CN116284281A - Recombinant protein of clostridium perfringens G, vaccine and application - Google Patents
Recombinant protein of clostridium perfringens G, vaccine and application Download PDFInfo
- Publication number
- CN116284281A CN116284281A CN202310209976.9A CN202310209976A CN116284281A CN 116284281 A CN116284281 A CN 116284281A CN 202310209976 A CN202310209976 A CN 202310209976A CN 116284281 A CN116284281 A CN 116284281A
- Authority
- CN
- China
- Prior art keywords
- vaccine
- recombinant protein
- clostridium perfringens
- nucleic acid
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 229960005486 vaccine Drugs 0.000 title claims abstract description 35
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 title claims abstract description 32
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 title claims abstract description 32
- 241000193468 Clostridium perfringens Species 0.000 title claims abstract description 28
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 16
- 238000002360 preparation method Methods 0.000 claims abstract description 7
- 210000004027 cell Anatomy 0.000 claims description 40
- 150000007523 nucleic acids Chemical class 0.000 claims description 29
- 108020004707 nucleic acids Proteins 0.000 claims description 28
- 102000039446 nucleic acids Human genes 0.000 claims description 28
- 239000013598 vector Substances 0.000 claims description 23
- 239000002671 adjuvant Substances 0.000 claims description 16
- 210000001236 prokaryotic cell Anatomy 0.000 claims description 4
- 239000003814 drug Substances 0.000 claims description 3
- 208000015181 infectious disease Diseases 0.000 claims description 3
- 238000011282 treatment Methods 0.000 claims description 3
- 238000002255 vaccination Methods 0.000 claims description 3
- 230000002265 prevention Effects 0.000 claims description 2
- 241000287828 Gallus gallus Species 0.000 abstract description 13
- 235000013330 chicken meat Nutrition 0.000 abstract description 12
- 230000003053 immunization Effects 0.000 abstract description 8
- 208000004232 Enteritis Diseases 0.000 abstract description 7
- 238000002649 immunization Methods 0.000 abstract description 7
- 230000001338 necrotic effect Effects 0.000 abstract description 7
- 108090000623 proteins and genes Proteins 0.000 description 19
- 241000271566 Aves Species 0.000 description 13
- 125000003729 nucleotide group Chemical group 0.000 description 13
- 239000002773 nucleotide Substances 0.000 description 12
- 230000001580 bacterial effect Effects 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- 239000002244 precipitate Substances 0.000 description 10
- 102000004169 proteins and genes Human genes 0.000 description 10
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 9
- 108090000765 processed proteins & peptides Proteins 0.000 description 9
- 239000013612 plasmid Substances 0.000 description 8
- 229920001184 polypeptide Polymers 0.000 description 8
- 102000004196 processed proteins & peptides Human genes 0.000 description 8
- 238000005406 washing Methods 0.000 description 8
- 241000894006 Bacteria Species 0.000 description 7
- 238000012258 culturing Methods 0.000 description 7
- 241001465754 Metazoa Species 0.000 description 6
- 239000012634 fragment Substances 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- 238000000034 method Methods 0.000 description 6
- 230000004048 modification Effects 0.000 description 6
- 238000012986 modification Methods 0.000 description 6
- 235000018102 proteins Nutrition 0.000 description 6
- 238000012216 screening Methods 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- 239000003053 toxin Substances 0.000 description 6
- 231100000765 toxin Toxicity 0.000 description 6
- 108700012359 toxins Proteins 0.000 description 6
- 108020004705 Codon Proteins 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 5
- 239000001963 growth medium Substances 0.000 description 5
- 230000003902 lesion Effects 0.000 description 5
- 230000004083 survival effect Effects 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- 241000272517 Anseriformes Species 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- 235000001014 amino acid Nutrition 0.000 description 4
- 235000021053 average weight gain Nutrition 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 108091006047 fluorescent proteins Proteins 0.000 description 4
- 102000034287 fluorescent proteins Human genes 0.000 description 4
- 230000014509 gene expression Effects 0.000 description 4
- 239000005090 green fluorescent protein Substances 0.000 description 4
- 229940126578 oral vaccine Drugs 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 235000019786 weight gain Nutrition 0.000 description 4
- 230000004584 weight gain Effects 0.000 description 4
- 241000282412 Homo Species 0.000 description 3
- 241000186660 Lactobacillus Species 0.000 description 3
- 206010028851 Necrosis Diseases 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- 208000025865 Ulcer Diseases 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 229940088710 antibiotic agent Drugs 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 229930027917 kanamycin Natural products 0.000 description 3
- 229960000318 kanamycin Drugs 0.000 description 3
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 3
- 229930182823 kanamycin A Natural products 0.000 description 3
- 229940039696 lactobacillus Drugs 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 230000017074 necrotic cell death Effects 0.000 description 3
- 239000012071 phase Substances 0.000 description 3
- 244000144977 poultry Species 0.000 description 3
- 235000013594 poultry meat Nutrition 0.000 description 3
- 108010054624 red fluorescent protein Proteins 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 230000005730 ADP ribosylation Effects 0.000 description 2
- 101710092462 Alpha-hemolysin Proteins 0.000 description 2
- 101710197219 Alpha-toxin Proteins 0.000 description 2
- 101100133212 Drosophila melanogaster NetB gene Proteins 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 2
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 2
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 101710124951 Phospholipase C Proteins 0.000 description 2
- 239000002776 alpha toxin Substances 0.000 description 2
- 229940037003 alum Drugs 0.000 description 2
- 150000001413 amino acids Chemical class 0.000 description 2
- 210000004102 animal cell Anatomy 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 239000008346 aqueous phase Substances 0.000 description 2
- 210000004436 artificial bacterial chromosome Anatomy 0.000 description 2
- 210000004507 artificial chromosome Anatomy 0.000 description 2
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- 108091005948 blue fluorescent proteins Proteins 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 210000004534 cecum Anatomy 0.000 description 2
- 238000007385 chemical modification Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 238000004132 cross linking Methods 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 210000001198 duodenum Anatomy 0.000 description 2
- 238000001976 enzyme digestion Methods 0.000 description 2
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 2
- 230000006251 gamma-carboxylation Effects 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 230000003903 intestinal lesions Effects 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 210000001630 jejunum Anatomy 0.000 description 2
- 238000009630 liquid culture Methods 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 230000011987 methylation Effects 0.000 description 2
- 238000007069 methylation reaction Methods 0.000 description 2
- JXTPJDDICSTXJX-UHFFFAOYSA-N n-Triacontane Natural products CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC JXTPJDDICSTXJX-UHFFFAOYSA-N 0.000 description 2
- 238000005457 optimization Methods 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 229940032094 squalane Drugs 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 230000019635 sulfation Effects 0.000 description 2
- 238000005670 sulfation reaction Methods 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 231100000397 ulcer Toxicity 0.000 description 2
- 108091005957 yellow fluorescent proteins Proteins 0.000 description 2
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- ODHCTXKNWHHXJC-VKHMYHEASA-N 5-oxo-L-proline Chemical compound OC(=O)[C@@H]1CCC(=O)N1 ODHCTXKNWHHXJC-VKHMYHEASA-N 0.000 description 1
- 108010042708 Acetylmuramyl-Alanyl-Isoglutamine Proteins 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 206010061043 Clostridial infection Diseases 0.000 description 1
- 208000037384 Clostridium Infections Diseases 0.000 description 1
- 241000224483 Coccidia Species 0.000 description 1
- 241000272201 Columbiformes Species 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 108091005941 EBFP Proteins 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 241001524679 Escherichia virus M13 Species 0.000 description 1
- 108010040721 Flagellin Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 108090000604 Hydrolases Proteins 0.000 description 1
- 102000004157 Hydrolases Human genes 0.000 description 1
- VHJLVAABSRFDPM-IMJSIDKUSA-N L-1,4-dithiothreitol Chemical compound SC[C@H](O)[C@@H](O)CS VHJLVAABSRFDPM-IMJSIDKUSA-N 0.000 description 1
- 241000713666 Lentivirus Species 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 241000286209 Phasianidae Species 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- ODHCTXKNWHHXJC-GSVOUGTGSA-N Pyroglutamic acid Natural products OC(=O)[C@H]1CCC(=O)N1 ODHCTXKNWHHXJC-GSVOUGTGSA-N 0.000 description 1
- AUNGANRZJHBGPY-SCRDCRAPSA-N Riboflavin Chemical compound OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-SCRDCRAPSA-N 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 108010008038 Synthetic Vaccines Proteins 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229930003779 Vitamin B12 Natural products 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- ODHCTXKNWHHXJC-UHFFFAOYSA-N acide pyroglutamique Natural products OC(=O)C1CCC(=O)N1 ODHCTXKNWHHXJC-UHFFFAOYSA-N 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000001408 amides Chemical group 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 230000010516 arginylation Effects 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000032770 biofilm formation Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 159000000007 calcium salts Chemical class 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- AGVAZMGAQJOSFJ-WZHZPDAFSA-M cobalt(2+);[(2r,3s,4r,5s)-5-(5,6-dimethylbenzimidazol-1-yl)-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl] [(2r)-1-[3-[(1r,2r,3r,4z,7s,9z,12s,13s,14z,17s,18s,19r)-2,13,18-tris(2-amino-2-oxoethyl)-7,12,17-tris(3-amino-3-oxopropyl)-3,5,8,8,13,15,18,19-octamethyl-2 Chemical compound [Co+2].N#[C-].[N-]([C@@H]1[C@H](CC(N)=O)[C@@]2(C)CCC(=O)NC[C@@H](C)OP(O)(=O)O[C@H]3[C@H]([C@H](O[C@@H]3CO)N3C4=CC(C)=C(C)C=C4N=C3)O)\C2=C(C)/C([C@H](C\2(C)C)CCC(N)=O)=N/C/2=C\C([C@H]([C@@]/2(CC(N)=O)C)CCC(N)=O)=N\C\2=C(C)/C2=N[C@]1(C)[C@@](C)(CC(N)=O)[C@@H]2CCC(N)=O AGVAZMGAQJOSFJ-WZHZPDAFSA-M 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 230000017858 demethylation Effects 0.000 description 1
- 238000010520 demethylation reaction Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 238000007599 discharging Methods 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- 239000003651 drinking water Substances 0.000 description 1
- 235000020188 drinking water Nutrition 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 235000013601 eggs Nutrition 0.000 description 1
- 239000003480 eluent Substances 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 210000002257 embryonic structure Anatomy 0.000 description 1
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000000688 enterotoxigenic effect Effects 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 231100000776 exotoxin Toxicity 0.000 description 1
- 239000002095 exotoxin Substances 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 108010021843 fluorescent protein 583 Proteins 0.000 description 1
- 229960000304 folic acid Drugs 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 238000005755 formation reaction Methods 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 1
- 150000003278 haem Chemical group 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 239000000416 hydrocolloid Substances 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 210000003405 ileum Anatomy 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 210000004347 intestinal mucosa Anatomy 0.000 description 1
- 230000026045 iodination Effects 0.000 description 1
- 238000006192 iodination reaction Methods 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- IAQLJCYTGRMXMA-UHFFFAOYSA-M lithium;acetate;dihydrate Chemical compound [Li+].O.O.CC([O-])=O IAQLJCYTGRMXMA-UHFFFAOYSA-M 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 1
- BSOQXXWZTUDTEL-ZUYCGGNHSA-N muramyl dipeptide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](O)[C@@H]1NC(C)=O BSOQXXWZTUDTEL-ZUYCGGNHSA-N 0.000 description 1
- 230000007498 myristoylation Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 208000003154 papilloma Diseases 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- 150000003905 phosphatidylinositols Chemical class 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229940115272 polyinosinic:polycytidylic acid Drugs 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000013823 prenylation Effects 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 230000006340 racemization Effects 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 239000013049 sediment Substances 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 229940031439 squalene Drugs 0.000 description 1
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 1
- YYGNTYWPHWGJRM-AAJYLUCBSA-N squalene Chemical compound CC(C)=CCC\C(C)=C\CC\C(C)=C\CC\C=C(/C)CC\C=C(/C)CCC=C(C)C YYGNTYWPHWGJRM-AAJYLUCBSA-N 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 230000036269 ulceration Effects 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 230000002477 vacuolizing effect Effects 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 235000019163 vitamin B12 Nutrition 0.000 description 1
- 239000011715 vitamin B12 Substances 0.000 description 1
- 239000007762 w/o emulsion Substances 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/33—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Clostridium (G)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/08—Clostridium, e.g. Clostridium tetani
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/01—Bacteria or Actinomycetales ; using bacteria or Actinomycetales
- C12R2001/185—Escherichia
- C12R2001/19—Escherichia coli
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Physics & Mathematics (AREA)
- Mycology (AREA)
- Immunology (AREA)
- Gastroenterology & Hepatology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Epidemiology (AREA)
- Plant Pathology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The application provides a recombinant protein of clostridium perfringens G, a vaccine and application thereof. Specifically, the recombinant protein of clostridium perfringens type G has an amino acid sequence shown in SEQ ID No. 3. Through immunization of the recombinant protein, necrotic enteritis of chickens caused by clostridium perfringens G can be effectively prevented; and has the characteristics of safety, reliability, simple preparation method and the like.
Description
Technical Field
The application relates to the field of biotechnology, in particular to a recombinant protein of clostridium perfringens type G, a vaccine and application.
Background
Clostridium perfringens (Clostridium perfringens) is widely distributed in the intestinal tract of humans, animals and birds. Clostridium perfringens can infect many tissues of humans and animals, causing enterotoxigenic diseases; the sliding movement of the bacteria is related to its toxic function, contributing to the adhesion capacity of the strain and to the biofilm formation.
The toxicity of clostridium perfringens can be attributed to its possession of more than 20 strong toxins and hydrolases. Clostridium perfringens can produce a variety of exotoxins and invasive enzymes depending on the mode of toxin production of the different strains, and the strains can be classified into seven toxin types (type a, type B, type C, type D, type E, type F, and type G) depending on the type of toxin produced. Among them, clostridium perfringens type G is the main pathogenic bacterium of necrotic enteritis (Necrotic enteritis, NE) in birds.
Currently, the poultry industry is primarily concerned with the prophylactic treatment of necrotic enteritis in poultry by the use of antibiotics. However, more and more bacteria are reported to develop resistance to antibiotics, and thus there is an urgent need for a safe and effective method for preventing necrotic enteritis in birds.
Disclosure of Invention
Based on the above, the application provides a recombinant protein of clostridium perfringens G, vaccine and application, wherein the recombinant protein can effectively prevent and treat necrotic enteritis of birds.
According to one aspect of the present application, there is provided a recombinant protein of clostridium perfringens type G having the amino acid sequence shown in SEQ ID No. 3.
An isolated nucleic acid encoding the recombinant protein described above.
In one embodiment, the nucleic acid has a sequence as shown in SEQ ID NO.1 or SEQ ID NO. 2.
A recombinant vector comprising the nucleic acid described above.
A host cell having incorporated into its genome the nucleic acid described above or the recombinant vector described above.
In one embodiment, the host cell is a prokaryotic cell.
A vaccine comprising the recombinant protein, the nucleic acid or the recombinant vector.
In one embodiment, an adjuvant is also included.
Kit of parts comprising a vaccine as described above, and a container for the vaccination of said vaccine.
According to another aspect of the present application, there is provided the use of the recombinant protein, the nucleic acid or the recombinant vector described above for the preparation of a medicament for the prevention and treatment of clostridium perfringens type G infection.
Compared with the prior art, the method has the following beneficial effects:
the application develops recombinant proteins with the amino acid sequences shown as SEQ ID NO.3 aiming at alpha toxin and NetB toxin of clostridium perfringens G. The recombinant protein can generate effective immune protection to clostridium perfringens G, and has the characteristics of safety, stability, no toxic or side effect and the like.
In addition, the recombinant protein can be used in the form of a molecular vaccine or an oral vaccine, and is effective in preventing and treating necrotic enteritis of poultry caused by clostridium perfringens G.
Drawings
In order to more clearly illustrate the technical solutions in the embodiments of the present application and to more fully understand the present application and its advantageous effects, the following brief description will be given with reference to the accompanying drawings, which are required to be used in the description of the embodiments. It is obvious that the drawings in the following description are only some embodiments of the present application, and that other drawings may be obtained from these drawings without inventive effort to a person skilled in the art.
FIG. 1 is a map of a recombinant plasmid constructed in example 2 of the present application;
FIG. 2 is a gel electrophoresis chart of colony PCR identification in example 2 of the present application;
FIG. 3 is a graph showing the purification and identification results of recombinant proteins in example 2 of the present application;
FIG. 4 is a map of a recombinant plasmid constructed in example 3 of the present application;
FIG. 5 is a gel electrophoresis chart of colony PCR identification in example 3 of the present application;
FIG. 6 is a graph showing results of intestinal lesions of chicken in example 4 of the present application.
Detailed Description
The detailed description of the embodiments of the present application will be presented in order to make the above objects, features and advantages of the present application more obvious and understandable. In the following description, numerous specific details are set forth in order to provide a thorough understanding of the present application. This application is, however, susceptible of embodiment in many other forms than those described herein and similar modifications can be made by those skilled in the art without departing from the spirit of the application, and therefore the application is not to be limited to the specific embodiments disclosed below.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this application belongs. The terminology used herein in the description of the application is for the purpose of describing particular embodiments only and is not intended to be limiting of the application. Unless specifically indicated otherwise, the various raw materials, reagents, instruments, equipment, and the like used in the present application are commercially available or may be prepared by existing methods.
The term "and/or," "and/or," as used herein, includes any one of two or more of the listed items in relation to each other, as well as any and all combinations of the listed items in relation to each other, including any two of the listed items in relation to each other, any more of the listed items in relation to each other, or all combinations of the listed items in relation to each other. It should be noted that, when at least three items are connected by a combination of at least two conjunctions selected from "and/or", "or/and", "and/or", it should be understood that, in this application, the technical solutions certainly include technical solutions that all use "logical and" connection, and also certainly include technical solutions that all use "logical or" connection. For example, "a and/or B" includes three parallel schemes A, B and a+b. For another example, the technical schemes of "a, and/or B, and/or C, and/or D" include any one of A, B, C, D (i.e., the technical scheme of "logical or" connection), and also include any and all combinations of A, B, C, D, i.e., any two or three of A, B, C, D, and also include four combinations of A, B, C, D (i.e., the technical scheme of "logical and" connection).
Some embodiments of the present application provide a recombinant protein of clostridium perfringens type G having the amino acid sequence shown in SEQ ID No. 3.
Specifically, the amino acid sequence shown in SEQ ID NO.3 is:
MGSDPSVGNNVKELVAYISTSGEKDAGTDDYMYFGIKTKDGKTQEWEMDNPGNDFMAGSKDTYTFKLKDENLKIDDIQNMWIRKRKYTAFPDAYKPENIKVIANGKVVVDKDINEWEAAAKYYGKMKWPETYRINVKSADVNNNIKIANSIPKNTIDKKDVSNSIGYSIGGNISVEGKTAGAGINASYNVQNTISYEQPDFRTIQRKDDANLASWDIKFVETKDGYNIDSYHAIYGNQLFMKSRLYNNGLE
the present application also provides an isolated nucleic acid encoding the recombinant protein described above.
The nucleic acid may be RNA or DNA.
In some of these embodiments, the nucleotide sequence of the above-described nucleic acid is codon optimized for a different host cell.
The codon optimization refers to optimizing a target gene by utilizing a preferred codon of a host cell under the condition of not changing an amino acid sequence, and improving the expression efficiency of the recombinant protein.
In some embodiments, the nucleic acid has a nucleotide sequence as set forth in SEQ ID NO.1 or SEQ ID NO. 2.
In addition, the amino acid sequence of the recombinant protein can be further matched with a sequence selected from SEQ ID NO:3, and a sequence substantially similar to the amino acid sequence of 3. The nucleotide sequence of the nucleic acid may also be identical to a nucleotide sequence selected from the group consisting of SEQ ID NOs: 1 or SEQ ID NO. 2. By "substantially similar" is meant that a given nucleic acid or amino acid sequence shares at least 95% identity with a reference sequence, e.g., 96%, 97%, 98%, 98.5%, 99%, 99.5%. Alternatively, it is meant that a given nucleic acid or amino acid sequence has a 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 nucleic acid or amino acid difference from a reference sequence, which difference is preferably an amino acid substitution or deletion for a polypeptide. Preferably, substantially similar sequences also retain the unique activity of the polypeptide that is highly efficient in detecting endogenous antibodies. Substitutions are generally considered to be conservative substitutions, such as substitutions in aliphatic amino acids Ala, val, leu and Ile with each other, exchanges of hydroxyl residues Ser and Thr, exchanges of acidic residues Asp and Glu, exchanges between amide residues Asn and Gln, exchanges of basic residues Lys and Arg, and exchanges between aromatic residues Phe, tyr.
The "substantially similar" amino acid sequence may also be a derivative of the polypeptide shown in SEQ ID NO. 3. The term "derivative" refers to a chemically modified protein or polypeptide that has been chemically modified by natural processes (such as processing and other post-translational modifications) as well as by chemical modification techniques, such as by the addition of one or more polyethylene glycol molecules, sugars, phosphates, and/or other such molecules, wherein one or more molecules are not naturally attached to the wild-type protein. Derivatives include salts. Such chemical modifications are described in detail in basic textbooks and in more detailed monographs, as well as in a number of research literature, and are well known to those skilled in the art. It will be appreciated that the same type of modification may be present at several sites in a given protein or polypeptide to the same or different extents. In addition, a given protein or polypeptide may contain many types of modifications. Modifications can occur anywhere in the protein or polypeptide, including the peptide backbone, amino acid side chains, and amino or carboxyl termini. Modifications include, for example, acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphatidylinositol, crosslinking, cyclization, disulfide bond formation, demethylation, covalent crosslinking formation, cysteine formation, pyroglutamic acid formation, methylation, gamma-carboxylation, glycosylation, GPI-anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, glycosylation, lipid attachment, sulfation, gamma-carboxylation of glutamic acid residues, hydrocarbylation and ADP-ribosylation, selenization, sulfation, transfer RNA-mediated addition of amino acids of proteins (such as arginylation), and ubiquitination. They may also bind to vitamins, such as biotin, folic acid, or vitamin B12.
The application also relates to a recombinant vector containing the nucleic acid.
The term "vector" refers to a nucleic acid vehicle into which a polynucleotide may be inserted. When a vector enables expression of a protein encoded by an inserted polynucleotide, the vector is referred to as an expression vector. The vector may be introduced into a host cell by transformation, transduction or transfection such that the genetic material elements carried thereby are expressed in the host cell. Vectors are well known to those skilled in the art and include, but are not limited to: a plasmid; phagemid; a cosmid; artificial chromosomes, such as Yeast Artificial Chromosome (YAC), bacterial Artificial Chromosome (BAC), or P1-derived artificial chromosome (PAC); phages such as lambda phage or M13 phage, animal viruses, etc. Animal viruses that may be used as vectors include, but are not limited to, retrovirus (including lentivirus), adenovirus, adeno-associated virus, herpes virus (e.g., herpes simplex virus), poxvirus, baculovirus, papilloma virus, papilloma vacuolation virus (e.g., SV 40). In some embodiments, the vectors described herein contain regulatory elements commonly used in genetic engineering, such as enhancers, promoters, internal Ribosome Entry Sites (IRES), and other expression control elements (e.g., transcription termination signals, or polyadenylation signals, and poly U sequences, etc.).
In some embodiments, the vectors described herein may further comprise fragments of genes used in screening (e.g., antibiotic resistance genes), nucleic acids for generating fluorescent proteins, and the like. The fluorescent protein may be selected from green fluorescent protein, blue fluorescent protein, yellow fluorescent protein, orange fluorescent protein or red fluorescent protein.
The green fluorescent protein can adopt common GFP, and also can adopt modified GFP genes, such as enhanced GFP gene EGFP and the like; the blue fluorescent protein may be selected from EBFP, azuritc, tagBFP and the like; the yellow fluorescent protein may be selected from EYFP, ypct, phiYFP and the like; the orange fluorescent protein may be selected from mKO, mOrange, mBanana and the like; the red fluorescent protein may be selected from TagRFP, mRuby, mCherry, mKate and the like.
The present application also relates to a host cell, the genome of which is incorporated with the nucleic acid described above or the vector described above.
In some of these embodiments, the host cells of the present application are transformed with the vectors described above.
The term "host cell" refers to a cell that can be used to introduce a vector, including, but not limited to: prokaryotic cells such as E.coli, lactobacillus or Bacillus subtilis; fungal cells such as yeast cells or aspergillus, insect cells such as S2 drosophila cells or Sf9, or animal cells such as fibroblasts, CHO cells, COS cells, NSO cells, heLa cells, BHK cells, HEK-293 cells or human cells. Host cells are generally not totipotent animal cells (preferably avian cells, such as chicken cells), e.g., do not include fertilized eggs, embryos, germ stem cells, embryonic stem cells, and the like. Preferably, the host cell is a prokaryotic cell; more preferably E.coli or Lactobacillus.
The present application also relates to a vaccine comprising the recombinant polypeptide, the nucleic acid or the vector.
In some embodiments, the vaccine described above further comprises an adjuvant. Adjuvants suitable for use in the vaccines of the present application include adjuvants that enhance or amplify the immune response of antibodies, as well as adjuvants that enhance cell-mediated T cell epitope responses. Such adjuvants are well known in the art.
In some embodiments, the above-described adjuvant is selected from one or more of alum, complete Freund's adjuvant, incomplete Freund's adjuvant, squalene, squalane, muramyl dipeptide, MF59, AS03, monophosphoryl lipid A, flagellin, cpG-ODN, poly (I: C), and small molecules of aluminum or calcium salts. These adjuvants are well known in the art and are available from several commercial sources. Among them, complete Freund's adjuvant, incomplete Freund's adjuvant, squalane and alum are generally not used in humans. When added, the amount of adjuvant in the vaccine is typically between about 1% (v/v) and 20% (v/v). In particular embodiments, the amount of the adjuvant is between about 2% (v/v) and 10% (v/v). In more specific embodiments, the amount of the adjuvant is between about 3% (v/v) and 6% (v/v).
In some embodiments, the vaccine described above further comprises a pharmaceutically acceptable carrier.
A "pharmaceutically acceptable carrier" is intended to aid in the stabilization and administration of the vaccine while being harmless and well tolerated by the target. Such carriers may be, for example, sterile water or sterile physiological saline solution. In more complex forms, the carrier may be, for example, a buffer, which may contain further additives, such as stabilizers or preservatives. Aqueous or aqueous saline solutions and aqueous solutions of sugars (e.g., dextrose and/or glycerol) can be employed as carriers, particularly for injectable solutions. Furthermore, the carrier may be and/or comprise a hydrocolloid and/or a polymer solution, for example, to thicken an avian vaccine to be sprayed on an avian.
In some embodiments, the vaccine is a water-in-oil emulsion having an aqueous phase and an oil phase.
In some embodiments, the vaccine is an oil-in-water emulsion having an aqueous phase and an oil phase.
Further, the vaccine comprises an inactivated virus and/or an inactivated bacterium (e.g., vaccine) and/or an antigen of the vaccine. This may be derived from the microorganism pathogenic to avians in any suitable manner, for example as a "live" attenuated, inactivated or subunit antigen.
Typical immunization is achieved by Subcutaneous (SC) or Intramuscular (IM) injection, or the vaccine may also be administered via a transdermal patch, in a delayed release implant, scarification or topical application. Administration may also be via drinking water and/or food of the recipient bird.
The present application also relates to a kit of parts comprising a vaccine as described above, and a container for the vaccination of said vaccine.
The application also relates to a preparation method of the vaccine, which comprises the following steps:
culturing the above host cells under proper conditions, collecting culture solution and/or lysate of host cells, and separating and purifying to obtain the vaccine.
The application also relates to application of the recombinant protein, the nucleic acid or the recombinant vector in preparation of medicines for preventing and treating G clostridium perfringens infection.
The present application further provides a method of protecting an avian from clostridium perfringens type G infection comprising administering to an avian animal a prophylactically effective amount/therapeutically effective amount of a vaccine of the present application.
The term "avian" refers to wild or domesticated birds, particularly chickens, ducks, geese, swans, geese, pigeons, quails and the like.
Factors influencing the preferred dosage regimen may include, for example, the species or variety of subject (e.g., the species or variety of avian), age, weight, diet, activity, lung size, and condition; route of administration; efficacy, safety, and immunization duration profile of the particular vaccine used; whether a delivery system is used; and whether the vaccine is administered as part of a pharmaceutical and/or vaccine combination. Thus, the dosages actually employed may vary for a particular animal and may therefore deviate from the typical dosages described above. Determination of such dose adjustments is generally within the skill of those skilled in the art of vaccine development using conventional methods.
The present application will be further described with reference to specific examples and comparative examples, which should not be construed as limiting the scope of the present application.
Example 1: screening of coding genes
The amino acid sequence shown as SEQ ID NO.3 is obtained by screening aiming at alpha toxin and NetB toxin of clostridium perfringens G.
The amino acid sequence shown in SEQ ID NO.3 is:
MGSDPSVGNNVKELVAYISTSGEKDAGTDDYMYFGIKTKDGKTQEWEMDNPGNDFMAGSKDTYTFKLKDENLKIDDIQNMWIRKRKYTAFPDAYKPENIKVIANGKVVVDKDINEWEAAAKYYGKMKWPETYRINVKSADVNNNIKIANSIPKNTIDKKDVSNSIGYSIGGNISVEGKTAGAGINASYNVQNTISYEQPDFRTIQRKDDANLASWDIKFVETKDGYNIDSYHAIYGNQLFMKSRLYNNGLE
and (3) aiming at different host cells, carrying out codon optimization to respectively obtain coding gene sequences with nucleotide sequences shown as SEQ ID NO.1 and SEQ ID NO. 2.
The nucleotide sequence shown in SEQ ID NO.1 is:
CATATGGGCAGCGATCCGAGCGTGGGTAATAATGTGAAAGAACTGGTTGCCTATATTAGCACCAGCGGTGAAAAAGATGCAGGTACCGATGATTATATGTATTTTGGTATTAAGACCAAGGACGGTAAAACCCAGGAATGGGAAATGGATAATCCGGGTAATGATTTTATGGCCGGTAGCAAAGATACCTATACCTTTAAACTGAAAGACGAAAATCTGAAAATCGATGATATCCAGAATATGTGGATTCGCAAACGCAAATATACCGCCTTTCCGGATGCCTATAAACCGGAAAATATTAAAGTGATTGCGAATGGTAAGGTTGTGGTTGATAAAGATATTAATGAGTGGGAAGCCGCCGCAAAATATTATGGTAAAATGAAATGGCCGGAAACCTATCGTATTAATGTTAAAAGTGCAGATGTGAATAACAACATTAAGATTGCAAACAGTATCCCGAAAAATACCATTGATAAAAAGGATGTTAGCAACAGCATTGGTTATAGTATTGGCGGTAATATTAGCGTGGAAGGTAAAACCGCAGGTGCCGGTATTAATGCAAGCTATAATGTTCAGAATACCATTAGTTACGAGCAGCCGGATTTTCGTACCATTCAGCGCAAAGATGATGCAAATCTGGCCAGTTGGGATATTAAATTTGTGGAAACCAAAGATGGTTACAATATTGATAGCTATCACGCCATTTATGGCAATCAGCTGTTTATGAAAAGCCGTCTGTATAATAATGGTCTCGAG
the nucleotide sequence shown in SEQ ID NO.2 is:
CCATGGGAATTCAGATCTTATGCTTTTGTTATAAGTTAGCACAAAAAAGCAGAAAATAAAAAGTAGAAATAAAAAAAGATGTTTTTTTGCCCATATCTCTATGAAAAAAACTGTGAAATGTGTAAAATATGGATGAAACATTGAATTTAAAAGGAGATATTTCATGAAGAAGGAATTGTCATTCCATGAAAAATTGTTGAAG
TTGACTAAGCAACAAAAGAAAAAGACTAACAAGCATGTTTTCATTGCTATT
CCAATTGTTTTCGTTTTGATGTTTGCTTTTATGTGGGCTGGTAAAGCTGAAA
CTCCAAAAGTTAAGACTTATTCAGATGATGTTTTGTCAGCTTCATTTGTTGG
TGATATTATGATGGGTCGTTATGTTGAAAAGGTTACTGAACAAAAAGGTGC
TGATTCAATTTTTCAATACGTTGAACCAATTTTCCGTGCTTCAGATTATGTTG
CTGGTAATTTTGAAAACCCAGTTACTTATCAAAAGAACTATAAGCAAGCTG
ATAAGGAAATTCATTTGCAAACTAATAAGGAAAGCGTTAAGGTTTTAAAGG
ATATGAATTTCACTGTTTTGAACTCAGCTAATAACCATGCTATGGATTATGGT
GTTCAAGGTATGAAGGATACTTTAGGTGAATTTGCTAAGCAAAATTTGGATA
TTGTTGGTGCTGGTTATTCATTATCAGATGCTAAAAAAAAGATTAGCTACCA
AAAGGTTAACGGTGTTACTATTGCTACTTTAGGTTTTACTGATGTTTCAGGT
AAGGGTTTTGCTGCTAAGAAGAATACTCCAGGTGTTTTACCAGCTGATCCA
GAAATTTTTATTCCAATGATTAGCGAAGCTAAGAAACATGCTGATATTGTTG
TTGTTCAATCACATTGGGGTCAAGAATATGATAATGATCCAAATGATCGTCA
ACGTCAATTAGCTCGTGCTATGTCAGATGCTGGTGCTGATATTATTGTTGGT
CATCATCCACATGTTTTAGAACCAATTGAAGTTTATAACGGTACTGTTATTTT
CTACTCATTGGGTAATTTCGTTTTCGATCAAGGTTGGACTCGTACTCGTGAT
TCAGCTTTAGTTCAATATCATTTAAAGAAGAACGGTACTGGTCGTTTTGAA
GTTACTCCAATTGATATTCATGAAGCTACTCCAGCTCCAGTTAAGAAGGATT
CATTAAAGCAAAAGACTATTATTCGTGAATTGACTAAGGATTCAAACTTTG
CTTGGAAAGTTGAAGATGGTAAGTTAACTTTTGACATTGATCATTCAGACA
AGTTAAAGTCAAAGGAAGGTAAGTCATCAGGTTCAGGTTCAGAATCAAAA
TCAACTGGATCCGCTCCACCACATGCTTTATCAGGTTCAGATCCATCAGTTG
GTAATAATGTTAAGGAATTAGTTGCTTACATTAGCACTTCAGGTGAAAAAG
ATGCTGGTACTGATGATTATATGTATTTTGGTATTAAGACTAAGGACGGTAA
AACTCAAGAATGGGAAATGGATAATCCAGGTAATGATTTTATGGCTGGTTC
AAAAGATACTTATACTTTTAAGTTGAAGGACGAAAACTTGAAAATTGATGA
TATTCAAAACATGTGGATTCGTAAACGTAAATATACTGCTTTTCCAGATGCT
TATAAGCCAGAAAATATTAAAGTTATTGCTAACGGTAAGGTTGTTGTTGATA
AAGATATTAACGAATGGGAAGCTGCTGCTAAATATTATGGTAAAATGAAGT
GGCCAGAAACTTATCGTATTAATGTTAAGTCAGCTGATGTTAATAACAACAT
TAAGATTGCTAACAGCATTCCAAAAAACACTATTGATAAGAAGGACGTTTC
AAATTCAATTGGTTATTCAATTGGTGGTAACATTTCAGTTGAAGGTAAAACT
GCTGGTGCTGGTATTAATGCTTCATATAATGTTCAAAACACTATTAGCTACG
AACAACCAGATTTTCGTACTATTCAACGTAAAGATGATGCTAATTTGGCTTC
ATGGGATATTAAGTTTGTTGAAACTAAGGATGGTTACAATATTGATTCATAC
CATGCTATTTACGGTAATCAATTATTCATGAAGAGCCGTTTATACAATAACG
GTGGATCCGAGCTCGGGCCCTCTAGAGTCGACCTCGAGCACCACCACCAC
CACCACTGATAACCCGGGTAATCTGAAGAAAAAGGAGGCTAGTATACTAGC
CTCCTTTTTCTTCAGATTACCCGGGGCGGCCGCAAGCTT
example 2: preparation of recombinant proteins
(1) The gene fragment with the nucleotide sequence shown as SEQ ID NO.1 obtained by manual screening combination is subjected to total gene synthesis, ndeI and XhoI restriction enzyme double-enzyme digestion are carried out simultaneously with a prokaryotic expression vector pET-30a (+), and then the nucleic acid fragments are respectively recovered and connected with T4 DNA ligase overnight; the recombinant plasmid map after ligation is shown in FIG. 1.
(2) The ligation products were heat-shock transformed into BL21 (DE 3) infected cells, and antibiotic pressure screening was performed using LB plates containing 50. Mu.g/ml kanamycin, and recombinant bacteria were obtained after colony PCR identification (as shown in FIG. 2) and nucleic acid sequencing analysis. The bacterium contains the recombinant plasmid constructed in the step (1).
(3) Selecting single colony of the recombinant bacteria selected in the step (2) to 5mL of LB liquid medium containing 50 mug/mL kanamycin, culturing overnight, inoculating to 100mL of LB liquid medium containing 50 mug/mL kanamycin according to the inoculum size of 1%, culturing to logarithmic phase at 25 ℃, adding 1mM IPTG inducer, culturing for 16 hours, and collecting the bacterial cells. PBS buffer was added to the cells, followed by washing twice successively, PBS buffer containing 10mL of 1% Triton X-100 was added, the cells were sonicated on ice, and centrifuged at 12000rpm for 20min, and the supernatant Q1 was collected. And (3) separating and purifying target protein in supernatant Q1 by using a Ni-Sepharose affinity chromatographic column, and collecting eluent to obtain recombinant protein of clostridium perfringens G.
The result shows that the recombinant bacteria can effectively express the target protein through induction, the size of the target protein is about 35Kda, and the purification result of the recombinant protein is shown in figure 3.
Example 3: preparation of oral vaccine
(1) Artificially synthesizing a codon optimized gene fragment (the nucleotide sequence is shown as SEQ ID NO. 2), cloning by a primer with a Not I restriction site primer (the nucleotide sequence is shown as SEQ ID NO. 4) and a HindIII restriction site primer (the nucleotide sequence is shown as SEQ ID NO. 5) to obtain a fragment 1, cloning by a primer with a BamH I restriction site (the nucleotide sequences are shown as SEQ ID NO.6 and SEQ ID NO. 7) to obtain a fragment 2, sequentially performing enzyme digestion on the two fragments to be connected to a pNZ8148 vector, and screening correct positive clones by colony PCR to obtain a plasmid 8148-CACN, wherein the plasmid map is shown as figure 4.
TABLE 1 primer information
(2) NZ9000 competent cells were prepared. Firstly, streaking NZ9000 bacterial liquid on a GM17 solid culture medium, and carrying out stationary culture for 24-36 h at 30 ℃ under anaerobic conditions; picking single colonies after plate streaking into 5mL GM17 liquid culture medium, and carrying out stationary culture at 30 ℃ for 12-16 h under anaerobic conditions; inoculating into 50mL fresh G/L-SGM17 liquid culture medium at 5% ratio, and culturing at 30deg.C under anaerobic condition until OD 600 Reaching 0.3 to 0.4 (estimated 2 to 3 hours); centrifuging at 4deg.C for 10min at 5000g, discarding supernatant, and retaining thallus precipitate; adding 5mL of washing solution III into the bacterial precipitate, re-suspending the bacterial precipitate, and standing for 30min at room temperature; centrifuging at 4deg.C for 10min at 5000g, discarding supernatant, and retaining thallus precipitate; adding 5mL of washing liquid I (precooling) into the bacterial precipitate, and re-suspending the bacterial precipitate; centrifuging at 4deg.C for 10min at 5000g, discarding supernatant, and retaining thallus precipitate; adding 5mL of washing liquid II (precooling) into the bacterial precipitate, and re-suspending the bacterial precipitate; centrifuging at 4deg.C for 10min at 5000g, discarding supernatant, and retaining thallus precipitate; 1mL (1/50 culture volume) of washing solution I (precooling) is added to the bacterial cell sediment, bacterial cells are resuspended, competent cells (ice bath) are packed according to 100 mu L/tube, and finally the bacterial cells are stored in a refrigerator at-80 ℃ for standby.
Wherein the washing liquid I comprises 0.5mol/L sucrose and 10% glycerol; washing solution II comprises 0.5mol/L sucrose, 10% glycerol and 50mmol/L EDTA; washing III included 100mmol/L lithium acetate dihydrate, 10mmol/L Dithiothreitol (DTT), 0.6mol/L sucrose and 1mol/L Tris-HCl (pH 7.5).
(3) 400ng of plasmid 8148-CACN prepared in the step (1) is added into 100 mu L of NZ9000 competent cells, and the mixture is placed on ice for 5min after uniform mixing; rapidly transferring to a 2mm electric shock cup (precooled for more than 10 min), placing in an electric converter, and discharging for 4.5 ms-5 ms according to 2.5 kV; after electrotransformation, 900 mu L of recovery culture medium (precooling) is quickly added, and ice bath is carried out for 5min; transferring the electrotransfer product to a 1.5mL centrifuge tube, and standing and culturing for 2h at 30 ℃; taking 100 mu L of GM17 solid culture medium coated with 1/2000 and 1/4000 chloramphenicol antibiotics, and standing and culturing for 36-48 h at 30 ℃ under anaerobic condition; picking the transformant for colony PCR identification, and obtaining a colony consistent with the expected size as shown in the result of FIG. 5; thus preparing an oral vaccine.
In the embodiment, a nucleotide sequence for encoding the recombinant protein of clostridium perfringens G is connected with an expression vector, and is positioned on the cell surface of lactobacillus through pgsA (poly-cobalamine synthetase A) for display expression; thus preparing an oral vaccine.
Example 4: animal experimental evaluation of clostridium perfringens vaccine G
(1) 817 broilers, which were not vaccinated at 1 day of age, were selected and divided into 3 groups of 30 experimental chickens. All test chickens were kept in cages without coccidian environment, were allowed to drink and feed freely. Wherein the immunization groups were subcutaneously injected with the recombinant protein prepared in example 2 at 1 day of age, 7 days of age and 14 days of age, respectively. Thereafter, the immunization group and the positive control group were subjected to attack treatment of clostridium perfringens type G at the age of 26 to 29 days according to 8X 10 8 CFU/proceed only.
Weighing at 1 day of age, 21 days of age and 30 days of age respectively, and calculating average weight gain and relative weight gain rate; at 30 days of age, survival rate was calculated; the results are shown in Table 2.
Survival = survival rate of 30 days old surviving chickens/21 days old surviving chickens 100%
Average weight gain (g) =30-21-day-old average body weight (g)
Relative weight gain (%) = (average weight gain of infected chickens/average weight gain of uninfected chickens) ×100%
TABLE 2
Experimental group | Relative weight gain rate | Survival rate |
Immunization group | 102% | 97% |
Positive group | 81% | 97% |
|
100% | 100% |
(2) Part of chickens were dissected and collected for the duodenum, jejunum, ileum and cecum, and lesion scores and photographic recordings were performed. The results are shown in Table 3 and FIG. 6.
The scoring criteria were as follows: 0 = no obvious lesions, 1 = congestion of intestinal mucosa, 2 = focal necrosis or ulcers (1-5 lesions), 3 = focal necrosis or ulcers (6-15 lesions); 4 = focal necrosis or ulceration (16 or more lesions)
TABLE 3 Table 3
Experimental group | Duodenum | Jejunum | Cecum |
Immunization group | 1.35 | 0.76 | 0.18 |
Positive group | 2.42 | 1.00 | 0.68 |
Negative group | 1.45 | 0.50 | 0.15 |
Therefore, after the recombinant protein is used for immunizing chickens, intestinal lesions are obviously improved compared with a positive control group, and the relative weight gain rate and the survival rate are similar to those of a negative control group, so that the recombinant protein can effectively improve the intestinal damage caused by clostridium perfringens G.
The technical features of the above-described embodiments may be arbitrarily combined, and all possible combinations of the technical features in the above-described embodiments are not described for brevity of description, however, as long as there is no contradiction between the combinations of the technical features, they should be considered as the scope of the description.
The above examples merely represent a few embodiments of the present application, which are described in more detail and are not to be construed as limiting the scope of the invention. It should be noted that it would be apparent to those skilled in the art that various modifications and improvements could be made without departing from the spirit of the present application, which would be within the scope of the present application. Accordingly, the scope of protection of the present application is to be determined by the claims appended hereto.
Claims (10)
1. A recombinant protein of clostridium perfringens type G, characterized in that it has an amino acid sequence shown in SEQ ID No. 3.
2. An isolated nucleic acid encoding the recombinant protein of claim 1.
3. The nucleic acid according to claim 2, wherein the sequence of the nucleic acid is shown as SEQ ID No.1 or SEQ ID No. 2.
4. A recombinant vector comprising the nucleic acid according to any one of claims 2 to 3.
5. A host cell comprising the nucleic acid of any one of claims 2 to 3 or the recombinant vector of claim 4.
6. The host cell of claim 5, wherein the host cell is a prokaryotic cell.
7. A vaccine comprising the recombinant protein of claim 1, the nucleic acid of any one of claims 2 to 3, or the recombinant vector of claim 4.
8. The vaccine of claim 7, further comprising an adjuvant.
9. Kit of parts, characterized in that it comprises a vaccine according to any one of claims 7 to 8, and a container for the vaccination of said vaccine.
10. Use of the recombinant protein of claim 1, the nucleic acid of any one of claims 2 to 3 or the recombinant vector of claim 4 for the preparation of a medicament for the prevention and treatment of clostridium perfringens G infection.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310209976.9A CN116284281A (en) | 2023-03-07 | 2023-03-07 | Recombinant protein of clostridium perfringens G, vaccine and application |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310209976.9A CN116284281A (en) | 2023-03-07 | 2023-03-07 | Recombinant protein of clostridium perfringens G, vaccine and application |
Publications (1)
Publication Number | Publication Date |
---|---|
CN116284281A true CN116284281A (en) | 2023-06-23 |
Family
ID=86826816
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202310209976.9A Pending CN116284281A (en) | 2023-03-07 | 2023-03-07 | Recombinant protein of clostridium perfringens G, vaccine and application |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN116284281A (en) |
-
2023
- 2023-03-07 CN CN202310209976.9A patent/CN116284281A/en active Pending
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN111088283B (en) | mVSV viral vector, viral vector vaccine thereof and mVSV-mediated novel coronary pneumonia vaccine | |
ES2520026T3 (en) | Compositions and methods to boost immune responses | |
CN101969990B (en) | Compositions and methods of enhancinc immune responses to eimeria | |
JP5746333B2 (en) | Vaccines and methods for reducing Campylobacter infection | |
KR20210133888A (en) | Vaccine composition for preventing or treating infection of SARS-CoV-2 | |
CN102037135A (en) | Compositions and methods of enhancing immune responses to flagellated bacterium | |
RU2677799C2 (en) | Modified supercoiled proteins with improved properties | |
US20230190923A1 (en) | Compositions comprising ltb and pathogenic antigens, and use thereof | |
JP2021500876A (en) | Recombinant non-pathogenic Marek's disease virus construct encoding multiple heterologous antigens | |
JP7046014B2 (en) | Recombinant non-pathogenic Marek's disease virus construct encoding antigens for infectious laryngeal tracheitis virus and infectious bursal disease virus | |
CN114908029B (en) | Construction and application of II-type grass carp reovirus VP6 recombinant lactobacillus | |
CN111607605B (en) | Construction method of multivalent epitope and subunit vaccine | |
CN110746496B (en) | PAL recombinant protein of Acinetobacter baumannii, encoding gene thereof and application of PAL recombinant protein and encoding gene | |
US9549978B2 (en) | Amino acid sequences for controlling pathogens | |
CN116284281A (en) | Recombinant protein of clostridium perfringens G, vaccine and application | |
CN114058634B (en) | Chicken bursa synovialis mycoplasma gene engineering subunit vaccine | |
CN110950968B (en) | gp 96-hog cholera E2 fusion protein, preparation method thereof and vaccine | |
CN113046384A (en) | Construction method of broad-spectrum antiviral recombinant salmonella | |
CN107281487B (en) | Veterinary vaccine adjuvant | |
CN114085293B (en) | Recombinant protein for preventing poultry ankara disease, construction method and application | |
KR100933090B1 (en) | Adhesive fusion protein and immunoadjuvant for preventing or treating diarrhea in livestock | |
CN114903986B (en) | Streptococcus suis three-component subunit vaccine and preparation method thereof | |
EP1603938B1 (en) | Inclusion bodies as antigens for the oral vaccination of animals against csfv | |
CN113527441A (en) | Adenovirus antigen polypeptide and application thereof | |
ES2719256T3 (en) | Modified super helix type proteins that have improved properties |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination |