1
- 108010039209 Blood Coagulation Factors Proteins 0.000 description 1
- 102000015081 Blood Coagulation Factors Human genes 0.000 description 1
- 239000003154 D dimer Substances 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 108010022233 Plasminogen Activator Inhibitor 1 Proteins 0.000 description 1
- 102000012335 Plasminogen Activator Inhibitor 1 Human genes 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108010094028 Prothrombin Proteins 0.000 description 1
- 102100027378 Prothrombin Human genes 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 102000012607 Thrombomodulin Human genes 0.000 description 1
- 108010079274 Thrombomodulin Proteins 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 230000010100 anticoagulation Effects 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 230000023555 blood coagulation Effects 0.000 description 1
- 239000003114 blood coagulation factor Substances 0.000 description 1
- 239000012503 blood component Substances 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 208000026106 cerebrovascular disease Diseases 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000003113 dilution method Methods 0.000 description 1
- 208000009190 disseminated intravascular coagulation Diseases 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 238000004945 emulsification Methods 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 108010052295 fibrin fragment D Proteins 0.000 description 1
- 230000020764 fibrinolysis Effects 0.000 description 1
- 239000007973 glycine-HCl buffer Substances 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000009533 lab test Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 239000011259 mixed solution Substances 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 230000000955 neuroendocrine Effects 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000008055 phosphate buffer solution Substances 0.000 description 1
- 230000010118 platelet activation Effects 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 229940039716 prothrombin Drugs 0.000 description 1
- 238000003908 quality control method Methods 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 230000001172 regenerating effect Effects 0.000 description 1
- 238000007480 sanger sequencing Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/536—Immunoassay; Biospecific binding assay; Materials therefor with immune complex formed in liquid phase
- G01N33/537—Immunoassay; Biospecific binding assay; Materials therefor with immune complex formed in liquid phase with separation of immune complex from unbound antigen or antibody
- G01N33/539—Immunoassay; Biospecific binding assay; Materials therefor with immune complex formed in liquid phase with separation of immune complex from unbound antigen or antibody involving precipitating reagent, e.g. ammonium sulfate
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/573—Immunoassay; Biospecific binding assay; Materials therefor for enzymes or isoenzymes
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Urology & Nephrology (AREA)
- Organic Chemistry (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Hematology (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Cell Biology (AREA)
- General Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Food Science & Technology (AREA)
- Analytical Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Plant Pathology (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
The invention belongs to the field of in-vitro diagnostic medical examination, and particularly relates to a thrombin-antithrombin complex (TAT) antibody, a preparation method and application thereof. The light chain amino acid sequence of the antibody is shown as SEQ ID NO. 7, and the heavy chain amino acid sequence is shown as SEQ ID NO. 9. The result coincidence rate of the kit prepared by the antibody is 94%, and the kit has good result coincidence compared with a standard diagnosis method. Compared with the chemoluminescence detection kit of the Hirschmeikang, the kit of the invention has the advantages of equivalent precision and detection limit to the linear verification result.
Description
Technical Field
The invention belongs to the field of in-vitro diagnostic medical examination, and particularly relates to a preparation method and application of a thrombin-antithrombin (TAT) complex antibody.
Background
Thrombosis is the result of the combined actions of multiple factors such as abnormal release of various coagulation factors due to platelet activation and neuroendocrine changes caused by imbalance of blood coagulation and anticoagulation systems, abnormal blood flow and blood components, and vascular endothelial injury.
The marker of coagulation is thrombin formation, but it is rapidly inactivated by thrombomodulin, heparin cofactor, etc. after formation, and thus its concentration cannot be directly measured. After prothrombin is activated, it is rapidly covalently linked to antithrombin by an ester linkage to form TAT, so TAT formation is a marker of thrombin activation in vivo. The half life of TAT is longer (10-30 min), the concentration of thrombin can be reflected by measuring the concentration of TAT, so that the change condition of coagulation-anticoagulation can be monitored, and the TAT has important value for thrombotic diseases such as Disseminated Intravascular Coagulation (DIC), deep Vein Thrombosis (DVT), pulmonary Embolism (PE), cerebrovascular diseases, myocardial infarction, severe hepatitis and the like. Can be combined with other molecular markers such as D-dimer, PAI-1, etc., and can more comprehensively reflect the coagulation and fibrinolysis states of patients.
Currently, quantitative determination methods of plasma TAT are mainly enzyme-linked immunosorbent assay (ELISA) method and chemiluminescent immunoassay method. ELISA method is complex in operation and time-consuming, and is not suitable for single sample measurement. The kit for detecting TAT by chemiluminescent immunoassay used in clinic almost entirely depends on japanese simeconazole (symex), which is expensive. Therefore, development of a domestic, high-quality, low-cost, high-sensitivity and high-specificity TAT antibody and a detection kit is urgent.
Disclosure of Invention
The invention provides an antibody capable of being applied to an immunoturbidimetry as well as a preparation method and application thereof aiming at the problems existing in the prior art.
In order to achieve the above purpose, the invention is realized by adopting the following technical scheme:
in a first aspect, the invention provides a thrombin-antithrombin complex antibody, wherein the light chain amino acid sequence of the antibody is shown as SEQ ID NO. 7, and the heavy chain amino acid sequence of the antibody is shown as SEQ ID NO. 9.
