CN115873121A - High-activity biological fermentation method and pharmaceutical composition containing probiotics - Google Patents
High-activity biological fermentation method and pharmaceutical composition containing probiotics Download PDFInfo
- Publication number
- CN115873121A CN115873121A CN202211113384.9A CN202211113384A CN115873121A CN 115873121 A CN115873121 A CN 115873121A CN 202211113384 A CN202211113384 A CN 202211113384A CN 115873121 A CN115873121 A CN 115873121A
- Authority
- CN
- China
- Prior art keywords
- monoclonal antibody
- caspase
- cas
- pharmaceutical composition
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 239000008194 pharmaceutical composition Substances 0.000 title claims abstract description 26
- 230000000694 effects Effects 0.000 title claims abstract description 22
- 239000006041 probiotic Substances 0.000 title claims abstract description 20
- 235000018291 probiotics Nutrition 0.000 title claims abstract description 20
- 238000000034 method Methods 0.000 title claims abstract description 15
- 238000000855 fermentation Methods 0.000 title claims abstract description 6
- 230000004151 fermentation Effects 0.000 title claims abstract description 6
- 201000005569 Gout Diseases 0.000 claims abstract description 33
- 108090000426 Caspase-1 Proteins 0.000 claims abstract description 20
- 102100035904 Caspase-1 Human genes 0.000 claims abstract description 20
- 230000000529 probiotic effect Effects 0.000 claims description 14
- 239000000203 mixture Substances 0.000 claims description 12
- 239000001963 growth medium Substances 0.000 claims description 10
- 239000004094 surface-active agent Substances 0.000 claims description 9
- 239000000872 buffer Substances 0.000 claims description 8
- 244000199866 Lactobacillus casei Species 0.000 claims description 6
- 235000013958 Lactobacillus casei Nutrition 0.000 claims description 6
- 238000012258 culturing Methods 0.000 claims description 6
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 6
- 229940017800 lactobacillus casei Drugs 0.000 claims description 6
- 244000153158 Ammi visnaga Species 0.000 claims description 4
- 235000010585 Ammi visnaga Nutrition 0.000 claims description 4
- 239000007788 liquid Substances 0.000 claims description 4
- 239000005913 Maltodextrin Substances 0.000 claims description 2
- 229920002774 Maltodextrin Polymers 0.000 claims description 2
- 239000006172 buffering agent Substances 0.000 claims description 2
- 229940035034 maltodextrin Drugs 0.000 claims description 2
- 239000002244 precipitate Substances 0.000 claims description 2
- 238000004321 preservation Methods 0.000 claims description 2
- 230000001580 bacterial effect Effects 0.000 claims 1
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 claims 1
- 238000011081 inoculation Methods 0.000 claims 1
- 238000003756 stirring Methods 0.000 claims 1
- 102000003777 Interleukin-1 beta Human genes 0.000 abstract description 28
- 108090000193 Interleukin-1 beta Proteins 0.000 abstract description 28
- 206010061218 Inflammation Diseases 0.000 abstract description 14
- 230000004054 inflammatory process Effects 0.000 abstract description 14
- 230000003053 immunization Effects 0.000 abstract description 7
- 239000002243 precursor Substances 0.000 abstract description 6
- 108090000765 processed proteins & peptides Proteins 0.000 abstract description 6
- 238000010172 mouse model Methods 0.000 abstract description 3
- 238000000338 in vitro Methods 0.000 abstract description 2
- -1 sorbitan fatty acid esters Chemical class 0.000 description 45
- LEHOTFFKMJEONL-UHFFFAOYSA-N Uric Acid Chemical compound N1C(=O)NC(=O)C2=C1NC(=O)N2 LEHOTFFKMJEONL-UHFFFAOYSA-N 0.000 description 23
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 21
- TVWHNULVHGKJHS-UHFFFAOYSA-N Uric acid Natural products N1C(=O)NC(=O)C2NC(=O)NC21 TVWHNULVHGKJHS-UHFFFAOYSA-N 0.000 description 20
- 229940116269 uric acid Drugs 0.000 description 20
- 210000004027 cell Anatomy 0.000 description 17
- 235000014113 dietary fatty acids Nutrition 0.000 description 17
- 239000000194 fatty acid Substances 0.000 description 17
- 229930195729 fatty acid Natural products 0.000 description 17
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 14
- 239000003814 drug Substances 0.000 description 14
- 239000002775 capsule Substances 0.000 description 11
- 230000001154 acute effect Effects 0.000 description 10
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 10
- 241000699666 Mus <mouse, genus> Species 0.000 description 9
- 210000004369 blood Anatomy 0.000 description 9
- 239000008280 blood Substances 0.000 description 9
- 229940079593 drug Drugs 0.000 description 9
- 239000000243 solution Substances 0.000 description 8
- 241000699670 Mus sp. Species 0.000 description 7
- 230000002401 inhibitory effect Effects 0.000 description 7
- 230000008961 swelling Effects 0.000 description 7
- IAKHMKGGTNLKSZ-INIZCTEOSA-N (S)-colchicine Chemical compound C1([C@@H](NC(C)=O)CC2)=CC(=O)C(OC)=CC=C1C1=C2C=C(OC)C(OC)=C1OC IAKHMKGGTNLKSZ-INIZCTEOSA-N 0.000 description 6
- 102000004127 Cytokines Human genes 0.000 description 6
- 108090000695 Cytokines Proteins 0.000 description 6
- 229920001214 Polysorbate 60 Polymers 0.000 description 6
- 239000007903 gelatin capsule Substances 0.000 description 6
- 210000000265 leukocyte Anatomy 0.000 description 6
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 6
- 230000009467 reduction Effects 0.000 description 6
- 241000894006 Bacteria Species 0.000 description 5
- 201000001431 Hyperuricemia Diseases 0.000 description 5
- 102000004889 Interleukin-6 Human genes 0.000 description 5
- 108090001005 Interleukin-6 Proteins 0.000 description 5
- 208000002193 Pain Diseases 0.000 description 5
- 238000010521 absorption reaction Methods 0.000 description 5
- 150000005215 alkyl ethers Chemical class 0.000 description 5
- 239000004310 lactic acid Substances 0.000 description 5
- 235000014655 lactic acid Nutrition 0.000 description 5
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 5
- 229920002503 polyoxyethylene-polyoxypropylene Polymers 0.000 description 5
- 229920000053 polysorbate 80 Polymers 0.000 description 5
- 239000013641 positive control Substances 0.000 description 5
- 239000000843 powder Substances 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 230000002829 reductive effect Effects 0.000 description 5
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 4
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 4
- 241000186660 Lactobacillus Species 0.000 description 4
- 241000700159 Rattus Species 0.000 description 4
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 239000004359 castor oil Substances 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 239000002552 dosage form Substances 0.000 description 4
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 4
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 229940039696 lactobacillus Drugs 0.000 description 4
- 238000002156 mixing Methods 0.000 description 4
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 4
- 230000000770 proinflammatory effect Effects 0.000 description 4
- 239000000600 sorbitol Substances 0.000 description 4
- HMLGSIZOMSVISS-ONJSNURVSA-N (7r)-7-[[(2z)-2-(2-amino-1,3-thiazol-4-yl)-2-(2,2-dimethylpropanoyloxymethoxyimino)acetyl]amino]-3-ethenyl-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid Chemical compound N([C@@H]1C(N2C(=C(C=C)CSC21)C(O)=O)=O)C(=O)\C(=N/OCOC(=O)C(C)(C)C)C1=CSC(N)=N1 HMLGSIZOMSVISS-ONJSNURVSA-N 0.000 description 3
- WOKDXPHSIQRTJF-UHFFFAOYSA-N 3-[3-[3-[3-[3-[3-[3-[3-[3-(2,3-dihydroxypropoxy)-2-hydroxypropoxy]-2-hydroxypropoxy]-2-hydroxypropoxy]-2-hydroxypropoxy]-2-hydroxypropoxy]-2-hydroxypropoxy]-2-hydroxypropoxy]-2-hydroxypropoxy]propane-1,2-diol Chemical compound OCC(O)COCC(O)COCC(O)COCC(O)COCC(O)COCC(O)COCC(O)COCC(O)COCC(O)COCC(O)CO WOKDXPHSIQRTJF-UHFFFAOYSA-N 0.000 description 3
- TYNLGDBUJLVSMA-UHFFFAOYSA-N 4,5-diacetyloxy-9,10-dioxo-2-anthracenecarboxylic acid Chemical compound O=C1C2=CC(C(O)=O)=CC(OC(C)=O)=C2C(=O)C2=C1C=CC=C2OC(=O)C TYNLGDBUJLVSMA-UHFFFAOYSA-N 0.000 description 3
- 206010003445 Ascites Diseases 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerol Natural products OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 206010018634 Gouty Arthritis Diseases 0.000 description 3
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 3
- 102000000589 Interleukin-1 Human genes 0.000 description 3
- 108010002352 Interleukin-1 Proteins 0.000 description 3
- 102000051628 Interleukin-1 receptor antagonist Human genes 0.000 description 3
- 108700021006 Interleukin-1 receptor antagonist Proteins 0.000 description 3
- 239000004166 Lanolin Substances 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 239000004147 Sorbitan trioleate Substances 0.000 description 3
- PRXRUNOAOLTIEF-ADSICKODSA-N Sorbitan trioleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCC\C=C/CCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCC\C=C/CCCCCCCC PRXRUNOAOLTIEF-ADSICKODSA-N 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 229960004238 anakinra Drugs 0.000 description 3
- 230000003110 anti-inflammatory effect Effects 0.000 description 3
- 206010003246 arthritis Diseases 0.000 description 3
- 235000013871 bee wax Nutrition 0.000 description 3
- 239000012166 beeswax Substances 0.000 description 3
- 235000019438 castor oil Nutrition 0.000 description 3
- 229960001338 colchicine Drugs 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 239000013078 crystal Substances 0.000 description 3
- 229960004590 diacerein Drugs 0.000 description 3
- 150000004665 fatty acids Chemical class 0.000 description 3
- 210000001035 gastrointestinal tract Anatomy 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 3
- 239000008187 granular material Substances 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007928 intraperitoneal injection Substances 0.000 description 3
- 210000001503 joint Anatomy 0.000 description 3
- 235000019388 lanolin Nutrition 0.000 description 3
- 229940039717 lanolin Drugs 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 229940068968 polysorbate 80 Drugs 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 229910052708 sodium Inorganic materials 0.000 description 3
- 235000019337 sorbitan trioleate Nutrition 0.000 description 3
- 229960000391 sorbitan trioleate Drugs 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 2
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 2
- RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- 208000006820 Arthralgia Diseases 0.000 description 2
- 238000011725 BALB/c mouse Methods 0.000 description 2
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 2
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 101000715398 Homo sapiens Caspase-1 Proteins 0.000 description 2
- 101000793880 Homo sapiens Caspase-3 Proteins 0.000 description 2
- 108090001007 Interleukin-8 Proteins 0.000 description 2
- 102000004890 Interleukin-8 Human genes 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 229960005305 adenosine Drugs 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- POJWUDADGALRAB-UHFFFAOYSA-N allantoin Chemical compound NC(=O)NC1NC(=O)NC1=O POJWUDADGALRAB-UHFFFAOYSA-N 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000001760 anti-analgesic effect Effects 0.000 description 2
- 210000000544 articulatio talocruralis Anatomy 0.000 description 2
- 235000015278 beef Nutrition 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 210000002798 bone marrow cell Anatomy 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 235000015140 cultured milk Nutrition 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 230000008021 deposition Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N ether Substances CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- 238000003304 gavage Methods 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- 229940029575 guanosine Drugs 0.000 description 2
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 229960003943 hypromellose Drugs 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- CGIGDMFJXJATDK-UHFFFAOYSA-N indomethacin Chemical compound CC1=C(CC(O)=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 CGIGDMFJXJATDK-UHFFFAOYSA-N 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- 230000028709 inflammatory response Effects 0.000 description 2
- 230000000968 intestinal effect Effects 0.000 description 2
- 235000015141 kefir Nutrition 0.000 description 2
- 230000003907 kidney function Effects 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 208000030159 metabolic disease Diseases 0.000 description 2
- 238000000465 moulding Methods 0.000 description 2
- 239000002736 nonionic surfactant Substances 0.000 description 2
- 235000015097 nutrients Nutrition 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 239000002504 physiological saline solution Substances 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 229920000223 polyglycerol Polymers 0.000 description 2
- 235000010483 polyoxyethylene sorbitan monopalmitate Nutrition 0.000 description 2
- 239000000249 polyoxyethylene sorbitan monopalmitate Substances 0.000 description 2
- 235000010989 polyoxyethylene sorbitan monostearate Nutrition 0.000 description 2
- 239000001818 polyoxyethylene sorbitan monostearate Substances 0.000 description 2
- 229940068977 polysorbate 20 Drugs 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 150000003180 prostaglandins Chemical class 0.000 description 2
- 150000003212 purines Chemical class 0.000 description 2
- GHBFNMLVSPCDGN-UHFFFAOYSA-N rac-1-monooctanoylglycerol Chemical compound CCCCCCCC(=O)OCC(O)CO GHBFNMLVSPCDGN-UHFFFAOYSA-N 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 210000002303 tibia Anatomy 0.000 description 2
- 210000000689 upper leg Anatomy 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- JNYAEWCLZODPBN-JGWLITMVSA-N (2r,3r,4s)-2-[(1r)-1,2-dihydroxyethyl]oxolane-3,4-diol Chemical compound OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O JNYAEWCLZODPBN-JGWLITMVSA-N 0.000 description 1
- LOGFVTREOLYCPF-KXNHARMFSA-N (2s,3r)-2-[[(2r)-1-[(2s)-2,6-diaminohexanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxybutanoic acid Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H]1CCCN1C(=O)[C@@H](N)CCCCN LOGFVTREOLYCPF-KXNHARMFSA-N 0.000 description 1
- HSINOMROUCMIEA-FGVHQWLLSA-N (2s,4r)-4-[(3r,5s,6r,7r,8s,9s,10s,13r,14s,17r)-6-ethyl-3,7-dihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]-2-methylpentanoic acid Chemical compound C([C@@]12C)C[C@@H](O)C[C@H]1[C@@H](CC)[C@@H](O)[C@@H]1[C@@H]2CC[C@]2(C)[C@@H]([C@H](C)C[C@H](C)C(O)=O)CC[C@H]21 HSINOMROUCMIEA-FGVHQWLLSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- XZIIFPSPUDAGJM-UHFFFAOYSA-N 6-chloro-2-n,2-n-diethylpyrimidine-2,4-diamine Chemical compound CCN(CC)C1=NC(N)=CC(Cl)=N1 XZIIFPSPUDAGJM-UHFFFAOYSA-N 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- POJWUDADGALRAB-PVQJCKRUSA-N Allantoin Natural products NC(=O)N[C@@H]1NC(=O)NC1=O POJWUDADGALRAB-PVQJCKRUSA-N 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 208000024172 Cardiovascular disease Diseases 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 208000032170 Congenital Abnormalities Diseases 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 239000004150 EU approved colour Substances 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 206010015150 Erythema Diseases 0.000 description 1
- FPVVYTCTZKCSOJ-UHFFFAOYSA-N Ethylene glycol distearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCOC(=O)CCCCCCCCCCCCCCCCC FPVVYTCTZKCSOJ-UHFFFAOYSA-N 0.000 description 1
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical group C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 1
- CTKXFMQHOOWWEB-UHFFFAOYSA-N Ethylene oxide/propylene oxide copolymer Chemical compound CCCOC(C)COCCO CTKXFMQHOOWWEB-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101001109465 Homo sapiens NACHT, LRR and PYD domains-containing protein 3 Proteins 0.000 description 1
- 101000669447 Homo sapiens Toll-like receptor 4 Proteins 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- 108010034143 Inflammasomes Proteins 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 206010060820 Joint injury Diseases 0.000 description 1
- 238000012449 Kunming mouse Methods 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 108010077432 Myeloid Differentiation Factor 88 Proteins 0.000 description 1
- 102000010168 Myeloid Differentiation Factor 88 Human genes 0.000 description 1
- 102100022691 NACHT, LRR and PYD domains-containing protein 3 Human genes 0.000 description 1
- 206010030113 Oedema Diseases 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 239000001888 Peptone Substances 0.000 description 1
- 108010080698 Peptones Proteins 0.000 description 1
- 229920001219 Polysorbate 40 Polymers 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 102000004005 Prostaglandin-endoperoxide synthases Human genes 0.000 description 1
- 108090000459 Prostaglandin-endoperoxide synthases Proteins 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- IYFATESGLOUGBX-YVNJGZBMSA-N Sorbitan monopalmitate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O IYFATESGLOUGBX-YVNJGZBMSA-N 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 102100039360 Toll-like receptor 4 Human genes 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 102000009618 Transforming Growth Factors Human genes 0.000 description 1
- 108010009583 Transforming Growth Factors Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 208000026816 acute arthritis Diseases 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 150000008051 alkyl sulfates Chemical class 0.000 description 1
- 229960000458 allantoin Drugs 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000001754 anti-pyretic effect Effects 0.000 description 1
- 230000010100 anticoagulation Effects 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 239000002221 antipyretic Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 230000002917 arthritic effect Effects 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 229940069780 barley extract Drugs 0.000 description 1
- 239000003613 bile acid Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 239000007894 caplet Substances 0.000 description 1
- KLOIYEQEVSIOOO-UHFFFAOYSA-N carbocromen Chemical compound CC1=C(CCN(CC)CC)C(=O)OC2=CC(OCC(=O)OCC)=CC=C21 KLOIYEQEVSIOOO-UHFFFAOYSA-N 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- RNFNDJAIBTYOQL-UHFFFAOYSA-N chloral hydrate Chemical compound OC(O)C(Cl)(Cl)Cl RNFNDJAIBTYOQL-UHFFFAOYSA-N 0.000 description 1
- 229960002327 chloral hydrate Drugs 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 239000007857 degradation product Substances 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 229960001193 diclofenac sodium Drugs 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000003113 dilution method Methods 0.000 description 1
- 230000003467 diminishing effect Effects 0.000 description 1
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 1
- 229910000396 dipotassium phosphate Inorganic materials 0.000 description 1
- 235000019797 dipotassium phosphate Nutrition 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 210000000750 endocrine system Anatomy 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 231100000321 erythema Toxicity 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 210000003414 extremity Anatomy 0.000 description 1
- 229940121360 farnesoid X receptor (fxr) agonists Drugs 0.000 description 1
- 239000012091 fetal bovine serum Substances 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 235000019688 fish Nutrition 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- YQEMORVAKMFKLG-UHFFFAOYSA-N glycerine monostearate Natural products CCCCCCCCCCCCCCCCCC(=O)OC(CO)CO YQEMORVAKMFKLG-UHFFFAOYSA-N 0.000 description 1
- SVUQHVRAGMNPLW-UHFFFAOYSA-N glycerol monostearate Natural products CCCCCCCCCCCCCCCCC(=O)OCC(O)CO SVUQHVRAGMNPLW-UHFFFAOYSA-N 0.000 description 1
- 150000002327 glycerophospholipids Chemical class 0.000 description 1
- 229940100608 glycol distearate Drugs 0.000 description 1
- RQFCJASXJCIDSX-UUOKFMHZSA-N guanosine 5'-monophosphate Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O RQFCJASXJCIDSX-UUOKFMHZSA-N 0.000 description 1
- 235000013928 guanylic acid Nutrition 0.000 description 1
- 239000004226 guanylic acid Substances 0.000 description 1
- 239000007887 hard shell capsule Substances 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 229940071829 ilaris Drugs 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 229940027941 immunoglobulin g Drugs 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 229960000905 indomethacin Drugs 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 229910017053 inorganic salt Inorganic materials 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 239000002563 ionic surfactant Substances 0.000 description 1
- 208000018937 joint inflammation Diseases 0.000 description 1
- 208000017169 kidney disease Diseases 0.000 description 1
- 150000002605 large molecules Chemical class 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 230000003908 liver function Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 1
- 235000019341 magnesium sulphate Nutrition 0.000 description 1
- 229940099596 manganese sulfate Drugs 0.000 description 1
- 239000011702 manganese sulphate Substances 0.000 description 1
- 235000007079 manganese sulphate Nutrition 0.000 description 1
- SQQMAOCOWKFBNP-UHFFFAOYSA-L manganese(II) sulfate Chemical compound [Mn+2].[O-]S([O-])(=O)=O SQQMAOCOWKFBNP-UHFFFAOYSA-L 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000037353 metabolic pathway Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 108010003099 nodulin Proteins 0.000 description 1
- 239000000041 non-steroidal anti-inflammatory agent Substances 0.000 description 1
- 229960005489 paracetamol Drugs 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 235000019319 peptone Nutrition 0.000 description 1
- 208000025487 periodic fever syndrome Diseases 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004014 plasticizer Substances 0.000 description 1
- 229920001993 poloxamer 188 Polymers 0.000 description 1
- 229940044519 poloxamer 188 Drugs 0.000 description 1
- 229920000259 polyoxyethylene lauryl ether Polymers 0.000 description 1
- 235000010988 polyoxyethylene sorbitan tristearate Nutrition 0.000 description 1
- 239000001816 polyoxyethylene sorbitan tristearate Substances 0.000 description 1
- 229940101027 polysorbate 40 Drugs 0.000 description 1
- 229940113124 polysorbate 60 Drugs 0.000 description 1
- 235000015277 pork Nutrition 0.000 description 1
- 230000008092 positive effect Effects 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- LWIHDJKSTIGBAC-UHFFFAOYSA-K potassium phosphate Substances [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 108090000623 proteins and genes Proteins 0.000 description 1
- 230000004144 purine metabolism Effects 0.000 description 1
- DCBSHORRWZKAKO-UHFFFAOYSA-N rac-1-monomyristoylglycerol Chemical compound CCCCCCCCCCCCCC(=O)OCC(O)CO DCBSHORRWZKAKO-UHFFFAOYSA-N 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- SLBXZQMMERXQAL-UHFFFAOYSA-M sodium;1-dodecoxy-4-hydroxy-1,4-dioxobutane-2-sulfonate Chemical compound [Na+].CCCCCCCCCCCCOC(=O)C(S(O)(=O)=O)CC([O-])=O SLBXZQMMERXQAL-UHFFFAOYSA-M 0.000 description 1
- JGMJQSFLQWGYMQ-UHFFFAOYSA-M sodium;2,6-dichloro-n-phenylaniline;acetate Chemical compound [Na+].CC([O-])=O.ClC1=CC=CC(Cl)=C1NC1=CC=CC=C1 JGMJQSFLQWGYMQ-UHFFFAOYSA-M 0.000 description 1
- MWZFQMUXPSUDJQ-KVVVOXFISA-M sodium;[(z)-octadec-9-enyl] sulfate Chemical compound [Na+].CCCCCCCC\C=C/CCCCCCCCOS([O-])(=O)=O MWZFQMUXPSUDJQ-KVVVOXFISA-M 0.000 description 1
- GGHPAKFFUZUEKL-UHFFFAOYSA-M sodium;hexadecyl sulfate Chemical compound [Na+].CCCCCCCCCCCCCCCCOS([O-])(=O)=O GGHPAKFFUZUEKL-UHFFFAOYSA-M 0.000 description 1
- 210000004872 soft tissue Anatomy 0.000 description 1
- 229940035044 sorbitan monolaurate Drugs 0.000 description 1
- 235000011071 sorbitan monopalmitate Nutrition 0.000 description 1
- 239000001570 sorbitan monopalmitate Substances 0.000 description 1
- 229940031953 sorbitan monopalmitate Drugs 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 150000003445 sucroses Chemical class 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 210000002437 synoviocyte Anatomy 0.000 description 1
- 210000002435 tendon Anatomy 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 229940126585 therapeutic drug Drugs 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 210000005239 tubule Anatomy 0.000 description 1
- 102000003390 tumor necrosis factor Human genes 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 229940075420 xanthine Drugs 0.000 description 1
- 239000002888 zwitterionic surfactant Substances 0.000 description 1
Images
Classifications
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The invention relates to a high-activity biological fermentation method and a pharmaceutical composition containing probiotics. Based on the characteristic of Caspase-1 processable precursor IL-1 beta, the epitope peptide is specifically screened and a specific monoclonal antibody is prepared by immunizing a mouse, the antibody can effectively inhibit the expression of IL-1 beta in an in vitro cell model, and simultaneously can be combined with probiotics to restrictively reduce the inflammation index in the mouse model so as to treat gout, so that the Caspase-1 processable precursor IL-1 beta has a good effect.
Description
Technical Field
The application relates to the field of biology, in particular to a high-activity biological fermentation method and a pharmaceutical composition containing probiotics.
Background
Gout is a common and complex type of arthritis, which can be suffered by all ages, with higher incidence in men than women. Patients with gout often have sudden joint pain at night, the joint is in urgent attack, pain, edema, red swelling and inflammation appear at the joint, and the pain is slowly relieved until the pain disappears and lasts for several days or weeks. Gout attack is related to the concentration of uric acid in the body, and gout can form urate deposition in joint cavities and the like, thereby causing acute joint pain.
Gout is a group of metabolic diseases caused by purine metabolic disorder, and the continuous increase of blood uric acid concentration causes urate crystal to deposit soft tissues. The pathological mechanism of gout and hyperuricemia is mainly 3 aspects as follows: (1) Congenital abnormalities of several uric acid transporters of the renal tubule may lead to the occurrence of hyperuricemia and are associated with the mechanisms of promoting uric acid elimination drugs and inhibiting uric acid excretion; (2) Epidemiological studies have shown that hyperuricemia and gout are both associated with death from cardiovascular disease, even hyperuricemia has been shown to be associated with chronic nephropathy; (3) The TO 11-like receptor (TLR-2, TLR-4) and NALP3 inflammasome in innate immunity receive danger signals of uric acid, and then cause inflammatory response of gout through activation of Bai Jiesuo IL-l, and in addition, transforming growth factor TGF-beta may be related TO automatic relief of the inflammatory response.
Gout treatment can be divided into three parts: (1) early control and relief of the onset of acute arthritis; (2) preventing further deposition of uric acid in the tissue by reducing the uric acid level in the blood; (3) prevent uric acid calculus formation, and reduce severe joint injury and renal function damage caused by uric acid calculus formation. Anti-inflammatory and analgesic treatment is recommended early (generally within 24 h) in the acute gout attack stage, and non-steroidal anti-inflammatory drugs (NSAIDs), colchicine and glucocorticoid can effectively resist inflammation and relieve pain and improve the life quality of patients. The acid reduction treatment is not carried out in the acute attack stage, but the patient who takes the acid reduction medicine does not need to stop taking the acid reduction medicine so as to avoid causing fluctuation of blood uric acid, and the attack time is prolonged or the attack is carried out again.
Colchicine and non-steroidal anti-inflammatory drugs (NSAIDs) are commonly used drugs for the treatment of acute gout. Colchicine is the first choice drug for treating acute gouty arthritis, and can inhibit the aggregation of white blood cells at the joint inflammation part, weaken the action of the white blood cells on phagocytizing uric acid, and relieve the inflammation reaction caused by local white blood cell destruction, thereby achieving the purpose of quickly diminishing inflammation. But it often causes gastrointestinal reaction and impairment of liver and kidney functions in clinic. The non-steroidal anti-inflammatory drug inhibits the activity of cyclooxygenase, blocks the synthesis of Prostaglandin (PG), and has antipyretic, anti-inflammatory and analgesic effects. The NSAIDs for treating acute gout mainly comprise acetaminophen, diclofenac sodium, indomethacin and the like. The urate crystals induce giant cells to activate aspartate proteolytic enzyme, catalyzing the conversion of interleukin-1 p precursor (Pro-IL-1 β) to IL-1 β. IL-1 beta is recognized as a key cytokine causing gouty arthritis and has important effects on the treatment of gout. Any drug that directly or indirectly blocks the binding of IL-1 β to a receptor may block the action of IL-1 β.
Current research on interleukin-1 beta inhibitors for treating acute phase gout has yielded promising results. Three drugs, canakiumab (ilakinumab, ilaris), linaclocept (irinotect) and anakinra (anakinra, kinereto, are approved by the FDA for the treatment of periodic fever syndrome (CAPS), and anakinra are also approved by the FDA for the treatment of rheumatoid arthritis.
Gout is clinically mainly manifested as arthritic symptoms, high-level uric acid in blood in an acute stage can directly stimulate and release a large amount of proinflammatory cytokines such as IL-1, IL-6, IL-8, IL-12 and the like and tumor necrosis factors, and the imbalance of the proinflammatory and anti-inflammatory cytokines is an important reason for gouty arthritis. Research shows that the lactobacillus can regulate the mRNA expression level of the cytokine in the spleen of the diabetic mouse and reduce the proinflammatory factors IL-6 and IL-8. When kefir fermented milk is used for interfering mouse breast cancer cells, the anticancer activity of the kefir fermented milk is realized by reducing the expression of IL-6 through the regulation of an immune system and an endocrine system by lactic acid bacteria. The barley extract fermented by lactic acid bacteria was also confirmed to be capable of reducing the secretion of rat inflammatory factors IL-1 beta, IL-6 and TNF-alpha, and causing the reduction of the expression of pro-inflammatory factors by inhibiting the expression of NF-. Kappa.B protein. Therefore, lactic acid bacteria have the functions of participating in cellular immune response, reducing inflammatory reaction of gout, particularly in the acute gout attack stage, and reducing adverse symptoms such as local red swelling and hot pain caused by inflammatory reaction. The high-concentration uric acid causing gout diseases mainly comes from purine metabolism, a reasonable mode is adopted to intervene in purine metabolic pathways, and the generation of uric acid end products is reduced, so that the method is a method for preventing and treating gout or hyperuricemia. The intestinal lactobacillus is a beneficial flora in the gastrointestinal tract of the organism, has the capability of decomposing and generating nutrient substances, can provide more nutrient substances for host cells, and can bring more probiotic effects to the organism through the absorption and transformation functions of the intestinal lactobacillus. Three aspects of purine absorption, purine metabolic intermediate inosine, guanosine absorption and uric acid absorption are also proved. Japanese has found that a strain of lactic acid bacteria PA-3 decomposes and absorbs purines, making them difficult to absorb directly by the human body. Domestic scholars have also demonstrated that orally administered lactic acid bacteria can break down purines ingested by food in the gut, and can reduce purine absorption and serum uric acid levels.
However, at present, there are few pharmaceutical compositions for using these probiotics and other therapeutic drugs, and few drugs with better effects are needed to be developed.
Disclosure of Invention
Previous studies have demonstrated that Caspase-1, also known as IL-l convertase, can process precursor IL-1 β, produce mature IL-1 β, and is secreted extracellularly. IL-1 β can activate nodulin MyD88 by interacting with IL-1 β receptors on synoviocytes, endothelial cells, fibroblasts, etc., which in turn initiates NF-. Kappa.B, triggers the transcription of secondary inflammatory cytokines, producing large amounts of cytokines including IL-1 β, TNF-. Alpha., IL-6, and neutrophil chemokines. Therefore, the development of drugs inhibiting Caspase-1 activity can be used for treating gout.
In one aspect of the invention, a monoclonal antibody specific to Caspase-1 is provided.
In one aspect, the Caspase-1 monoclonal antibody is Cas-5H14, and the light chain variable region sequence is
DIVITQRPALMAASPGEKVTITCGARFAIPPVQNTWYQQKSGISPKPWIYVMIFEIPGVPARFSGSGSGTSYSLTITSMEAEDAATYYCFWCDVRKSEFGAGTKLELK
The heavy chain variable region sequence is
EVQLEESATELARPGASVKLSCKASGYIFSDICAHWIKQRPGQGLEWIGCLNKPKFARIDYVRFPGKATLTADKSSSTAYMQLSSLASEDSAVYYCAGDWASKSIWGLGTTLAVSS。
On one hand, the invention provides the application of the Caspase-1 monoclonal antibody in preparing a medicament for inhibiting the expression of IL-1 beta.
In another aspect of the invention, the invention provides an application of the Caspase-1 monoclonal antibody in preparation of a medicament for treating gout.
Previous researches show that lactobacillus casei ZM15 can efficiently degrade four purine substances, namely adenosine, guanylic acid, adenosine and guanosine, the degradation rate reaches 100%, uric acid and allantoin are not produced after degradation, the amount of free purine bases (xanthine, hypoxanthine and guanine) produced is low and is only 1.40mmol/L (accounting for 0.10% of total degradation products), the in vivo uric acid generation can be effectively reduced, and the blood uric acid level can be reduced. Therefore, the lactobacillus is used as a drug of the composition.
Furthermore, the invention also provides the application of the monoclonal antibody of Caspase-1 and lactobacillus casei ZM15 in preparing a kit for inhibiting the expression of IL-1 beta.
In another aspect of the invention, the use of a Caspase-1 monoclonal antibody and Lactobacillus casei ZM15 in the preparation of a kit for treating gout is provided.
The viable cell count of the Lactobacillus casei ZM15 is preferably 1.0X 10 to 3.0X 10 1CFU/g, more preferably 2.0X 10 to 1.0X 10 1CFU/g.
The dosage of the medicine box for treating gout is preferably 1-20 g/day, and more preferably 10 g/day.
Further, the compositions of the present invention utilize a buffering agent to adjust the pH. Suitable buffers for the composition are not limited, and examples thereof include gluconate, histidine, citrate, phosphate [ e.g., sodium or potassium ], succinate [ e.g., sodium ], acetate, tris (hydroxymethyl) aminomethane, glycine, arginine, and combinations thereof, and can be used individually depending on the pH to be adjusted. The pharmaceutical composition of the present invention preferably contains acetate, histidine, or phosphate as a buffer, more preferably histidine as a buffer. The concentration of the buffer is not particularly limited as long as it is pharmaceutically acceptable, and is preferably 1mM to 150mM, more preferably 5mM to 100mM, and still more preferably 10mM to 50mM. In addition, the concentration of the buffer is preferably about 1mM, about 5mM, about 10mM, about 15mM, about 20mM, about 25mM, about 30mM, about 35mM, about 40mM, about 45mM, or about 50mM. From the viewpoint of using a salt, particularly an inorganic salt buffer, it is preferable to use a concentration of less than 30mM, particularly 10mM or less.
Histidine (e.g., at a concentration of 5mM to 50mM, e.g., 10mM to 50mM, about 5mM, about 10mM, about 15mM, about 20mM, about 25mM, about 30mM, about 35mM, about 40mM, about 45mM, about 50 mM) is particularly beneficial as a buffer in the pharmaceutical compositions or kits of the invention. In one embodiment, the stable pharmaceutical composition contains 5mM to 20mM histidine. The pH of the pharmaceutical composition may be in the range of 4.0 to 8.0, pH in the range of 4.5 to 7.5, such as 5.0 to 7.0, 5.2 to 6.8, such as about 4.2, about 4.3, about 4.4, about 4.5, about 4.6, about 4.7, about 4.8, about 4.9, about 5.0, about 5.1, about 5.2, about 5.3, about 5.4, about 5.5, about 5.6, about 5.7, about 5.8, about 5.9, about 6.0, about 6.1, about 6.2, about 6.3, about 6.4, about 6.5, about 6.6, about 6.7, about 6.8, about 6.9, about 7.0, about 7.1, about 7.2, about 7.3, about 7.4, about 7.5, about 7.7, about 7.8, about 7.9, about 7.0, about 7.1, about 7.2, about 7.3, about 7.4, about 7.7.7, about 7.8 is common. The pharmaceutical composition of the present invention has an increased turbidity in long-term storage at pH4 or pH 8. In addition, when the pharmaceutical composition of the present invention has pH4 or pH8, pH drift is significant in long-term storage. Therefore, in one embodiment, the pH of the stable antibody-containing pharmaceutical composition is greater than 4 and less than 8, preferably 5 or more and 7 or less, more preferably 5.5 or more and 6.5 or less, and most preferably 6.0.
The pharmaceutical composition or kit of the present invention preferably contains a surfactant. Suitable surfactants for pharmaceutical compositions are not limited and include nonionic surfactants, ionic surfactants, zwitterionic surfactants, and combinations thereof. Typical surfactants for use in the present invention are not limited, and include sorbitan fatty acid esters (e.g., sorbitan monocaprylate, sorbitan monolaurate, sorbitan monopalmitate), sorbitan trioleate, glycerol fatty acid esters (e.g., glycerol monocaprylate, glycerol monomyristate, glycerol monostearate), polyglycerol fatty acid esters (e.g., decaglycerol monostearate, decaglycerol distearate, decaglycerol monolinoleate), polyoxyethylene sorbitan fatty acid esters (e.g., polyoxyethylene sorbitan monolaurate, polyoxyethylene sorbitan monooleate, polyoxyethylene sorbitan monostearate, polyoxyethylene sorbitan monopalmitate, polyoxyethylene sorbitan trioleate, polyoxyethylene sorbitan tristearate), polyoxyethylene sorbitan fatty acid esters (e.g., polyoxyethylene sorbitol tetrastearate, polyoxyethylene sorbitol tetraoleate), polyoxyethylene glycerol fatty acid esters (e.g., polyoxyethylene glycerol monostearate), polyethylene glycol fatty acid esters (e.g., polyethylene glycol distearate), polyoxyethylene alkyl ethers (e.g., polyoxyethylene lauryl ether), polyoxyethylene polyoxypropylene alkyl ethers (e.g., polyoxyethylene polyoxypropylene glycol, polyoxyethylene polyoxypropylene propyl ether, polyoxyethylene polyoxypropylene cetyl ether), polyoxyethylene alkylphenyl ethers (e.g., polyoxyethylene nonylphenyl ether), polyoxyethylene hydrogenated castor oils (e.g., polyoxyethylene castor oil, polyoxyethylene hydrogenated castor oil), polyoxyethylene beeswax derivatives (e.g., polyoxyethylene sorbitol beeswax), polyoxyethylene lanolin derivatives (e.g., polyoxyethylene lanolin), polyoxyethylene fatty acid amides (e.g., polyoxyethylene stearamide), C10-C18 alkylsulfates (e.g., sodium hexadecylsulfate, sodium lauryl sulfate, sodium oleyl sulfate), polyoxyethylene C10-C18 alkylether sulfates (e.g., sodium polyoxyethylene lauryl sulfate) and C1-C18 alkylsulfosuccinate salts (e.g., sodium lauryl sulfosuccinate) obtained by adding an average of 2 to 4 moles of ethylene oxide units, and natural surfactants such as lecithin, glycerophospholipids, sphingomyelin (e.g., sphingomyelin) and sucrose esters of C12-C18 fatty acids.
The pharmaceutical composition or kit of the present invention may contain 1 or more of the above surfactants. Preferred surfactants are nonionic surfactants (e.g., sorbitan fatty acid esters, sorbitan trioleate, glycerin fatty acid esters, polyglycerol fatty acid esters, polyoxyethylene sorbitan fatty acid esters, polyoxyethylene sorbitol fatty acid esters, polyoxyethylene glycerin fatty acid esters, polyoxyethylene alkyl ethers, polyoxyethylene polyoxypropylene alkyl ethers, polyoxyethylene alkylphenyl ethers, polyoxyethylene hydrogenated castor oil, polyoxyethylene beeswax derivatives, polyoxyethylene lanolin derivatives, polyoxyethylene fatty acid amides), more preferably polyoxyethylene alkyl ethers (e.g., poloxamer 188) or polyoxyethylene sorbitan fatty acid esters, such as polysorbate 20, 40, 60 or 80. The concentration of the surfactant may be any concentration commonly used in the art, and may be used, for example, at a concentration of about 0.01% (w/v) to about 0.1% (w/v), for example, about 0.01% (w/v) to about 0.04% (w/v), for example, about 0.01% (w/v), about 0.02% (w/v), about 0.04% (w/v), about 0.06% (w/v), about 0.08% (w/v), or about 0.1% (w/v). Among the surfactants, polysorbate 80 (tween 80) is particularly advantageous. In one embodiment, the stable pharmaceutical composition comprises about 0.02% (w/v) polysorbate 80. In one embodiment, the stable pharmaceutical composition contains about 0.02% (w/v) polysorbate 20.
Further, the pharmaceutical compositions or kits disclosed herein are intended for oral administration to humans and animals in unit dosage form or multiple dosage forms, such as capsules, caplets, powders, pellets, granules, tablets, microtablets, sachets or stick packs. The pharmaceutical composition may comprise compound (a) or further comprise compound (b) as described above. Preferably, the unit dosage form or multiple dosage forms are, for example, capsules, tablets, microtablets, sachets or stick packs. More preferably, the pharmaceutical composition is in the form of a capsule or tablet. This may be achieved by mixing the pharmaceutical composition as defined herein with diluents, lubricants, binders, disintegrants and/or absorbents, colouring, flavouring and sweetening agents.
Capsules comprising the particles or compositions of the invention as defined herein may be prepared using techniques known in the art. Suitable capsules may be selected from soft gelatin capsules, hard shell capsules, hard gelatin capsules, plant based shell capsules, hypromellose (HPMC) based capsules or mixtures thereof. A pharmaceutical composition, as described herein, may be presented in a hard gelatin capsule, a soft gelatin capsule, a hard or plant shell capsule, a Hypromellose (HPMC) capsule, wherein the pharmaceutical composition is further mixed with an inert solid diluent, such as calcium carbonate, calcium phosphate or cellulose-based excipients. Hard gelatin capsules are made from a two-piece outer gelatin shell called a body and a cap. The shell may comprise vegetable or animal gelatin (e.g. pork, beef or fish-based gelatin), water, one or more plasticizers, and possibly some preservatives. The capsules may hold a dry mixture in the form of a powder, tiny granules or granules, comprising a non-bile acid FXR agonist, e.g., compound (a), at least one binder, and optionally excipients. The outer shell may be transparent, opaque, colored or flavored. Capsules containing the particles may be coated with enteric and/or gastric soluble or delayed release coating materials using techniques well known in the art to achieve, for example, better stability in the gastrointestinal tract or to achieve a desired release rate. Hard gelatin capsules of any size (e.g., 000-5 in size) may be prepared.
Advantageous effects
Based on the characteristic that Caspase-1 can process precursor IL-1 beta, the epitope peptide is specifically screened and a specific monoclonal antibody is prepared by immunizing a mouse, the antibody can effectively inhibit the expression of the IL-1 beta in an in vitro cell model, and simultaneously can reduce the inflammation index in the mouse model in a limited manner after being combined with probiotics so as to treat gout, so that the invention has better effect.
Drawings
FIG. 1 is a diagram showing the result of the specific identification of monoclonal antibody
FIG. 2 Effect of monoclonal antibodies on IL-1 beta content in cell models
FIG. 3 is a graph showing the result of IL-1. Beta. Content in serum after treatment with mAb and/or probiotic
Detailed Description
The present invention may be understood more readily by reference to the following description of certain embodiments of the invention and the detailed description of the examples included therein. Before the present invention is further described, it is to be understood that this invention is not limited to particular embodiments described, as such embodiments are necessarily varied. It is also to be understood that the terminology used in the description is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
EXAMPLE 1 preparation of Caspase-1 monoclonal antibody
The DNASAR software is used for predicting secondary structures, surface characteristics (such as hydrophilicity, surface property and antigenicity) and the like of Caspase-1 protein sequences of human and mice, an online IEDB analysis tool is used for analyzing, and according to an analysis result, a conserved immunogenic peptide Cas with better immunogenicity is selected: pehktsdstflvfmshgi. The jieji peptide organisms were committed to synthesis.
Coupling an immunogenic peptide to a macromolecule KLH to form a Cas-KLH; cas peptides were additionally combined with a large molecule GGG, known as coat Immunoglobulin G, to form Cas-GGG for use in ELISA screening for antibody production.
Selecting SPF-grade 6-week BALB/c mice, female mice, 3 mice, immunizing 3 mice once, taking 80 mu g Cas-KLH conjugate each time, uniformly mixing the Cas-KLH conjugate with Freund's complete adjuvant according to the proportion of 1:1, then adopting a mouse subcutaneous multi-point injection method, separating for 3 weeks, taking 80 mu g Cas-KLH conjugate from 2 to 3 times, uniformly mixing the Cas-KLH conjugate with the Freund's incomplete adjuvant according to the proportion of 1:1, then adopting the mouse subcutaneous multi-point injection method, separating for 3 weeks from 2 and 3 times, taking blood after 3 weeks of immunization, measuring the titer, selecting a No. 2 mouse (1 25000) with the highest titer to carry out boosting immunization on 100 mu g Cas-KLH conjugate for immunization, and preparing cell fusion after 3 days of boosting immunization. According to the traditional monoclonal antibody preparation technology, hybridoma cell strains Cas-1D23 and Cas-5H14 with stable monoclonal antibody secretion are obtained through cloning culture by a 4-time limiting dilution method.
Preparing ascites from 8-week-old BALB/c mice by a conventional method, and treating the ascites with a single antibody of I: the dilution ratio is increased by 100, the reaction titer is detected by indirect ELISA, and the result shows that the titers of the Cas-1D23 monoclonal antibody and the Cas-5H14 monoclonal antibody are both above 1. And meanwhile, the subclass identification of the monoclonal antibody in the purified ascites is carried out by using an HRP-labeled goat anti-mouse antibody subclass identification kit, and the result shows that 2 monoclonal antibodies are IgG1 and light chains are kappa chains.
Example 2 identification of biological Functions of Cas-5H14 monoclonal antibodies
(1) Monoclonal antibody relative affinity identification: cas-GGG (l. Mu.g/well) was coated, monoclonal antibody concentrations were l00, 50, 25, l2.5, 6.25 and 3.125. Mu.g/ml, incubated at 37 ℃ for l hours, washed 3 times, then enzyme-labeled secondary antibody (l: 5000) was added, washed after 1 hour at 37 ℃, and then subjected to chromogenic assay with substrate, and the relative affinities were calculated as 50% of the maximum bound monoclonal antibodies, as shown in Table 1.
TABLE 1 Cas-5H14 monoclonal antibody relative affinities
Name of antibody | Relative affinity |
Cas-5H14 monoclonal antibody | (2.19±0.10)μg/mL |
As can be seen from the results in Table 1, the Cas-5H14 monoclonal antibody has better affinity.
(2) Cas-5H14 monoclonal antibody specificity identification: cas-GGG, BSA, recombinant human Caspase-3 protein (Biovision, cat # 1083-10) and recombinant human Caspase-1 protein (Biovision cat # 1081-25) were each coated with antigen at l. Mu.g/well and left overnight at 4 ℃. The concentration of the Cas-5H14 monoclonal antibody is 1 mug/mL, the goat anti-mouse Ig marked by AP is diluted according to 1.
As can be seen from the results of FIG. 1, the Cas-5H14 monoclonal antibody prepared by the invention shows positive effects only against Cas-GGG and recombinant human Caspase-1 protein, but has no obvious combination effect against recombinant human Caspase-3 protein, BSA, GGG and the like, which indicates that the monoclonal antibody prepared by the invention has better specificity.
The light chain sequence and the heavy chain sequence of the Cas-5H14 monoclonal antibody are amplified by adopting a kit and sequenced to obtain a light chain variable region sequence of DIVITQRPALMAASPGEKVTITCGARFAIPPVQNTWYQQKSGISPKPWIYVMIFEIPGVPARFSGSGSGTSYSLTITSMEAEDAATYYCFWCDVRKSEFGAGTKLELK and a heavy chain variable region sequence of EVQLEESATELARPGASVKLSCKASGYIFSDICAHWIKQRPGQGLEWIGCLNKPKFARIDYVRFPGKATLTADKSSSTAYMQLSSLASEDSAVYYCAGDWASKSIWGLGTTLAVSS.
Example 3 Effect of Cas-5H14 monoclonal antibodies on gout model cells
CO 2 After the mice were sacrificed, the femur and tibia were removed under sterile conditions, the muscle and other tissues were thoroughly removed, holes were punched at both ends of the femur and tibia with a 7-gauge needle, all bone marrow cells were washed out with PBS, and then a cell suspension was prepared with a 4-gauge needle, centrifuged at 1000 Xg for 5min at room temperature, after washing, the number of bone marrow cells was counted, and the cell concentration was adjusted to 1X 10 by using a DMEM medium containing 20% macrophage colony stimulating factor, 2mmol/L of glutamate, 0.1mmol/L of non-essential amino acids, 100mg/mL of streptomycin, and 10% of fetal bovine serum inactivated at high temperature 6 one/mL, and 4 mL/well in sterile 6-well plastic plates, at 37 ℃ in CO 2 Culturing in 5% culture box for 3d, changing culture solution to remove suspended cells, adding the same culture solution, and culturing until the blood cover sheet at the bottom of the culture plate is fully covered with elliptical macrophages. When the cell concentration reaches 2X 10 6 at/mL, mononuclear macrophages were transferred to serum-free tissue culture plates and the experimental groups first induced cells for 10h with 250. Mu.g/mL MSU crystals. Dividing the cells into blank control group (cells not treated), MSU induced group (MSU treated cells alone), and positive control diacerein + MSU group (diacerein used for MSU induced cells)Treatment is carried out, the concentration is 10 mug/mL), a Cas-5H14 monoclonal antibody + MSU group (cells induced by MSU are treated by the Cas-5H14 monoclonal antibody, the concentration is 10 mug/mL), the IL-1 beta content is detected, and blank control cells are not treated. The results are shown in FIG. 2.
Compared with a blank control group, the level of IL-1 beta in the MSU induction group is obviously increased (difference is obvious, P is less than 0.01), compared with a positive control group, after the treatment by the Cas-5H14 monoclonal antibody, the content of IL-1 beta is only (83.5 +/-4.0) pg/mL, and the effect is better than that of the positive control group. This fully suggests that the Cas-5H14 monoclonal antibody can be used for treating gout by inhibiting the processing precursor IL-1 beta and further inhibiting the content of mature IL-1 beta.
Example 4 preparation of probiotics for the treatment of gout
Taking out original strain ZM15 (preservation number is CGMCC No. 13980) of lactobacillus casei strain from-80 ℃, picking out the original strain with sterilized toothpick, then marking on YE plate, culturing at constant temperature of 37 ℃ for 2d, picking out a single clone with toothpick, inoculating the single clone into 3mL of liquid sterile MRS culture medium for overnight culture, transferring 1% of inoculum size into 100mL of sterilized liquid MRS culture medium, standing at 37 ℃ for 12h, then culturing at 150r/min in a shaking way for 28h, centrifuging at 10000r/min for 50min, collecting precipitate, adjusting the viable count to 1.0 x 10 10 CFU/g, 10g and 10g maltodextrin are taken and stirred for 10min at the rotating speed of 1000r/min, and the probiotic composition, namely the probiotic activity product is obtained.
Wherein the MRS culture medium comprises (g/L): 10.0 parts of peptone, 8.0 parts of beef extract, 4.0 parts of yeast powder, 20.0 parts of glucose, 2.0 parts of dipotassium phosphate, 2.0 parts of diammonium hydrogen citrate, 5.0 parts of sodium acetate, 0.2 part of magnesium sulfate, 0.04 part of manganese sulfate, 801.0 part of tween-801.0, 5.7 +/-0.2 parts of pH value and sterilization at 118 ℃ for 25min. YE culture medium: 15g of yeast powder, 20g of glucose, 1000mL of distilled water, sterilizing the yeast powder and the glucose respectively, cooling and mixing, adding 1.5% of agar into the solid YE culture medium, and 2% of CaCO 3 (CaCO 3 Sterilized separately from the medium).
EXAMPLE 5 therapeutic testing of drugs on mouse models
Male Kunming mice of 6 weeks old are selected, a model group is inserted into the inner side of a tibial tendon from the 45-degree direction of the back side of the right hind limb ankle joint of a tested rat by using a No. 6 injection needle, 0.05mL of MSU solution (50 mg/mL) is injected into the ankle joint cavity, and the acute GA model is prepared by once more administration at an interval of 3d.
The experiment was performed using the following grouping pattern, with 10 mice per group:
the blank control group (group A) and the model group (group B) were administered with physiological saline;
positive control group (group C): 1mg of diacerein per 100g of mouse body weight, and carrying out intraperitoneal injection administration;
mab treatment group (group D): cas-5H14 monoclonal antibody 1mg/100g mouse weight, intraperitoneal injection administration;
probiotic group (group E): probiotic composition 4.0 x 10 prepared according to example 4 9 CFU/day, administration by gavage;
mab combined probiotic group (group F): 1mg of Cas-5H14 monoclonal antibody per 100g of mouse body weight, and carrying out intraperitoneal injection administration; meanwhile, the probiotic composition prepared according to example 4 was 4.0 × 10 9 CFU/day, administration by gavage;
dosing was started once daily for 3 days in each group after the start of molding. After 3d, the inflammation index, the grading standard of the inflammation index: normally 0 (score 0); erythema of the articular skin, mild swelling, bony signs visible as grade 1 (score 2); the joint is obviously red and swollen, the bony mark disappears, but the swelling is limited to the joint part and is grade 2 (4 points); swelling of the limbs other than the joints was grade 3 (score 6). Meanwhile, the joint cavity is internally used by 0.5mL. The solution is washed by physiological saline, and 0.05mL of washing solution is reserved. The leukocytes were immediately counted under microscopic examination. The results are shown in table 2 below.
TABLE 2 inflammation index and leukocyte count in the groups of mice
As can be seen from the results in table 2, the inflammation index of each experimental group has a significant statistical significance (P < 0.01) compared to the model group. According to observation, the swelling degree of the joints of rats in each group is increased after model building, the inflammation indexes are reduced to different degrees after treatment, particularly, the monoclonal antibody combined probiotic group has a remarkable down-regulation effect, the inflammation indexes and the white blood cell number show a good treatment effect, the swelling of the joints is also remarkably relieved, and the good treatment effect is reflected.
72h after molding, taking blood from heart of an anesthetized rat with 0.8mL of chloral hydrate of 100g/L, injecting 1mL of the blood into an EDTA anticoagulation tube, taking serum to detect the amount of IL-1 beta, and detecting by adopting an ELISA method strictly according to the kit instructions. The results are shown in FIG. 3.
As can be seen from the results of fig. 3, the amount of IL-1 β was significantly increased in the model group relative to the blank control group (P < 0.01). The amount of IL-1 beta can be reduced by adopting probiotic treatment, but the reduction amplitude is not particularly high relative to the Cas-5H14 monoclonal antibody or a positive control, but the probiotic and the Cas-5H14 monoclonal antibody have better reduction effect after being combined, and the amount of IL-1 beta is only (22.03 +/-0.52) mu g/L, so that the effect is better.
Finally, it should be noted that: the above embodiments are only used to illustrate the technical solution of the present invention, and not to limit the same; while the invention has been described in detail and with reference to the foregoing embodiments, it will be understood by those skilled in the art that: the technical solutions described in the foregoing embodiments may still be modified, or some or all of the technical features may be equivalently replaced; and these modifications or substitutions do not depart from the spirit of the corresponding technical solutions of the embodiments of the present invention.
Claims (6)
- Caspase-1 monoclonal antibody Cas-5H14, characterized in that: the light chain variable region sequence is shown as SEQ ID NO:1 is shown in the specification; the heavy chain variable region sequence is shown as SEQ ID NO:2, respectively.
- The application of the Caspase-1 monoclonal antibody in preparing a pharmaceutical composition for treating gout, wherein the Caspase-1 monoclonal antibody is Cas-5H14, and the light chain variable region sequence of the Caspase-1 monoclonal antibody is shown as SEQ ID NO:1 is shown in the specification; the heavy chain variable region sequence is shown as SEQ ID NO:2, respectively.
- 3. The probiotic composition prepared by a high-activity biological fermentation method and the application of a Caspase-1 monoclonal antibody in preparing a kit for treating gout, wherein the Caspase-1 monoclonal antibody is Cas-5H14, and the light chain variable region sequence of the Caspase-1 monoclonal antibody is shown as SEQ ID NO:1 is shown in the specification; the heavy chain variable region sequence is shown as SEQ ID NO:2 is shown in the specification; the probiotic composition prepared by the high-activity biological fermentation method specifically comprises the steps of taking out a starting strain of lactobacillus casei ZM15 with the preservation number of CGMCC No.13980 from minus 80 ℃, picking the starting strain by using a sterilized toothpick, then marking the selected starting strain on a YE flat plate, culturing the selected starting strain at the constant temperature of 37 ℃ for 2d, picking a single clone by using the toothpick, inoculating the single clone into a 3mL liquid sterile MRS culture medium for overnight culture, transferring the selected bacterial strain into 100mL of sterilized liquid MRS culture medium by using the inoculation amount of 1%, standing the obtained culture medium at the temperature of 37 ℃ for 12h, then culturing the obtained culture medium by using a 150r/min shaking table to 28h, centrifuging the obtained culture medium for 50min by using 10000r/min, collecting precipitates, adjusting the viable count to be 1.0 x 1010CFU/g, and stirring 10g and 10g of maltodextrin at the rotating speed of 1000r/min to obtain the probiotic composition.
- 4. Use according to claim 2 or 3, wherein the pharmaceutical composition or kit comprises a suitable buffer.
- 5. Use according to claim 2 or 3, wherein the pharmaceutical composition or kit comprises a suitable surfactant.
- 6. The use of claim 4, wherein the buffering agent is histidine.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202211113384.9A CN115873121A (en) | 2022-09-14 | 2022-09-14 | High-activity biological fermentation method and pharmaceutical composition containing probiotics |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202211113384.9A CN115873121A (en) | 2022-09-14 | 2022-09-14 | High-activity biological fermentation method and pharmaceutical composition containing probiotics |
Publications (1)
Publication Number | Publication Date |
---|---|
CN115873121A true CN115873121A (en) | 2023-03-31 |
Family
ID=85769841
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202211113384.9A Pending CN115873121A (en) | 2022-09-14 | 2022-09-14 | High-activity biological fermentation method and pharmaceutical composition containing probiotics |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN115873121A (en) |
-
2022
- 2022-09-14 CN CN202211113384.9A patent/CN115873121A/en active Pending
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN101795685A (en) | hydroxyproline compositions and uses thereof | |
EA014070B1 (en) | Use of a herbal composition for the treatment of inflammatory disorders | |
CN116211900B (en) | Microecological viable bacteria preparation for improving polycystic ovary syndrome, and preparation method and application thereof | |
JPH09508782A (en) | Biologically active fermented dairy product Acidolacto-narine and process for producing the same | |
JP4132635B2 (en) | Uninactivated enzyme-enhanced composition | |
CN114869917A (en) | Application of lactobacillus plantarum N13 in preparation of medicine for preventing and treating vaginitis or inhibiting pathogenic bacteria | |
CN1454901A (en) | Gynaecological anti-infective specificity IgY and its combined preparation | |
JP2009044976A (en) | Animal body type-improving feeding system | |
CN115873121A (en) | High-activity biological fermentation method and pharmaceutical composition containing probiotics | |
CN116590200A (en) | Lactobacillus johnsonii and application thereof in preparation of products for preventing and/or improving acute pancreatitis | |
CN115850494A (en) | Medicine prepared by combining active product prepared by biological fermentation with probiotics | |
CN116948901A (en) | Application of Weissella antrum D-2 extracellular polysaccharide in inhibiting colon cancer cells | |
US20240041948A1 (en) | Compositions and methods using at least one strain of staphylococcus carnosus therapeutically or prophylactically | |
CN112546074B (en) | Bifidobacterium breve capable of inhibiting release of IL-23 and Th17 axis-related inflammatory factors and application thereof | |
JP4377117B2 (en) | Composition for improving inflammatory diseases | |
CN101357142A (en) | Use of Clostridium butyricum in preparing medicine composition for preventing and treating cerebrovascular disease | |
JP2892300B2 (en) | HSP47 synthesis inhibitor | |
MacLeod | Pigs: The Homoeopathic Approach to the Treatment and Prevention of Diseases | |
CN116925186B (en) | Mesenchymal stem cell treatment method for neonatal pulmonary dysplasia | |
CN117384790B (en) | Pediococcus pentosaceus KS5 and application thereof in preparation of sleep-aiding drugs | |
TWI789123B (en) | Using Growth Factors to Treat Arthritis | |
CN114949242B (en) | Application of selenium-containing compound in preparation of osteoclast differentiation inhibitor | |
JP6830266B2 (en) | Composition for improving NASH, food composition for improving NASH, beverage composition for improving NASH, composition for preventing transition from NASH to liver cirrhosis, and composition for preventing transition from NASH to hepatocellular carcinoma | |
US20230139904A1 (en) | Method for promoting bone healing | |
JPH11180865A (en) | Mixture of lactic acid condensate and composition containing the same |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
WD01 | Invention patent application deemed withdrawn after publication | ||
WD01 | Invention patent application deemed withdrawn after publication |
Application publication date: 20230331 |