The light chain amino acid sequence of TAT monoclonal antibody is: QIVLTQSPAIMSCAQNLELPTMTCSASSSITYMHWYQQKSENILHHSPKIIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWRSDPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
The heavy chain amino acid sequence is: QVHLKESGPGLVASSQSLSITCQKSGTSPKRWGLHWVRQPPGKGGGELPIDWAGGTTNYNSALMSRLSISKDKSKSQVFLKMNSLQTDDTAMYYCARERNGMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
In a second aspect, the present invention provides a method for preparing thrombin-antithrombin complex antibodies, comprising the steps of:
s1: preparation of monoclonal antibodies
Immunizing a mouse with complete Freund's adjuvant and natural antigen, separating spleen cells, fusing the spleen cells with SP2/0 cells under the action of a PEG fusion agent, and screening monoclonal antibodies on a HAT selection medium;
s2: acquisition of monoclonal antibody sequences
Extracting RNA of the hybridoma cell strain obtained in the step S1, amplifying sequences of DNA of light chain and heavy chain variable regions of the antibody by RT-PCR, and sequencing the amplified DNA sequences;
s3: construction of monoclonal antibody sequences
Light chain: adding the DNA sequence of the light chain variable region obtained by sequencing in the S2 to the DNA sequence of the IgK conserved region of the mouse antibody;
heavy chain: adding the heavy chain variable region DNA sequence obtained by sequencing in the step S2 to the IgG1 conserved region DNA sequence;
s4: expression of monoclonal antibodies
Constructing antibody light chain and heavy chain expression vectors by utilizing a genetic engineering technology, transfecting the vectors into a CHO cell line to obtain a CHO cell line capable of generating thrombin-antithrombin complex antibodies, and carrying out stable expression of the antibodies;
s5: monoclonal antibodies were purified using protein G sepharose.
Further, in step S2, the 5' primer sequence is: ATTGT CCTTA ATGGG GGG.
Light chain hybrid primer:
5'-ACAGT TGGTG CAGCA TCTGC-3' (IgK conserved 5' -end reverse primer),
5'-GGCGA AGACT TGGGC TGGCC-3' (reverse primer at 5' end of IgL1 conserved region),
5'-GGAGT GGACT TGGGC TGACC-3' (IgL 2 conserved 5' -end reverse primer).
Heavy chain hybrid primer:
5'-CTAGG GGGTG TCGTT TTAGC-3' (reverse primer 5' to the IgG1 conserved region),
5'-GATGG GGCTG TTGTT TTAGC-3' (reverse primer 5' to the IgG2a conserved region),
5'-GATGG GGGTG TTGTT TTAGC-3' (reverse primer 5' to the IgG2b conserved region),
5'-GATGG GGCTG TTGTT GTAGC-3' (reverse primer 5' to IgG3 conserved region).
Further, in step S1, spleen cells fused with myeloma cells were taken as a cell suspension prepared by taking the spleen the third day after the last immunization, and the cell suspension was prepared with myeloma cells according to the following ratio 1:6 to 1:10, and cell fusion under the action of PEG.
Further, the CHO cell line capable of producing thrombin-antithrombin complex antibodies in step S4 has a preservation number of CCTCC NO: C202201, which is named as Chinese hamster ovary cell CHO TAT, and is preserved in China center for type culture Collection, the preservation number of CCTCC NO: C202201, the preservation date of 2022, and 12 days of 01 month, and the preservation address of: eight branches of 299 Wuhan university in Wuhan district of Wuhan, hubei province. .
In a third aspect, the invention provides the use of thrombin-antithrombin complex antibodies in an immunonephelometric in vitro diagnostic kit.
Further, the kit comprises an R1 reagent and an R2 reagent, wherein the R2 reagent comprises TAT monoclonal antibody latex, bovine serum albumin and ProClin 300.
The result coincidence rate of the kit prepared by the thrombin-antithrombin complex antibody is 94%, and the kit has good result coincidence compared with a standard diagnosis method. The regression equation of the theoretical and measured values of the linear verification test is y=1.009 x-0.1040, r2=0.9999, and the deviation is less than 5%. Compared with the chemoluminescence detection kit of the Hirschmeikang, the kit of the invention has the advantages of equivalent precision and detection limit to the linear verification result.
Drawings
The invention is further described below with reference to the accompanying drawings.
FIG. 1 is a schematic diagram of the ELISA of the invention for detecting TAT mAb 7 cross-reacts with antithrombin;
FIG. 2 is a schematic diagram showing the cross-reaction of the TAT mAb 7 detected by ELISA of the present invention with protease.
Detailed Description
In order that the above objects, features and advantages of the invention will be more clearly understood, a further description of the invention will be provided with reference to specific examples. It should be noted that, in the case of no conflict, the embodiments of the present application and the features in the embodiments may be combined with each other.
In the following description, specific details are set forth in order to provide a thorough understanding of the invention, however, the invention may be practiced otherwise than as described herein, and therefore the invention is not limited to the specific embodiments of the disclosure that follow.
Example 1
This example provides a process for the preparation of monoclonal antibodies.
Preparation of tat antibodies.
1.1 immunization of BALB/C mice was performed by conventional methods, the immunogen being a native TAT protein (purchased from Alpha Diagnostic intl., inc.).
1.2 primary immunization after full emulsification of 100. Mu.g antigen with Freund's complete adjuvant, intraperitoneal or subcutaneous multipoint injections were made. Every two weeks thereafter, 50 μg of antigen was mixed with incomplete adjuvant and injected for four total immunizations.
1.3 boost once 3 days prior to fusion, then remove spleen to prepare spleen cell suspension.
1.4 fusion with SP2/0 cells under the action of PEG fusion agent and screening of monoclonal on HAT selection medium.
1.5, obtaining 17 anti-TAT specific monoclonal antibody strains respectively named TAT mAb 1 to TAT mAb 17 according to sequence numbers.
2. Quality control of antibodies.
Myeloma cells: SP2/0, which does not synthesize or secrete immunoglobulin per se, meets the requirements of preservation.
Cell fusion: spleen was taken for the third day after last immunization to prepare cell suspension, and the cell suspension was prepared with myeloma cells according to a ratio of 1:6 to 1:10, and cell fusion under the action of PEG.
Cloning: the hybridoma secreting the target antibody is screened by ELISA method, and cloned by limiting dilution method to obtain hybridoma cell line. After cloning and continuous passage inspection, the positive rate of the monoclonal antibody is 100 percent after continuous cloning.
3. Identification of monoclonal antibodies.
Specificity analysis: ELISA reaction is carried out on the obtained monoclonal antibody and a series of irrelevant antigens, and whether the obtained antibody generates cross reaction with the irrelevant immunogen or not is detected. As a result, TAT mAb 7 prepared in this example showed substantially no cross-reaction with other antigens.
Example 2
Obtaining monoclonal antibody sequences.
1. Obtaining antibody DNA sequence.
1.1 Total RNA was extracted from monoclonal cells according to the protocol of Invitrogen ™ PureLink ™ RNA minikit.
1.2 RNA from the antibody light and heavy chain variable regions was then reverse transcribed into cDNA according to the protocol of the Thermo Scientific ™ ReverteAid RT reverse transcription kit, as described in Table 1 below.
Table 1 reaction system (42 ℃,30 min)
1.3 the addition of a polyC tail at the rear end of the reverse transcription product according to Invitrogen ™ terminal deoxynucleotidyl transferase (TdT) instructions.
The specific reaction system is shown in Table 2 below:
table 2 reaction system (37 ℃,15 min)
1.4 amplification of antibody light and heavy chain DNA by PCR techniques according to the instructions of Thermo Scientific ™ PCR Master Mix (2X), respectively. The PCR reaction conditions were: preheating at 95 ℃ for 5min, circulating (denaturation at 95 ℃ for 30s, annealing at 55 ℃ for 30s, extension at 72 ℃ for 30 s) and long-time extension (at 72 ℃ for 10 min). The reaction system is shown in Table 3.
TABLE 3 reaction system
The 5' end primer sequence is as follows: ATTGT CCTTA ATGGG GGG.
Light chain hybrid primer:
5'-ACAGT TGGTG CAGCA TCTGC-3' (IgK conserved 5' -end reverse primer),
5'-GGCGA AGACT TGGGC TGGCC-3' (reverse primer at 5' end of IgL1 conserved region),
5'-GGAGT GGACT TGGGC TGACC-3' (IgL 2 conserved 5' -end reverse primer).
Heavy chain hybrid primer:
5'-CTAGG GGGTG TCGTT TTAGC-3' (reverse primer 5' to the IgG1 conserved region),
5'-GATGG GGCTG TTGTT TTAGC-3' (reverse primer 5' to the IgG2a conserved region),
5'-GATGG GGGTG TTGTT TTAGC-3' (reverse primer 5' to the IgG2b conserved region),
5'-GATGG GGCTG TTGTT GTAGC-3' (reverse primer 5' to IgG3 conserved region).
1.5 PCR purification kit instructions for the purification of PCR products according to the Charge switch ™ protocol.
DNA sequencing
And (3) carrying out DNA sequencing on the purified PCR product by using a Sanger sequencing method, wherein a sequencing result is shown in a sequence table.
The amino acid sequence of the TAT mAb 7 light chain variable region is shown as SEQ ID NO. 1, and the DNA sequence is shown as SEQ ID NO. 2.
The amino acid sequence of the heavy chain variable region of TAT mAb 7 is shown as SEQ ID NO. 3, and the DNA sequence is shown as SEQ ID NO. 4.
Example 3
This example provides the construction of monoclonal antibody sequences.
And adding a mouse antibody IgK light chain conserved region DNA sequence SEQ ID NO. 5 after the antibody light chain variable region DNA sequence to obtain the modified antibody light chain sequence.
And adding a mouse heavy chain IgG1 conserved region DNA sequence SEQ ID NO. 6 after the Fab end DNA sequence of the antibody heavy chain variable region to obtain the modified antibody heavy chain sequence.
TAT monoclonal antibody (modified TAT mAb 7 antibody) has light chain amino acid sequence shown in SEQ ID NO. 7 and DNA sequence shown in SEQ ID NO. 8.
The heavy chain amino acid sequence of TAT monoclonal antibody (modified TAT mAb 7 antibody) is shown as SEQ ID NO. 9, and the DNA sequence is shown as SEQ ID NO. 10.
Example 4
This example provides for expression of monoclonal antibodies.
Expression of tat monoclonal antibodies.
The synthetic DNA sequence SEQ ID NO. 8 was ligated into the pcDNA3.1 plasmid.
The synthetic DNA sequence SEQ ID NO. 10 was ligated into the pcDNA3.1 plasmid.
The two plasmids were 1:1 mixed and the plasmids were transfected into a CHO cell line for expression according to the instructions of the Gibco ™ ExpiFectamine ™ CHO transfection kit. The cell line is named as Chinese hamster ovary cell CHO TAT, and is preserved in China center for type culture Collection with the preservation number of CCTCC NO: C202201 and the preservation date of 2022, 01 and 12 days.
2. And (5) purifying the antibody.
Monoclonal antibodies were purified using protein G sepharose.
2.1 Protean G agarose gel was packed in a column with a bed volume of 1mL at 0.75X2 cm.
2.2 wash 5mL with 20mM phosphate buffer, PBS solution at pH 7.4 (buffer A).
2.3 1mL of cell lysate was diluted to 5mL with buffer A, filtered through a 0.45 μm filter and loaded, and 5mL was rewashed with buffer A.
2.4 elution with 100mM glycine-HCl buffer (buffer B, pH 2.7) at a flow rate of 1mL/min, collection of eluted antibody, immediate neutralization of antibody with 1M Tris-HCl buffer (buffer C, pH 9.0) and collection.
2.5 washing with purified water 10mL and then with 20% ethanol 10mL, regenerating the column and storing in an environment of 4-8deg.C.
Example 5
This example provides for the preparation of an immunoturbidimetric reaction reagent.
Preparation of R1 reagent
The concentration of 3-bis (2-hydroxyethyl) amino-2-hydroxypropanesulfonic acid (DIPSO) buffer was 0.05mol/L and the pH was adjusted to 7.5 with 0.1mol/L HCl solution. Then 0.15mol/L sodium chloride and 0.1% triton X-100,0.02%ProClin 300 are added. Wherein, the DIPSO buffer solution plays a role in stabilizing the pH value of the reaction system, sodium chloride provides an ionic environment for the reaction system, triton X-100 is a surfactant, and ProClin 300 plays a role in the reaction system as a preservative.
2. R2 reagent preparation
2.1 Preparation of 0.05mol/L (pH 7.2) phosphate buffer
First separately prepare NaH of 0.05mol/L 2 PO 4 Solution and 0.05mol/L Na 2 HPO 4 Is a solution of (a) and (b). Wherein 0.05mol/L NaH 2 PO 4 The preparation method comprises the following steps: 7.8015g of NaH was weighed out 2 PO 4 -2H 2 O, added to 1L of water. Similarly, 17.911g of Na 2 HPO 4 -12H 2 O is dissolved in 1L of water to prepare 0.05mol/L Na 2 HPO 4 Is a solution of (a) and (b). Then 28ml NaH was taken 2 PO 4 Solution and 72ml Na 2 HPO 4 The solution was stirred and mixed.
2.2 Preparation of 0.5mol/L MES buffer (pH 6.0)
97.6g of 2-morpholinoethanesulfonic acid was weighed, added to 1L of purified water, dissolved sufficiently at room temperature, and pH was adjusted to 6.0 (0.5 mol/L) with sodium hydroxide.
2.3 weighing of other materials
2.3.1 NHS: NHS 2g was weighed out, dissolved in 5mL of purified water with stirring, and stirred for 5min to allow complete dissolution.
2.3.2 EDC: 1.4g of EDC is weighed, 3mL of purified water is added, and stirring and dissolution are carried out; stirring for 5min to dissolve thoroughly.
2.3.3 polystyrene latex beads: 2.5mL of polystyrene latex beads were measured.
2.3.4 bovine serum albumin: 10g of bovine serum albumin was weighed.
2.3.5 ProClin 300: proClin 300.2 mL was measured.
2.4 activation of polystyrene latex microspheres
2.4.1 the dissolved EDC solution was added to the NHS solution and mixed well.
2.4.2 adding the measured polystyrene latex beads into the well dissolved EDC and NHS mixed solution, adding 2.5mL of 0.5mol/L MES buffer (pH 6.0), adding 5 times volume (polystyrene latex beads) of purified water for full dissolution, reacting for 30min at room temperature, and continuously stirring.
2.4.3 transfer the prepared polystyrene latex solution into a centrifuge bottle, centrifuge after balancing, 15000rpm,8℃for 50min.
2.4.4 discarding the supernatant, and collecting the centrifugal precipitate; adding 40mL of phosphate buffer, fully suspending polystyrene latex beads by using a stirrer, balancing, centrifuging at 15000rpm and 8 ℃ for 40min; twice in succession.
2.4.5 discarding the supernatant, and collecting the centrifugal precipitate; the polystyrene latex beads were resuspended in 40mL of phosphate buffer and dispersed by sonication for 20min (150W, 3 seconds, 10 seconds apart, 30 times).
2.5 Coupling of TAT antibodies
2.5.1 TAT antibody was added to the above latex solution, stirred at room temperature for 30min, and then transferred to 2-8deg.C for overnight stirring.
2.5.2 Centrifugation at 15000rmp for 50min, and discarding the supernatant. Washing twice with phosphate buffer, centrifuging to precipitate, and discarding supernatant; the monoclonal antibody latex was resuspended in 40mL of phosphate buffer and sonicated for 20 minutes (150 w,3 seconds, 10 seconds apart, 30 times) to disperse.
2.5.3 adding bovine serum albumin and ProClin 300 into monoclonal antibody emulsion, fully dissolving, and adding 460mL of phosphate buffer solution to obtain the R2 reagent.
Laboratory test results:
A. accuracy of detection reagents
50 specimens were clinically taken, and the kit of the invention was compared with the Hizimeric kit for clinical negative and positive comparison, and the results are shown in Table 4 below.
TABLE 4 accuracy test results
B. Linear range of detection reagents
Blood samples with detection values of 117.64ng/mL of the Hizimelkang kit were prepared with TAT standard substances with concentrations of 100ng/mL,50ng/mL,25ng/mL,10ng/mL,5ng/mL,1ng/mL and 0ng/mL using the kit of the invention as a diluent, and detection results were shown in Table 5 below.
TABLE 5 Linear test results
C. Precision of detection reagent
Blood samples with detection values of 4.15ng/mL and 94.78ng/mL of the Hizimel kit were tested 10 times with the kit of the present invention, and the precision of the kit of the present invention was measured, and the results are shown in Table 6 below.
TABLE 6 precision measurement results
As can be seen from the above table, the results of the kit prepared by using the antibody of the present invention have a coincidence rate of 94% and good consistency compared with the standard diagnostic method. The regression equation of the theoretical and measured values of the linear verification test is y=1.009 x-0.1040, r 2 =0.9999, deviation less than 5%. The samples with the same concentration are continuously monitored for 10 times, and the results show that the variation coefficient CV of the kit is less than 5%. The existing method for detecting TAT is less, mainly comprises an ELISA method and a few tubular chemiluminescence methods, and the ELISA method has obvious defects such as poor reproducibility, inconvenient operation and the like.
And (3) a sequence table:
SEQ ID NO:1
QIVLTQSPAIMSCAQNLELPTMTCSASSSITYMHWYQQKSENILHHSPKIIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWRSDPPTFGGGTKLEIK
SEQ ID NO:2:
CAAATTGTTTTCACCCAATCTCCTGCTATTATGTCTTGTGCTCAAAATTTCGAATTCCCTACCATGACCTGTTCTGCTTCTTCTTCTATTACCTATATGCATTGGTATCAACAAAAATCTGAAAATATTTTCCATCATTCTCCTAAAATTATTTATGATACCTCTAAATTCGCTTCTGGTGTTCCTGCTCGTTTTTCTGGTTCTGGTTCTGGTACCTCTTATTCTTTCACCATTTCTTCTATGGAAGCTGAAGATGCTGCTACCTATTATTGTCAACAATGGCGTTCTGATCCTCCTACCTTTGGTGGTGGTACCAAATTCGAAATTAAA
SEQ ID NO:3:
QVHLKESGPGLVASSQSLSITCQKSGTSPKRWGLHWVRQPPGKGGGELPIDWAGGTTNYNSALMSRLSISKDKSKSQVFLKMNSLQTDDTAMYYCARERNGMDYWGQGTSVTVSS
SEQ ID NO:4:
CAAGTTCATTTCAAAGAATCTGGTCCTGGTTTCGTTGCTTCTTCTCAATCTTTCTCTATTACCTGTCAAAAATCTGGTACCTCTCCTAAACGTWGGTTTCCATWGTTCGTCAACCTCCTGGTAAAGGTGGTGGTGAATTCCCTATTGATWGCTGGTGGTACCACCAATTATAATTCTGCTTTCATGTCTCGTTTCTCTATTTCTAAAGATAAATCTAAATCTCAAGTTTTTTTCAAAATGAATTCTTTCCAAACCGATGATACCGCTATGTATTATTGTGCTCGTGAACGTAATGGTATGGATTATWGGTCAAGGTACCTCTGTTACCGTTTCTTCT
SEQ ID NO:5:
CGTGCAGATGCTGCACCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACATCTGGAGGTGCCTCAGTCGTGTGCTTCTTGAACAACTTCTACCCCAAAGACATCAATGTCAAGTGGAAGATTGATGGCAGTGAACGACAAAATGGCGTCCTGAACAGTTGGACTGATCAGGACAGCAAAGACAGCACCTACAGCATGAGCAGCACCCTCACGTTGACCAAGGACGAGTATGAACGACATAACAGCTATACCTGTGAGGCCACTCACAAGACATCAACTTCACCCATTGTCAAGAGCTTCAACAGGAATGAGTGTTAG
SEQ ID NO:6:
GCTAAAACGACACCCCCATCTGTCTATCCACTGGCCCCTGGATCTGCTGCCCAAACTAACTCCATGGTGACCCTGGGATGCCTGGTCAAGGGCTATTTCCCTGAGCCAGTGACAGTGACCTGGAACTCTGGATCCCTGTCCAGCGGTGTGCACACCTTCCCAGCTGTCCTGCAGTCTGACCTCTACACTCTGAGCAGCTCAGTGACTGTCCCCTCCAGCACCTGGCCCAGCGAGACCGTCACCTGCAACGTTGCCCACCCGGCCAGCAGCACCAAGGTGGACAAGAAAATTGTGCCCAGGGATTGTGGTTGTAAGCCTTGCATATGTACAGTCCCAGAAGTATCATCTGTCTTCATCTTCCCCCCAAAGCCCAAGGATGTGCTCACCATTACTCTGACTCCTAAGGTCACGTGTGTTGTGGTAGACATCAGCAAGGATGATCCCGAGGTCCAGTTCAGCTGGTTTGTAGATGATGTGGAGGTGCACACAGCTCAGACGCAACCCCGGGAGGAGCAGTTCAACAGCACTTTCCGCTCAGTCAGTGAACTTCCCATCATGCACCAGGACTGGCTCAATGGCAAGGAGTTCAAATGCAGGGTCAACAGTGCAGCTTTCCCTGCCCCCATCGAGAAAACCATCTCCAAAACCAAAGGCAGACCGAAGGCTCCGCAGGTGTACACCATTCCACCTCCCAAGGAGCAGATGGCCAAGGATAAAGTCAGTCTGACCTGCATGATAACAGACTTCTTCCCTGAAGACATTACTGTGGAGTGGCAGTGGAATGGGCAGCCAGCGGAGAACTACAAGAACACTCAGCCCATCATGGACACAGATGGCTCTTACTTCGTCTACAGCAAGCTCAATGTGCAGAAGAGCAACTGGGAGGCAGGAAATACTTTCACCTGCTCTGTGTTACATGAGGGCCTGCACAACCACCATACTGAGAAGAGCCTCTCCCACTCTCCTGGTAAATGA
SEQ ID NO:7:
QIVLTQSPAIMSCAQNLELPTMTCSASSSITYMHWYQQKSENILHHSPKIIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWRSDPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
SEQ ID NO:8:
CAAATTGTTTTCACCCAATCTCCTGCTATTATGTCTTGTGCTCAAAATTTCGAATTCCCTACCATGACCTGTTCTGCTTCTTCTTCTATTACCTATATGCATTGGTATCAACAAAAATCTGAAAATATTTTCCATCATTCTCCTAAAATTATTTATGATACCTCTAAATTCGCTTCTGGTGTTCCTGCTCGTTTTTCTGGTTCTGGTTCTGGTACCTCTTATTCTTTCACCATTTCTTCTATGGAAGCTGAAGATGCTGCTACCTATTATTGTCAACAATGGCGTTCTGATCCTCCTACCTTTGGTGGTGGTACCAAATTCGAAATTAAACGTGCAGATGCTGCACCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACATCTGGAGGTGCCTCAGTCGTGTGCTTCTTGAACAACTTCTACCCCAAAGACATCAATGTCAAGTGGAAGATTGATGGCAGTGAACGACAAAATGGCGTCCTGAACAGTTGGACTGATCAGGACAGCAAAGACAGCACCTACAGCATGAGCAGCACCCTCACGTTGACCAAGGACGAGTATGAACGACATAACAGCTATACCTGTGAGGCCACTCACAAGACATCAACTTCACCCATTGTCAAGAGCTTCAACAGGAATGAGTGTTAG
SEQ ID NO:9:
QVHLKESGPGLVASSQSLSITCQKSGTSPKRWGLHWVRQPPGKGGGELPIDWAGGTTNYNSALMSRLSISKDKSKSQVFLKMNSLQTDDTAMYYCARERNGMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
SEQ ID NO:10:
CAAGTTCATTTCAAAGAATCTGGTCCTGGTTTCGTTGCTTCTTCTCAATCTTTCTCTATTACCTGTCAAAAATCTGGTACCTCTCCTAAACGTWGGTTTCCATWGTTCGTCAACCTCCTGGTAAAGGTGGTGGTGAATTCCCTATTGATWGCTGGTGGTACCACCAATTATAATTCTGCTTTCATGTCTCGTTTCTCTATTTCTAAAGATAAATCTAAATCTCAAGTTTTTTTCAAAATGAATTCTTTCCAAACCGATGATACCGCTATGTATTATTGTGCTCGTGAACGTAATGGTATGGATTATWGGTCAAGGTACCTCTGTTACCGTTTCTTCTGCTAAAACGACACCCCCATCTGTCTATCCACTGGCCCCTGGATCTGCTGCCCAAACTAACTCCATGGTGACCCTGGGATGCCTGGTCAAGGGCTATTTCCCTGAGCCAGTGACAGTGACCTGGAACTCTGGATCCCTGTCCAGCGGTGTGCACACCTTCCCAGCTGTCCTGCAGTCTGACCTCTACACTCTGAGCAGCTCAGTGACTGTCCCCTCCAGCACCTGGCCCAGCGAGACCGTCACCTGCAACGTTGCCCACCCGGCCAGCAGCACCAAGGTGGACAAGAAAATTGTGCCCAGGGATTGTGGTTGTAAGCCTTGCATATGTACAGTCCCAGAAGTATCATCTGTCTTCATCTTCCCCCCAAAGCCCAAGGATGTGCTCACCATTACTCTGACTCCTAAGGTCACGTGTGTTGTGGTAGACATCAGCAAGGATGATCCCGAGGTCCAGTTCAGCTGGTTTGTAGATGATGTGGAGGTGCACACAGCTCAGACGCAACCCCGGGAGGAGCAGTTCAACAGCACTTTCCGCTCAGTCAGTGAACTTCCCATCATGCACCAGGACTGGCTCAATGGCAAGGAGTTCAAATGCAGGGTCAACAGTGCAGCTTTCCCTGCCCCCATCGAGAAAACCATCTCCAAAACCAAAGGCAGACCGAAGGCTCCGCAGGTGTACACCATTCCACCTCCCAAGGAGCAGATGGCCAAGGATAAAGTCAGTCTGACCTGCATGATAACAGACTTCTTCCCTGAAGACATTACTGTGGAGTGGCAGTGGAATGGGCAGCCAGCGGAGAACTACAAGAACACTCAGCCCATCATGGACACAGATGGCTCTTACTTCGTCTACAGCAAGCTCAATGTGCAGAAGAGCAACTGGGAGGCAGGAAATACTTTCACCTGCTCTGTGTTACATGAGGGCCTGCACAACCACCATACTGAGAAGAGCCTCTCCCACTCTCCTGGTAAATGA
the present invention is not limited to the above-mentioned embodiments, and any equivalent embodiments which can be changed or modified to equivalent changes by those skilled in the art can be applied to other fields by using the above-mentioned technical matters without departing from the technical matters of the present invention, and any simple modification, equivalent changes and modification to the above-mentioned embodiments according to the technical matters of the present invention still belong to the protection scope of the technical matters of the present invention.
Claims (7)
1. The thrombin-antithrombin complex antibody is characterized in that the light chain amino acid sequence of the antibody is shown as SEQ ID NO. 7, and the heavy chain amino acid sequence is shown as SEQ ID NO. 9.
2. The method for producing thrombin-antithrombin complex antibody according to claim 1, wherein: the method comprises the following steps:
s1: preparation of monoclonal antibodies
Immunizing a mouse with complete Freund's adjuvant and natural antigen, separating spleen cells, fusing the spleen cells with SP2/0 cells under the action of a PEG fusion agent, and screening monoclonal antibodies on a HAT selection medium;
s2: acquisition of monoclonal antibody sequences
Extracting RNA of the hybridoma cell strain obtained in the step S1, amplifying sequences of DNA of light chain and heavy chain variable regions of the antibody by RT-PCR, and sequencing the amplified DNA sequences;
s3: construction of monoclonal antibody sequences
Light chain: adding the DNA sequence of the light chain variable region obtained by sequencing in the S2 to the DNA sequence of the IgK conserved region of the mouse antibody;
heavy chain: adding the heavy chain variable region DNA sequence obtained by sequencing in the step S2 to the IgG1 conserved region DNA sequence;
s4: expression of monoclonal antibodies
Constructing antibody light chain and heavy chain expression vectors by utilizing a genetic engineering technology, transfecting the vectors into a CHO cell line to obtain a CHO cell line capable of generating thrombin-antithrombin complex antibodies, and carrying out stable expression of the antibodies;
s5: monoclonal antibodies were purified using protein G sepharose.
3. The method for producing thrombin-antithrombin complex antibody according to claim 2, wherein: in the step S2, the 5' end primer sequence is as follows: ATTGT CCTTA ATGGG GGG
Light chain hybrid primer:
5'-ACAGT TGGTG CAGCA TCTGC-3' (IgK conserved 5' -end reverse primer),
5'-GGCGA AGACT TGGGC TGGCC-3' (reverse primer at 5' end of IgL1 conserved region),
5'-GGAGT GGACT TGGGC TGACC-3' (IgL 2 conserved 5' -end reverse primer);
heavy chain hybrid primer:
5'-CTAGG GGGTG TCGTT TTAGC-3' (reverse primer 5' to the IgG1 conserved region),
5'-GATGG GGCTG TTGTT TTAGC-3' (reverse primer 5' to the IgG2a conserved region),
5'-GATGG GGGTG TTGTT TTAGC-3' (reverse primer 5' to the IgG2b conserved region),
5'-GATGG GGCTG TTGTT GTAGC-3' (reverse primer 5' to IgG3 conserved region).
4. The method for producing thrombin-antithrombin complex antibody according to claim 2, wherein: in step S1, spleen cells fused with myeloma cells are cell suspensions prepared by taking spleen on the third day after last immunization, and the cell suspensions are prepared according to the following ratio of 1:6 to 1:10, and cell fusion under the action of PEG.
5. The method for producing thrombin-antithrombin complex antibody according to claim 2, wherein: the preservation number of the CHO cell strain capable of producing thrombin-antithrombin complex antibodies is CCTCC NO: C202201.
6. The use of a thrombin-antithrombin complex antibody according to claim 1 in an immunonephelometric in vitro diagnostic kit.
7. The use of thrombin-antithrombin complex antibodies according to claim 6 in an immunonephelometric in vitro diagnostic kit, characterized in that: the kit comprises an R1 reagent and an R2 reagent, wherein the R2 reagent comprises TAT monoclonal antibody latex, bovine serum albumin and ProClin 300.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310089381.4A CN116284417B (en) | 2023-02-09 | 2023-02-09 | Thrombin-antithrombin complex antibody, its preparation method and application |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310089381.4A CN116284417B (en) | 2023-02-09 | 2023-02-09 | Thrombin-antithrombin complex antibody, its preparation method and application |
Publications (2)
Publication Number | Publication Date |
---|---|
CN116284417A true CN116284417A (en) | 2023-06-23 |
CN116284417B CN116284417B (en) | 2023-10-31 |
Family
ID=86827821
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202310089381.4A Active CN116284417B (en) | 2023-02-09 | 2023-02-09 | Thrombin-antithrombin complex antibody, its preparation method and application |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN116284417B (en) |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1994024566A1 (en) * | 1993-04-15 | 1994-10-27 | Baxter Diagnostics Inc. | Immunoassay and test kit for thrombin-antithrombin iii complex |
EP0640621A2 (en) * | 1993-08-24 | 1995-03-01 | Oriental Yeast Co., Ltd. | Anti-thrombin monoclonal antibody |
CN111007250A (en) * | 2019-12-10 | 2020-04-14 | 江苏三联生物工程有限公司 | Electrochemiluminescence kit for detecting TAT (thrombin-antithrombin complex) and preparation method |
CN111948406A (en) * | 2020-08-31 | 2020-11-17 | 浙江盛域医疗技术有限公司 | Time-resolved fluoroimmunoassay kit for detecting thrombin-antithrombin complex and application thereof |
CN114689875A (en) * | 2022-06-02 | 2022-07-01 | 深圳市帝迈生物技术有限公司 | Kit for determining TAT content and preparation method thereof |
-
2023
- 2023-02-09 CN CN202310089381.4A patent/CN116284417B/en active Active
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1994024566A1 (en) * | 1993-04-15 | 1994-10-27 | Baxter Diagnostics Inc. | Immunoassay and test kit for thrombin-antithrombin iii complex |
EP0640621A2 (en) * | 1993-08-24 | 1995-03-01 | Oriental Yeast Co., Ltd. | Anti-thrombin monoclonal antibody |
CN111007250A (en) * | 2019-12-10 | 2020-04-14 | 江苏三联生物工程有限公司 | Electrochemiluminescence kit for detecting TAT (thrombin-antithrombin complex) and preparation method |
CN111948406A (en) * | 2020-08-31 | 2020-11-17 | 浙江盛域医疗技术有限公司 | Time-resolved fluoroimmunoassay kit for detecting thrombin-antithrombin complex and application thereof |
CN114689875A (en) * | 2022-06-02 | 2022-07-01 | 深圳市帝迈生物技术有限公司 | Kit for determining TAT content and preparation method thereof |
Also Published As
Publication number | Publication date |
---|---|
CN116284417B (en) | 2023-10-31 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
JP5807300B2 (en) | Method and reagent for measuring C-reactive protein in sample | |
CN111748033B (en) | Separation antibody combined with novel coronavirus NP protein and detection kit containing same | |
CN110372783A (en) | The preparation method and adiponectin detection kit of a kind of adiponectin antigen, antibody and its emulsion reagent | |
CN116536269B (en) | CHO cell strain, fibrinogen degradation product FDP antibody and application thereof | |
CN102914651A (en) | Method and kit for detecting myeloperoxidase (MPO) | |
CN114133452B (en) | Heparin binding protein antibody, kit and application thereof | |
CN117720650B (en) | Anti-human respiratory syncytial virus antibody and application thereof | |
CN116284417B (en) | Thrombin-antithrombin complex antibody, its preparation method and application | |
CN117003878A (en) | Monoclonal antibody composition for resisting sFLT-1 protein and application thereof | |
CN117327185A (en) | anti-D-dimer monoclonal antibody, preparation method, composition and kit thereof | |
CN113717285B (en) | Anti-human D-dimer antibodies and uses thereof | |
CN115948342B (en) | CHO cell strain, D-dimer monoclonal antibody and application thereof | |
CN116284415B (en) | Plasmin-alpha 2 anti-plasmin complex monoclonal antibody, preparation and application thereof | |
NO172084B (en) | MONOCLONAL ANTIBODY, USE thereof AND REAGENT SYSTEM FOR IMMUNOLOGICAL DETERMINATION OF FREE PROTEIN S AND C4BP PROTEIN S COMPLEX | |
TW202210525A (en) | Rabbit antibodies to human immunoglobulins g | |
CN113683684A (en) | Anti-hepatitis B virus surface antigen antibody, antibody pair, detection reagent containing same and kit | |
CN117683121B (en) | Anti-varicella-zoster virus antibodies and uses thereof | |
CN117866100B (en) | Single-domain antibodies or antigen-binding fragments thereof directed against D-dimer and related biomaterials and uses thereof | |
CN105987998B (en) | Human tissue kallikrein 1ELISA immue quantitative detection reagent boxes | |
CN105988004B (en) | The collaurum quantitative testing test paper card of human tissue kallikrein 1 | |
CN105985436B (en) | Anti-human kininogenase antibody and its application | |
CN117285637B (en) | Anti-idiotype antibody and application thereof | |
JPH07313186A (en) | Anti-pivka-ii monoclonal antibody | |
CN117285635B (en) | Monoclonal antibody composition for resisting heparin binding protein and application thereof | |
WO2023088443A1 (en) | Anti-human igm antibody and preparation method therefor and use thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |