CN115572326A - Triplex agonists of GLP-1, GCG and GIP receptors - Google Patents
Triplex agonists of GLP-1, GCG and GIP receptors Download PDFInfo
- Publication number
- CN115572326A CN115572326A CN202210698013.5A CN202210698013A CN115572326A CN 115572326 A CN115572326 A CN 115572326A CN 202210698013 A CN202210698013 A CN 202210698013A CN 115572326 A CN115572326 A CN 115572326A
- Authority
- CN
- China
- Prior art keywords
- seq
- aib
- phe
- ser
- pro
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 102100040918 Pro-glucagon Human genes 0.000 title claims abstract description 16
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 title claims abstract description 15
- 108010036598 gastric inhibitory polypeptide receptor Proteins 0.000 title claims abstract description 10
- 239000000556 agonist Substances 0.000 title claims description 5
- 101710198884 GATA-type zinc finger protein 1 Proteins 0.000 title claims 2
- 150000001875 compounds Chemical class 0.000 claims abstract description 63
- 206010012601 diabetes mellitus Diseases 0.000 claims abstract description 20
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 10
- 208000008589 Obesity Diseases 0.000 claims abstract description 7
- 208000030159 metabolic disease Diseases 0.000 claims abstract description 7
- 235000020824 obesity Nutrition 0.000 claims abstract description 7
- 208000032928 Dyslipidaemia Diseases 0.000 claims abstract description 5
- 208000017170 Lipid metabolism disease Diseases 0.000 claims abstract description 5
- 208000001145 Metabolic Syndrome Diseases 0.000 claims abstract description 4
- 201000000690 abdominal obesity-metabolic syndrome Diseases 0.000 claims abstract description 4
- 208000008338 non-alcoholic fatty liver disease Diseases 0.000 claims abstract description 4
- 208000010706 fatty liver disease Diseases 0.000 claims abstract description 3
- 206010053219 non-alcoholic steatohepatitis Diseases 0.000 claims abstract description 3
- 230000002265 prevention Effects 0.000 claims abstract description 3
- -1 [ 2- (2-amino-ethoxy) -ethoxy]-acetyl Chemical group 0.000 claims description 106
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 98
- 125000004042 4-aminobutyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])N([H])[H] 0.000 claims description 63
- 230000004048 modification Effects 0.000 claims description 60
- 238000012986 modification Methods 0.000 claims description 60
- 239000003814 drug Substances 0.000 claims description 19
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 13
- 239000000203 mixture Substances 0.000 claims description 10
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 9
- 208000035475 disorder Diseases 0.000 claims description 7
- 239000003085 diluting agent Substances 0.000 claims description 5
- 239000003937 drug carrier Substances 0.000 claims description 4
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 4
- 238000004519 manufacturing process Methods 0.000 claims description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 abstract description 44
- 239000008103 glucose Substances 0.000 abstract description 44
- 102000051325 Glucagon Human genes 0.000 abstract description 14
- 108060003199 Glucagon Proteins 0.000 abstract description 14
- 101800000224 Glucagon-like peptide 1 Proteins 0.000 abstract description 14
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 abstract description 14
- 229960004666 glucagon Drugs 0.000 abstract description 14
- 108010004460 Gastric Inhibitory Polypeptide Proteins 0.000 abstract description 9
- 102100039994 Gastric inhibitory polypeptide Human genes 0.000 abstract description 9
- 108020003175 receptors Proteins 0.000 abstract description 7
- 230000001419 dependent effect Effects 0.000 abstract description 5
- 239000000859 incretin Substances 0.000 abstract description 4
- GCYXWQUSHADNBF-AAEALURTSA-N preproglucagon 78-108 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 GCYXWQUSHADNBF-AAEALURTSA-N 0.000 abstract description 4
- 239000013559 triple agonist Substances 0.000 abstract description 4
- 108010063919 Glucagon Receptors Proteins 0.000 abstract description 3
- MGXWVYUBJRZYPE-YUGYIWNOSA-N incretin Chemical class C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=C(O)C=C1 MGXWVYUBJRZYPE-YUGYIWNOSA-N 0.000 abstract description 3
- 230000001270 agonistic effect Effects 0.000 abstract description 2
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 description 110
- 239000008280 blood Substances 0.000 description 59
- 210000004369 blood Anatomy 0.000 description 59
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 55
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 47
- IVDFVBVIVLJJHR-LKXGYXEUSA-N Thr-Ser-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O IVDFVBVIVLJJHR-LKXGYXEUSA-N 0.000 description 47
- 108010068265 aspartyltyrosine Proteins 0.000 description 47
- QPOUERMDWKKZEG-HJPIBITLSA-N Tyr-Ser-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 QPOUERMDWKKZEG-HJPIBITLSA-N 0.000 description 46
- LEHPJMKVGFPSSP-ZQINRCPSSA-N Ile-Glu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)[C@@H](C)CC)C(O)=O)=CNC2=C1 LEHPJMKVGFPSSP-ZQINRCPSSA-N 0.000 description 43
- JXFLPKSDLDEOQK-JHEQGTHGSA-N Gln-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CCC(N)=O JXFLPKSDLDEOQK-JHEQGTHGSA-N 0.000 description 41
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 41
- 241000699670 Mus sp. Species 0.000 description 41
- 108010031719 prolyl-serine Proteins 0.000 description 40
- 230000000694 effects Effects 0.000 description 37
- JCFYLFOCALSNLQ-GUBZILKMSA-N Lys-Ala-Gln Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(O)=O JCFYLFOCALSNLQ-GUBZILKMSA-N 0.000 description 36
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 31
- SBVPYBFMIGDIDX-SRVKXCTJSA-N Pro-Pro-Pro Chemical compound OC(=O)[C@@H]1CCCN1C(=O)[C@H]1N(C(=O)[C@H]2NCCC2)CCC1 SBVPYBFMIGDIDX-SRVKXCTJSA-N 0.000 description 27
- UQFYNFTYDHUIMI-WHFBIAKZSA-N Ser-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](N)CO UQFYNFTYDHUIMI-WHFBIAKZSA-N 0.000 description 27
- MYGQXVYRZMKRDB-SRVKXCTJSA-N Leu-Asp-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN MYGQXVYRZMKRDB-SRVKXCTJSA-N 0.000 description 26
- WNGVUZWBXZKQES-YUMQZZPRSA-N Leu-Ala-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O WNGVUZWBXZKQES-YUMQZZPRSA-N 0.000 description 24
- QNBVTHNJGCOVFA-AVGNSLFASA-N Leu-Leu-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCC(O)=O QNBVTHNJGCOVFA-AVGNSLFASA-N 0.000 description 24
- 239000004472 Lysine Substances 0.000 description 23
- 238000007385 chemical modification Methods 0.000 description 23
- DLSWIYLPEUIQAV-UHFFFAOYSA-N Semaglutide Chemical compound CCC(C)C(NC(=O)C(Cc1ccccc1)NC(=O)C(CCC(O)=O)NC(=O)C(CCCCNC(=O)COCCOCCNC(=O)COCCOCCNC(=O)CCC(NC(=O)CCCCCCCCCCCCCCCCC(O)=O)C(O)=O)NC(=O)C(C)NC(=O)C(C)NC(=O)C(CCC(N)=O)NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)C(CC(C)C)NC(=O)C(Cc1ccc(O)cc1)NC(=O)C(CO)NC(=O)C(CO)NC(=O)C(NC(=O)C(CC(O)=O)NC(=O)C(CO)NC(=O)C(NC(=O)C(Cc1ccccc1)NC(=O)C(NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)C(C)(C)NC(=O)C(N)Cc1cnc[nH]1)C(C)O)C(C)O)C(C)C)C(=O)NC(C)C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NC(CC(C)C)C(=O)NC(C(C)C)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CCCNC(N)=N)C(=O)NCC(O)=O DLSWIYLPEUIQAV-UHFFFAOYSA-N 0.000 description 17
- TTXYKSADPSNOIF-IHRRRGAJSA-N Arg-Asp-Phe Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O TTXYKSADPSNOIF-IHRRRGAJSA-N 0.000 description 16
- 210000004027 cell Anatomy 0.000 description 15
- HAOUOFNNJJLVNS-BQBZGAKWSA-N Gly-Pro-Ser Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O HAOUOFNNJJLVNS-BQBZGAKWSA-N 0.000 description 14
- 230000037396 body weight Effects 0.000 description 14
- 229940079593 drug Drugs 0.000 description 14
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 14
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 13
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 13
- 235000004279 alanine Nutrition 0.000 description 13
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 13
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 12
- BUEFQXUHTUZXHR-LURJTMIESA-N Gly-Gly-Pro zwitterion Chemical compound NCC(=O)NCC(=O)N1CCC[C@H]1C(O)=O BUEFQXUHTUZXHR-LURJTMIESA-N 0.000 description 12
- 108010076324 alanyl-glycyl-glycine Proteins 0.000 description 12
- 108010006664 gamma-glutamyl-glycyl-glycine Proteins 0.000 description 12
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 11
- 241001465754 Metazoa Species 0.000 description 11
- 108010092854 aspartyllysine Proteins 0.000 description 11
- 230000037406 food intake Effects 0.000 description 11
- 235000012631 food intake Nutrition 0.000 description 11
- 230000007774 longterm Effects 0.000 description 11
- NKVZTQVGUNLLQW-JBDRJPRFSA-N Ile-Ala-Ala Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)O)N NKVZTQVGUNLLQW-JBDRJPRFSA-N 0.000 description 10
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 10
- 230000001603 reducing effect Effects 0.000 description 10
- CZIVKMOEXPILDK-SRVKXCTJSA-N Asp-Tyr-Ser Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O CZIVKMOEXPILDK-SRVKXCTJSA-N 0.000 description 9
- JKPGHIQCHIIRMS-AVGNSLFASA-N Gln-Asp-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)N)N JKPGHIQCHIIRMS-AVGNSLFASA-N 0.000 description 9
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 9
- GNRMAQSIROFNMI-IXOXFDKPSA-N Phe-Thr-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O GNRMAQSIROFNMI-IXOXFDKPSA-N 0.000 description 9
- 150000004665 fatty acids Chemical class 0.000 description 9
- 235000013922 glutamic acid Nutrition 0.000 description 9
- 239000004220 glutamic acid Substances 0.000 description 9
- 238000000034 method Methods 0.000 description 9
- SBVJJNJLFWSJOV-UBHSHLNASA-N Arg-Ala-Phe Chemical compound NC(=N)NCCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 SBVJJNJLFWSJOV-UBHSHLNASA-N 0.000 description 8
- BDFCIKANUNMFGB-PMVVWTBXSA-N His-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CC1=CN=CN1 BDFCIKANUNMFGB-PMVVWTBXSA-N 0.000 description 8
- YKNBJXOJTURHCU-DCAQKATOSA-N Leu-Asp-Arg Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N YKNBJXOJTURHCU-DCAQKATOSA-N 0.000 description 8
- ILJREDZFPHTUIE-GUBZILKMSA-N Leu-Asp-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O ILJREDZFPHTUIE-GUBZILKMSA-N 0.000 description 8
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 8
- QIJVAFLRMVBHMU-KKUMJFAQSA-N Lys-Asp-Phe Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O QIJVAFLRMVBHMU-KKUMJFAQSA-N 0.000 description 8
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 8
- 229960000310 isoleucine Drugs 0.000 description 8
- 239000011347 resin Substances 0.000 description 8
- 229920005989 resin Polymers 0.000 description 8
- 108010060325 semaglutide Proteins 0.000 description 8
- 229950011186 semaglutide Drugs 0.000 description 8
- 239000004475 Arginine Substances 0.000 description 7
- 238000011740 C57BL/6 mouse Methods 0.000 description 7
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 7
- 210000004185 liver Anatomy 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 7
- LLWQVJNHMYBLLK-CDMKHQONSA-N Gly-Thr-Phe Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O LLWQVJNHMYBLLK-CDMKHQONSA-N 0.000 description 6
- JXMSHKFPDIUYGS-SIUGBPQLSA-N Ile-Glu-Tyr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)N JXMSHKFPDIUYGS-SIUGBPQLSA-N 0.000 description 6
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 6
- AUEJLPRZGVVDNU-UHFFFAOYSA-N N-L-tyrosyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CC1=CC=C(O)C=C1 AUEJLPRZGVVDNU-UHFFFAOYSA-N 0.000 description 6
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 6
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 6
- 150000003839 salts Chemical class 0.000 description 6
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 6
- 108010078580 tyrosylleucine Proteins 0.000 description 6
- 239000003981 vehicle Substances 0.000 description 6
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 5
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 5
- FZIJIFCXUCZHOL-CIUDSAMLSA-N Lys-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN FZIJIFCXUCZHOL-CIUDSAMLSA-N 0.000 description 5
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 5
- 235000001014 amino acid Nutrition 0.000 description 5
- 229940024606 amino acid Drugs 0.000 description 5
- 150000001413 amino acids Chemical class 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 108010025153 lysyl-alanyl-alanine Proteins 0.000 description 5
- 102000004196 processed proteins & peptides Human genes 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 239000007929 subcutaneous injection Substances 0.000 description 5
- 238000010254 subcutaneous injection Methods 0.000 description 5
- BTSOGEDATSQOAF-SMAAHMJQSA-N tirzepatide Chemical group CC[C@H](C)[C@@H](C(N[C@@H](C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCNC(COCCOCCNC(COCCOCCNC(CC[C@H](C(O)=O)NC(CCCCCCCCCCCCCCCCCCC(O)=O)=O)=O)=O)=O)C(N[C@@H](C)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H](C(C)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC1=CNC2=C1C=CC=C2)C(N[C@@H](CC(C)C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(NCC(NCC(N(CCC1)[C@@H]1C(N[C@@H](CO)C(N[C@@H](CO)C(NCC(N[C@@H](C)C(N(CCC1)[C@@H]1C(N(CCC1)[C@@H]1C(N(CCC1)[C@@H]1C(N[C@@H](CO)C(N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)NC([C@H](CCCCN)NC([C@H](CC(O)=O)NC([C@H](CC(C)C)NC(C(C)(C)NC([C@H]([C@@H](C)CC)NC([C@H](CO)NC([C@H](CC(C=C1)=CC=C1O)NC([C@H](CC(O)=O)NC([C@H](CO)NC([C@H]([C@@H](C)O)NC([C@H](CC1=CC=CC=C1)NC([C@H]([C@@H](C)O)NC(CNC([C@H](CCC(O)=O)NC(C(C)(C)NC([C@H](CC(C=C1)=CC=C1O)N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O BTSOGEDATSQOAF-SMAAHMJQSA-N 0.000 description 5
- MXECDVKIKUSSNC-JTQLQIEISA-N (2s)-2-amino-3-(2-fluorophenyl)-2-methylpropanoic acid Chemical compound OC(=O)[C@](N)(C)CC1=CC=CC=C1F MXECDVKIKUSSNC-JTQLQIEISA-N 0.000 description 4
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- 241000282414 Homo sapiens Species 0.000 description 4
- HPCFRQWLTRDGHT-AJNGGQMLSA-N Ile-Leu-Leu Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O HPCFRQWLTRDGHT-AJNGGQMLSA-N 0.000 description 4
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 4
- YIBOAHAOAWACDK-QEJZJMRPSA-N Lys-Ala-Phe Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 YIBOAHAOAWACDK-QEJZJMRPSA-N 0.000 description 4
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- IEWKKXZRJLTIOV-AVGNSLFASA-N Tyr-Ser-Gln Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(O)=O IEWKKXZRJLTIOV-AVGNSLFASA-N 0.000 description 4
- RKIGNDAHUOOIMJ-BQFCYCMXSA-N Val-Glu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)C(C)C)C(O)=O)=CNC2=C1 RKIGNDAHUOOIMJ-BQFCYCMXSA-N 0.000 description 4
- 235000003704 aspartic acid Nutrition 0.000 description 4
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 4
- 238000007865 diluting Methods 0.000 description 4
- 108010078144 glutaminyl-glycine Proteins 0.000 description 4
- 239000010413 mother solution Substances 0.000 description 4
- 229920001184 polypeptide Polymers 0.000 description 4
- 125000006239 protecting group Chemical group 0.000 description 4
- 239000012224 working solution Substances 0.000 description 4
- GVEODXUBBFDBPW-MGHWNKPDSA-N Ile-Tyr-Leu Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(O)=O)CC1=CC=C(O)C=C1 GVEODXUBBFDBPW-MGHWNKPDSA-N 0.000 description 3
- 102000004877 Insulin Human genes 0.000 description 3
- 108090001061 Insulin Proteins 0.000 description 3
- MJOZZTKJZQFKDK-GUBZILKMSA-N Leu-Ala-Gln Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(N)=O MJOZZTKJZQFKDK-GUBZILKMSA-N 0.000 description 3
- 102000015731 Peptide Hormones Human genes 0.000 description 3
- 108010038988 Peptide Hormones Proteins 0.000 description 3
- BSCBBPKDVOZICB-KKUMJFAQSA-N Tyr-Leu-Asp Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O BSCBBPKDVOZICB-KKUMJFAQSA-N 0.000 description 3
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 3
- 239000012131 assay buffer Substances 0.000 description 3
- 230000001684 chronic effect Effects 0.000 description 3
- 229940125396 insulin Drugs 0.000 description 3
- 230000000968 intestinal effect Effects 0.000 description 3
- 239000007928 intraperitoneal injection Substances 0.000 description 3
- 239000000813 peptide hormone Substances 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 210000003462 vein Anatomy 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 2
- SKTGPBFTMNLIHQ-KKUMJFAQSA-N Arg-Glu-Phe Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O SKTGPBFTMNLIHQ-KKUMJFAQSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- LFIVHGMKWFGUGK-IHRRRGAJSA-N Gln-Glu-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)N)N LFIVHGMKWFGUGK-IHRRRGAJSA-N 0.000 description 2
- 206010018429 Glucose tolerance impaired Diseases 0.000 description 2
- QXPRJQPCFXMCIY-NKWVEPMBSA-N Gly-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)CN QXPRJQPCFXMCIY-NKWVEPMBSA-N 0.000 description 2
- WGVPDSNCHDEDBP-KKUMJFAQSA-N His-Asp-Phe Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O WGVPDSNCHDEDBP-KKUMJFAQSA-N 0.000 description 2
- WEIYKCOEVBUJQC-JYJNAYRXSA-N His-Glu-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC2=CN=CN2)N WEIYKCOEVBUJQC-JYJNAYRXSA-N 0.000 description 2
- 206010020772 Hypertension Diseases 0.000 description 2
- YKRYHWJRQUSTKG-KBIXCLLPSA-N Ile-Ala-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N YKRYHWJRQUSTKG-KBIXCLLPSA-N 0.000 description 2
- VAXBXNPRXPHGHG-BJDJZHNGSA-N Ile-Ala-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)O)N VAXBXNPRXPHGHG-BJDJZHNGSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- RXGLHDWAZQECBI-SRVKXCTJSA-N Leu-Leu-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O RXGLHDWAZQECBI-SRVKXCTJSA-N 0.000 description 2
- DUTMKEAPLLUGNO-JYJNAYRXSA-N Lys-Glu-Phe Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O DUTMKEAPLLUGNO-JYJNAYRXSA-N 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- MKGIILKDUGDRRO-FXQIFTODSA-N Pro-Ser-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1 MKGIILKDUGDRRO-FXQIFTODSA-N 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 108010028939 alanyl-alanyl-lysyl-alanine Proteins 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 230000001276 controlling effect Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 230000002218 hypoglycaemic effect Effects 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 108010044374 isoleucyl-tyrosine Proteins 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 238000001819 mass spectrum Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 108010077112 prolyl-proline Proteins 0.000 description 2
- 239000000018 receptor agonist Substances 0.000 description 2
- 229940044601 receptor agonist Drugs 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- DYHSDKLCOJIUFX-UHFFFAOYSA-N tert-butoxycarbonyl anhydride Chemical compound CC(C)(C)OC(=O)OC(=O)OC(C)(C)C DYHSDKLCOJIUFX-UHFFFAOYSA-N 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- 108010080629 tryptophan-leucine Proteins 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- VDWWLJRQDNTHJB-MXAMYCJDSA-N (2s)-2-[[(2s,3r)-2-[[2-[[(2s)-5-amino-2-[[(2s)-2-[[(2s)-2-amino-3-(1h-imidazol-5-yl)propanoyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]acetyl]amino]-3-hydroxybutanoyl]amino]-3-phenylpropanoic acid Chemical compound C([C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CN=CN1 VDWWLJRQDNTHJB-MXAMYCJDSA-N 0.000 description 1
- BDNKZNFMNDZQMI-UHFFFAOYSA-N 1,3-diisopropylcarbodiimide Chemical compound CC(C)N=C=NC(C)C BDNKZNFMNDZQMI-UHFFFAOYSA-N 0.000 description 1
- ASOKPJOREAFHNY-UHFFFAOYSA-N 1-Hydroxybenzotriazole Chemical compound C1=CC=C2N(O)N=NC2=C1 ASOKPJOREAFHNY-UHFFFAOYSA-N 0.000 description 1
- 125000001431 2-aminoisobutyric acid group Chemical group [#6]C([#6])(N*)C(*)=O 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- MQIGTEQXYCRLGK-BQBZGAKWSA-N Ala-Gly-Pro Chemical compound C[C@H](N)C(=O)NCC(=O)N1CCC[C@H]1C(O)=O MQIGTEQXYCRLGK-BQBZGAKWSA-N 0.000 description 1
- VHEVVUZDDUCAKU-FXQIFTODSA-N Ala-Met-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(O)=O VHEVVUZDDUCAKU-FXQIFTODSA-N 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- IBLAOXSULLECQZ-IUKAMOBKSA-N Asn-Ile-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CC(N)=O IBLAOXSULLECQZ-IUKAMOBKSA-N 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 210000002237 B-cell of pancreatic islet Anatomy 0.000 description 1
- 208000024172 Cardiovascular disease Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- BDAGIHXWWSANSR-UHFFFAOYSA-M Formate Chemical compound [O-]C=O BDAGIHXWWSANSR-UHFFFAOYSA-M 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 1
- 102100039997 Gastric inhibitory polypeptide receptor Human genes 0.000 description 1
- YJIUYQKQBBQYHZ-ACZMJKKPSA-N Gln-Ala-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(O)=O YJIUYQKQBBQYHZ-ACZMJKKPSA-N 0.000 description 1
- 102100040890 Glucagon receptor Human genes 0.000 description 1
- 108010086246 Glucagon-Like Peptide-1 Receptor Proteins 0.000 description 1
- 102100032882 Glucagon-like peptide 1 receptor Human genes 0.000 description 1
- 229940089838 Glucagon-like peptide 1 receptor agonist Drugs 0.000 description 1
- 208000002705 Glucose Intolerance Diseases 0.000 description 1
- RJIVPOXLQFJRTG-LURJTMIESA-N Gly-Arg-Gly Chemical compound OC(=O)CNC(=O)[C@@H](NC(=O)CN)CCCN=C(N)N RJIVPOXLQFJRTG-LURJTMIESA-N 0.000 description 1
- OLIFSFOFKGKIRH-WUJLRWPWSA-N Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CN OLIFSFOFKGKIRH-WUJLRWPWSA-N 0.000 description 1
- AEMRFAOFKBGASW-UHFFFAOYSA-M Glycolate Chemical compound OCC([O-])=O AEMRFAOFKBGASW-UHFFFAOYSA-M 0.000 description 1
- AFPFGFUGETYOSY-HGNGGELXSA-N His-Ala-Glu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O AFPFGFUGETYOSY-HGNGGELXSA-N 0.000 description 1
- 101000886866 Homo sapiens Gastric inhibitory polypeptide receptor Proteins 0.000 description 1
- 101001040075 Homo sapiens Glucagon receptor Proteins 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 1
- 208000013016 Hypoglycemia Diseases 0.000 description 1
- WZPIKDWQVRTATP-SYWGBEHUSA-N Ile-Ala-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](N)[C@@H](C)CC)C(O)=O)=CNC2=C1 WZPIKDWQVRTATP-SYWGBEHUSA-N 0.000 description 1
- HYLIOBDWPQNLKI-HVTMNAMFSA-N Ile-His-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N HYLIOBDWPQNLKI-HVTMNAMFSA-N 0.000 description 1
- JZNVOBUNTWNZPW-GHCJXIJMSA-N Ile-Ser-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)O)N JZNVOBUNTWNZPW-GHCJXIJMSA-N 0.000 description 1
- 206010022489 Insulin Resistance Diseases 0.000 description 1
- 125000000998 L-alanino group Chemical group [H]N([*])[C@](C([H])([H])[H])([H])C(=O)O[H] 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- 238000008214 LDL Cholesterol Methods 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- WQWSMEOYXJTFRU-GUBZILKMSA-N Leu-Glu-Ser Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O WQWSMEOYXJTFRU-GUBZILKMSA-N 0.000 description 1
- YQFZRHYZLARWDY-IHRRRGAJSA-N Leu-Val-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCCCN YQFZRHYZLARWDY-IHRRRGAJSA-N 0.000 description 1
- 102000004882 Lipase Human genes 0.000 description 1
- 108090001060 Lipase Proteins 0.000 description 1
- 239000004367 Lipase Substances 0.000 description 1
- YSDQQAXHVYUZIW-QCIJIYAXSA-N Liraglutide Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCNC(=O)CC[C@H](NC(=O)CCCCCCCCCCCCCCC)C(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 YSDQQAXHVYUZIW-QCIJIYAXSA-N 0.000 description 1
- 108010019598 Liraglutide Proteins 0.000 description 1
- 108010062166 Lys-Asn-Asp Proteins 0.000 description 1
- BYPMOIFBQPEWOH-CIUDSAMLSA-N Lys-Asn-Asp Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)N BYPMOIFBQPEWOH-CIUDSAMLSA-N 0.000 description 1
- NKKFVJRLCCUJNA-QWRGUYRKSA-N Lys-Gly-Lys Chemical compound NCCCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCCN NKKFVJRLCCUJNA-QWRGUYRKSA-N 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-L Malonate Chemical compound [O-]C(=O)CC([O-])=O OFOBLEOULBTSOW-UHFFFAOYSA-L 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 229910002651 NO3 Inorganic materials 0.000 description 1
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 208000005764 Peripheral Arterial Disease Diseases 0.000 description 1
- 208000030831 Peripheral arterial occlusive disease Diseases 0.000 description 1
- 208000001280 Prediabetic State Diseases 0.000 description 1
- FDMKYQQYJKYCLV-GUBZILKMSA-N Pro-Pro-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 FDMKYQQYJKYCLV-GUBZILKMSA-N 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 208000007536 Thrombosis Diseases 0.000 description 1
- DTQVDTLACAAQTR-UHFFFAOYSA-M Trifluoroacetate Chemical compound [O-]C(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-M 0.000 description 1
- OWSRIUBVJOQHNY-IHPCNDPISA-N Trp-Lys-His Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC3=CN=CN3)C(=O)O)N OWSRIUBVJOQHNY-IHPCNDPISA-N 0.000 description 1
- GLNADSQYFUSGOU-GPTZEZBUSA-J Trypan blue Chemical compound [Na+].[Na+].[Na+].[Na+].C1=C(S([O-])(=O)=O)C=C2C=C(S([O-])(=O)=O)C(/N=N/C3=CC=C(C=C3C)C=3C=C(C(=CC=3)\N=N\C=3C(=CC4=CC(=CC(N)=C4C=3O)S([O-])(=O)=O)S([O-])(=O)=O)C)=C(O)C2=C1N GLNADSQYFUSGOU-GPTZEZBUSA-J 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- IELISNUVHBKYBX-XDTLVQLUSA-N Tyr-Ala-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 IELISNUVHBKYBX-XDTLVQLUSA-N 0.000 description 1
- KSCVLGXNQXKUAR-JYJNAYRXSA-N Tyr-Leu-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O KSCVLGXNQXKUAR-JYJNAYRXSA-N 0.000 description 1
- NHOVZGFNTGMYMI-KKUMJFAQSA-N Tyr-Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 NHOVZGFNTGMYMI-KKUMJFAQSA-N 0.000 description 1
- NMPXRFYMZDIBRF-ZOBUZTSGSA-N Val-Asn-Trp Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)N NMPXRFYMZDIBRF-ZOBUZTSGSA-N 0.000 description 1
- PZTZYZUTCPZWJH-FXQIFTODSA-N Val-Ser-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O)N PZTZYZUTCPZWJH-FXQIFTODSA-N 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 230000003044 adaptive effect Effects 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 230000036528 appetite Effects 0.000 description 1
- 235000019789 appetite Nutrition 0.000 description 1
- 208000011775 arteriosclerosis disease Diseases 0.000 description 1
- 108010038633 aspartylglutamate Proteins 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 1
- 229940077388 benzenesulfonate Drugs 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 230000036772 blood pressure Effects 0.000 description 1
- 238000007664 blowing Methods 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- SXDBWCPKPHAZSM-UHFFFAOYSA-M bromate Inorganic materials [O-]Br(=O)=O SXDBWCPKPHAZSM-UHFFFAOYSA-M 0.000 description 1
- SXDBWCPKPHAZSM-UHFFFAOYSA-N bromic acid Chemical compound OBr(=O)=O SXDBWCPKPHAZSM-UHFFFAOYSA-N 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 208000029078 coronary artery disease Diseases 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- 230000003226 decolorizating effect Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 238000010511 deprotection reaction Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 238000005265 energy consumption Methods 0.000 description 1
- 210000003158 enteroendocrine cell Anatomy 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 230000030136 gastric emptying Effects 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 239000003877 glucagon like peptide 1 receptor agonist Substances 0.000 description 1
- 230000004110 gluconeogenesis Effects 0.000 description 1
- 238000007446 glucose tolerance test Methods 0.000 description 1
- 230000004116 glycogenolysis Effects 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 108010089804 glycyl-threonine Proteins 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000005802 health problem Effects 0.000 description 1
- 235000009200 high fat diet Nutrition 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 1
- 201000001421 hyperglycemia Diseases 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- WVZWEMOFSIEEMU-UHFFFAOYSA-N indene-1,2,3-trione Chemical compound C1=CC=C2C(=O)C(=O)C(=O)C2=C1 WVZWEMOFSIEEMU-UHFFFAOYSA-N 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 210000004153 islets of langerhan Anatomy 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 235000019421 lipase Nutrition 0.000 description 1
- 230000004130 lipolysis Effects 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 229960002701 liraglutide Drugs 0.000 description 1
- 230000003908 liver function Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 238000013116 obese mouse model Methods 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 238000003359 percent control normalization Methods 0.000 description 1
- VLTRZXGMWDSKGL-UHFFFAOYSA-M perchlorate Inorganic materials [O-]Cl(=O)(=O)=O VLTRZXGMWDSKGL-UHFFFAOYSA-M 0.000 description 1
- VLTRZXGMWDSKGL-UHFFFAOYSA-N perchloric acid Chemical compound OCl(=O)(=O)=O VLTRZXGMWDSKGL-UHFFFAOYSA-N 0.000 description 1
- 230000008855 peristalsis Effects 0.000 description 1
- 239000008194 pharmaceutical composition Substances 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000007406 plaque accumulation Effects 0.000 description 1
- 230000000291 postprandial effect Effects 0.000 description 1
- 201000009104 prediabetes syndrome Diseases 0.000 description 1
- 150000003140 primary amides Chemical class 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 1
- YGSDEFSMJLZEOE-UHFFFAOYSA-M salicylate Chemical compound OC1=CC=CC=C1C([O-])=O YGSDEFSMJLZEOE-UHFFFAOYSA-M 0.000 description 1
- 229960001860 salicylate Drugs 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000007789 sealing Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 239000012453 solvate Substances 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- 238000004260 weight control Methods 0.000 description 1
- 235000019786 weight gain Nutrition 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 239000013585 weight reducing agent Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/04—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length on carriers
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/06—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length using protecting groups or activating agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/14—Extraction; Separation; Purification
- C07K1/16—Extraction; Separation; Purification by chromatography
- C07K1/20—Partition-, reverse-phase or hydrophobic interaction chromatography
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Abstract
The invention relates to a triple agonist of GLP-1, GCG and GIP receptors, the compound provided by the invention has strong agonistic activity on glucagon-like peptide-1 (GLP-1) receptor, glucagon (GCG) receptor and glucose-dependent incretin (GIP) receptor; it can be used for the treatment and/or prevention of metabolic disorders including diabetes, obesity, fatty liver disease, non-alcoholic steatohepatitis, dyslipidemia and metabolic syndrome and related disorders.
Description
Technical Field
The invention relates to the field of biological medicines, in particular to a triple agonist of GLP-1, GCG and GIP receptors.
Background
At present, the number of diabetes mellitus patients in the world is 5.37 hundred million, the number of diabetes mellitus patients in China is nearly 1.4 hundred million, and the diabetes mellitus patients live at the first place of the world, so that the diabetes mellitus patients are one of the main disease burdens in China. While obese type II diabetics are the largest population of diabetics. Obesity disturbs the levels of insulin, sugar and blood lipids in blood, and is also easy to cause various metabolic diseases such as hypertension, non-alcoholic fatty liver disease and atherosclerosis besides type II diabetes, and a series of health problems are risk factors of cardiovascular diseases. At present, the medicines for treating type II diabetes in the market mainly focus on blood sugar reduction treatment, and the effect of reducing weight is very limited. The blood sugar reducing medicine can really bring more benefits and longer benefits only by paying attention to the blood sugar reducing effectiveness and considering the weight control.
Glucagon-like peptide-1 (GLP-1) is a polypeptide hormone secreted by intestinal L-cells after eating, and can stimulate pancreatic beta cells to secrete insulin, thereby stabilizing the fluctuation of postprandial blood sugar. The function of reducing blood sugar has glucose concentration dependency, and the risk of blood sugar is greatly reduced while blood sugar is regulated. GLP-1 based drugs, such as liraglutide, dolabrlutide and somagluteptide, have gradually taken a very important position in diabetes drugs in recent years. The GLP-1 medicines have the effect of losing weight when reducing blood sugar, and the mechanism is that GLP-1 acts on gastrointestinal tracts to delay gastric emptying and intestinal peristalsis, acts on a central nervous system to suppress appetite and the like, thereby reducing food intake and achieving the purpose of losing weight. However, when the GLP-1 receptor agonist drugs are used for losing weight, the dosage is generally large, gastrointestinal side effects are easy to generate, the tolerance is poor, the treatment window is narrow, and the weight reduction effect still does not completely meet the clinical requirement.
Glucagon (GCG) is a polypeptide hormone secreted by pancreatic islet alpha cells that promotes glycogenolysis and gluconeogenesis, resulting in a significant increase in blood glucose; simultaneously, the lipase can be activated, lipolysis is promoted, fatty acid oxidation is improved, energy consumption is increased, and therefore the effects of reducing fat and reducing weight are achieved. Because of its physiological action of increasing blood sugar, it can be used for treating hypoglycemia, but its application in obesity indication is limited by single-target treatment, and it is not suitable for obesity and type II diabetes obesity patient.
Glucose-dependent incretins (GIP) is a polypeptide hormone secreted by intestinal K cells. GIP and GLP-1 are intestinal hypoglycemic, can promote the secretion of insulin in a blood sugar concentration-dependent mode, and reduce blood sugar, and the blood sugar reducing effect mediated by GIP is even stronger than that of GLP-1. However, diabetic patients show GIP insensitivity, probably due to receptor tolerance by hyperglycemia, and thus the GIP receptor agonist alone does not achieve the goal of improving blood glucose in diabetic patients.
At present, most diabetes drugs on the market exist, but the low standard-reaching rate of diabetes treatment is still a difficult problem, and a great distance is left to cure diabetes, so that the development of new diabetes drugs is still far from the original way. By targeting multiple action targets, the disease symptoms are controlled in multiple directions, so that good clinical benefits are expected. Therefore, those skilled in the art would like to develop new single molecule GLP-1/GCG/GIP triple receptor agonists to overcome the deficiencies of the existing single target drugs.
Disclosure of Invention
The present invention aims to provide a triple agonist of GLP-1, GCG and GIP receptors, which has strong agonistic activity to glucagon-like peptide-1 (GLP-1) receptor, glucagon (GCG) receptor and glucose-dependent incretin (GIP) receptor.
To this end, in a first aspect, the present invention is a compound which is a peptide having the general formula I:
xaa1-Xaa2-Xaa3-Gly-Thr-Xaa6-Thr-Ser-Asp-Tyr-Ser-Ile-Xaa13-Leu-Asp-Xaa16-Xaa17-Ala-Xaa19-Xaa20-Xaa21-Phe-Xaa23-Glu-Xaa25-Leu-Xaa27-Xaa28-Xaa29-R1 (general formula I, SEQ ID NO: 1);
wherein Xaa1 is tyrosine (Tyr, Y) or histidine (His, H);
xaa2 is serine (Ser, S), or 2-aminoisobutyric acid (Aib);
xaa3 is glutamine (Gln, Q), or histidine (His, H);
xaa6 is phenylalanine (Phe, F), or α -methyl-2-fluorophenylalanine (. Alpha. -Me- (2-F) -Phe);
xaa13 is leucine (Leu, L), tyrosine (Tyr, Y), or alanine (Ala, A);
xaa16 is lysine (Lys, K), glutamic acid (Glu, E), or arginine (Arg, R);
xaa17 is lysine (Lys, K), or isoleucine (Ile, I);
xaa19 is glutamine (Gln, Q), or alanine (Ala, A);
xaa20 is arginine (Arg, R), glutamine (Gln, Q), lysine (Lys, K), or histidine (His, H);
xaa21 is aspartic acid (Asp, D), alanine (Ala, A), or glutamic acid (Glu, E);
xaa23 is isoleucine (Ile, I), or valine (Val, V);
xaa25 is tryptophan (Trp, W), or tyrosine (Tyr, Y);
xaa27 is leucine (Leu, L), or glutamic acid (Glu, E);
xaa28 is alanine (Ala, A), serine (Ser, S), or glutamic acid (Glu, E);
xaa29 is glycine (Gly, G), glutamine (Gln, Q), or alanine (Ala, A);
r1 is Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser (GPSSGAPPPS, SEQ ID NO: 2), pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser (PSSGAPPPS, SEQ ID NO: 3), pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser (PSSGAPPS, SEQ ID NO: 4) or deleted;
at least one of Xaa17 and Xaa20 is a lysine that is unmodified or modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18.
In some embodiments, in formula I,
xaa17 is lysine, xaa20 is lysine; or the like, or, alternatively,
xaa17 is lysine modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18; xaa20 is arginine, glutamine or histidine; or the like, or, alternatively,
xaa17 is isoleucine, xaa20 is lysine modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18; or the like, or, alternatively,
xaa17 is lysine modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18; xaa20 is lysine.
In some embodiments, in formula I,
xaa1 is tyrosine (Tyr, Y) or histidine (His, H);
xaa2 is serine (Ser, S), or 2-aminoisobutyric acid (Aib);
xaa3 is glutamine (Gln, Q), or histidine (His, H);
xaa6 is phenylalanine (Phe, F), or α -methyl-2-fluorophenylalanine (α -Me- (2-F) -Phe);
xaa13 is leucine (Leu, L), or alanine (Ala, A);
xaa16 is lysine (Lys, K), glutamic acid (Glu, E), or arginine (Arg, R);
xaa17 is lysine (Lys, K), or isoleucine (Ile, I);
xaa19 is glutamine (Gln, Q), or alanine (Ala, A);
xaa20 is arginine (Arg, R), glutamine (Gln, Q), lysine (Lys, K), or histidine (His, H);
xaa21 is aspartic acid (Asp, D), alanine (Ala, A), or glutamic acid (Glu, E);
xaa23 is isoleucine (Ile, I), or valine (Val, V);
xaa25 is tryptophan (Trp, W), or tyrosine (Tyr, Y);
xaa27 is leucine (Leu, L);
xaa28 is alanine (Ala, A), serine (Ser, S), or glutamic acid (Glu, E);
xaa29 is glycine (Gly, G), or alanine (Ala, A);
r1 is Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser (GPSSGAPPPS, SEQ ID NO: 2), pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser (PSSGAPPPS, SEQ ID NO: 3), pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser (PSSGAPPS, SEQ ID NO: 4) or deleted;
at least one of Xaa17 and Xaa20 is a lysine that is unmodified or modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18.
In some embodiments, in formula I,
xaa1 is tyrosine (Tyr, Y) or histidine (His, H);
xaa2 is serine (Ser, S), or 2-aminoisobutyric acid (Aib);
xaa3 is glutamine (Gln, Q), or histidine (His, H);
xaa6 is phenylalanine (Phe, F), or α -methyl-2-fluorophenylalanine (α -Me- (2-F) -Phe);
xaa13 is leucine (Leu, L);
xaa16 is lysine (Lys, K);
xaa17 is lysine (Lys, K), or isoleucine (Ile, I);
xaa19 is glutamine (Gln, Q), or alanine (Ala, A);
xaa20 is arginine (Arg, R), glutamine (Gln, Q), lysine (Lys, K), or histidine (His, H);
xaa21 is aspartic acid (Asp, D);
xaa23 is isoleucine (Ile, I);
xaa25 is tryptophan (Trp, W);
xaa27 is leucine (Leu, L);
xaa28 is alanine (Ala, A), or glutamic acid (Glu, E);
xaa29 is glycine (Gly, G);
r1 is Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser (GPSSGAPPPS, SEQ ID NO: 2), pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser (PSSGAPPPS, SEQ ID NO: 3), pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser (PSSGAPPS, SEQ ID NO: 4) or deleted;
at least one of Xaa17 and Xaa20 is a lysine that is unmodified or modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18.
In some embodiments, in formula I,
xaa1 is tyrosine (Tyr, Y) or histidine (His, H);
xaa2 is 2-aminoisobutyric acid (Aib);
xaa3 is glutamine (Gln, Q), or histidine (His, H);
xaa6 is α -methyl-2-fluorophenylalanine (α -Me- (2-F) -Phe);
xaa13 is leucine (Leu, L);
xaa16 is lysine (Lys, K);
xaa17 is lysine modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the K side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18;
xaa19 is glutamine (Gln, Q);
xaa20 is arginine (Arg, R), glutamine (Gln, Q), or histidine (His, H);
xaa21 is aspartic acid (Asp, D);
xaa23 is isoleucine (Ile, I);
xaa25 is tryptophan (Trp, W);
xaa27 is leucine (Leu, L);
xaa28 is alanine (Ala, A), or glutamic acid (Glu, E);
xaa29 is glycine (Gly, G);
r1 is Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser (GPSSGAPPPS, SEQ ID NO: 2), pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser (PSSGAPPPS, SEQ ID NO: 3), or Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser (PSSGAPPS, SEQ ID NO: 4).
In some embodiments, the peptide having the general formula I further has one or more modifications selected from: n-terminal acetylation, C-terminal amidation, glycosylation, phosphorylation.
In some embodiments, the C-terminal amino acid is amidated as a primary amide.
In some embodiments, positions 1 to 29 of formula I are the following sequence:
YSQGTFTSDYSILLDKKAQRDFIEWLAG (SEQ ID NO:32, i.e., positions 1 to 29 of SEQ ID NO: 5);
y (dS) QGTFTSDYSILLDKKAQRDFIEWLAG (SEQ ID NO:33, i.e., positions 1 to 29 of SEQ ID NO: 6);
Y-Aib-QGTFTSDYSILLDKKAQRDFIEWLAG (SEQ ID NO:34, i.e., positions 1 to 29 of SEQ ID NO: 7);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSILLDKKAQRDFIEWLAG (SEQ ID NO:35, i.e., positions 1 to 29 of SEQ ID NO: 8);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSLDLKKAQQDFIEWLLAG (SEQ ID NO:36, i.e., positions 1 to 29 of SEQ ID NO: 9);
Y-Aib-QGTFTSDYSIYLDDKKAQRAFVEWLAQ (SEQ ID NO:37, i.e., positions 1 to 29 of SEQ ID NO: 10);
Y-Aib-QGTFTSDYSIYLDEKAAKEFIEWLESA(SEQ ID NO:11);
Y-Aib-QGTFTSDYSIALDKKAQREFVEWLSA (SEQ ID NO:38, i.e., positions 1 to 29 of SEQ ID NO: 12);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSILLDRKAQRDIEWLLAG (SEQ ID NO:39, i.e., positions 1 to 29 of SEQ ID NO: 13);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSILLDRKAKRQRDFIEWLEG (SEQ ID NO:40, i.e., positions 1-29 of SEQ ID NO: 14);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSILLDKKAQRDFIEWLEG (SEQ ID NO:41, i.e., positions 1 to 29 of SEQ ID NO: 15);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSLDLKKAAHEFIEWLAG (SEQ ID NO:42, i.e., positions 1 to 29 of SEQ ID NO: 16);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSILLDEKAAQEFIEWLLAG (SEQ ID NO:43, i.e., positions 1 to 29 of SEQ ID NO: 17);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSIYLDDKKAQQDFIEWLLEG (SEQ ID NO:44, i.e., positions 1 to 29 of SEQ ID NO: 18);
Y-Aib-HGT- (. Alpha. -Me- (2-F) -Phe) -TSDYSILLDKKAQRDFIEWLAG (SEQ ID NO:45, i.e., positions 1 to 29 of SEQ ID NO: 19);
H-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSILLDKIAAKDFIEWLEG (SEQ ID NO:46, i.e., positions 1 to 29 of SEQ ID NO: 20);
H-Aib-QGTFTSDYSILLDKIAAKDFIEWLEG (SEQ ID NO:47, i.e., positions 1 to 29 of SEQ ID NO: 21);
H-Aib-HGT- (. Alpha. -Me- (2-F) -Phe) -TSDYSLDLKKAQQDFIEWLLEG (SEQ ID NO:48, i.e., positions 1 to 29 of SEQ ID NO: 22);
H-Aib-HGT- (. Alpha. -Me- (2-F) -Phe) -TSDYSILLDKKAQHDFIEWLEG (SEQ ID NO:49, i.e., positions 1 to 29 of SEQ ID NO: 23);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSILLDEIAAKDFIEWLEG (SEQ ID NO:50, i.e., positions 1 to 29 of SEQ ID NO: 24);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSILLDEIAQKAFIEYLEG (SEQ ID NO:51, i.e., positions 1 to 29 of SEQ ID NO: 25);
H-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSILLDEIAAKAFIEYLEG (SEQ ID NO:52, i.e., positions 1-29 of SEQ ID NO: 26);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSILLDRKAQDFIEWLLEG (SEQ ID NO:53, i.e., positions 1 to 29 of SEQ ID NO: 27);
H-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSILLDIAAKDFIEWLLEG (SEQ ID NO:54, i.e., positions 1 to 29 of SEQ ID NO: 28);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSILLDKKAQRAFIEYLLAG (SEQ ID NO:55, i.e., positions 1 to 29 of SEQ ID NO: 29);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSLDLKKAQRAFIEWLAG (SEQ ID NO:56, i.e., positions 1 to 29 of SEQ ID NO: 30); or
Y-Aib-HGT- (. Alpha. -Me- (2-F) -Phe) -TSDYSILLDKKAQRAFIEWLAG (SEQ ID NO:57, i.e., positions 1 to 29 of SEQ ID NO: 31);
wherein the lysine at position 17 and/or 20 is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18;
and R1 is Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser (GPSSGAPPPS, SEQ ID NO: 2), pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser (PSSGAPPPS, SEQ ID NO: 3), pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser (PSSGAPPPS, SEQ ID NO: 4) or deleted.
In some embodiments, formula I is the following sequence:
YSQGTFTSDYSILLDKKAQRDFIEWLLAGGPSSGAPPPS(SEQ ID NO: 5);
Y(dS)QGTFTSDYSILLDKKAQRDFIEWLLAGGPSSGAPPPS(SEQ ID NO: 6);
Y-Aib-QGTFTSDYSILLDKKAQRDFIEWLLAGGPSSGAPPPS(SEQ ID NO:7);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLAGGPSSGAP PPS(SEQ ID NO:8);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQQDFIEWLLAGGPSSGAP PPS(SEQ ID NO:9);
Y-Aib-QGTFTSDYSIYLDKKAQRAFVEWLLAQGPSSGAPPPS(SEQ ID NO:10);
Y-Aib-QGTFTSDYSIYLDEKAAKEFIEWLESA(SEQ ID NO:11);
Y-Aib-QGTFTSDYSIALDKKAQREFVEWLLSAGPSSGAPPPS(SEQ ID NO:12);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRKAQRDFIEWLLAGGPSSGAP PPS(SEQ ID NO:13);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRKAQRDFIEWLLEGGPSSGAPP PS(SEQ ID NO:14);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLEGGPSSGAP PPS(SEQ ID NO:15);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAAHEFIEWLLAGGPSSGAP PPS(SEQ ID NO:16);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEKAAQEFIEWLLAGGPSSGAPP PS(SEQ ID NO:17);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSIYLDKKAQQDFIEWLLEGGPSSGAP PPS(SEQ ID NO:18);
Y-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLAGGPSSGAP PPS(SEQ ID NO:19);
H-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKIAAKDFIEWLLEGGPSSGAPP PS(SEQ ID NO:20);
H-Aib-QGTFTSDYSILLDKIAAKDFIEWLLEGGPSSGAPPPS(SEQ ID NO: 21);
H-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQQDFIEWLLEGGPSSGAP PPS(SEQ ID NO:22);
H-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQHDFIEWLLEGGPSSGAP PPS(SEQ ID NO:23);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEIAAKDFIEWLLEGGPSSGAPP PS(SEQ ID NO:24);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEIAQKAFIEYLLEGGPSSGAPPP S(SEQ ID NO:25);
H-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEIAAKAFIEYLLEGGPSSGAPP PS(SEQ ID NO:26);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRKAQQDFIEWLLEGGPSSGAP PPS(SEQ ID NO:27);
H-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRIAAKDFIEWLLEGGPSSGAPP PS(SEQ ID NO:28);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRAFIEYLLAGGPSSGAPP PS(SEQ ID NO:29);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSLDLKKAQRAFIEWLAGLSSGAP PPS (SEQ ID NO: 30); or
Y-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRAFIEWLLAGGPSSGAP PPS(SEQ ID NO:31);
Wherein the lysine at position 17 and/or 20 is unmodifiedOr the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18.
In one embodiment, the present invention provides a compound of the formula:
YSQGTFTSDYSILLDKKAQRDFIEWLLAGGPSSGAPPPS(SEQ ID NO: 5)。
in one embodiment, the present invention provides a compound of the formula:
YSQGTFTSDYSILLDKKAQRDFIEWLLAGGPSSGAPPPS(SEQ ID NO: 5),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the invention provides a compound of the formula:
Y(dS)QGTFTSDYSILLDKKAQRDFIEWLLAGGPSSGAPPPS(SEQ ID NO: 6),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGTFTSDYSILLDKKAQRDFIEWLLAGGPSSGAPPPS(SEQ ID NO:7),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLAGGPSSGAP PPS(SEQ ID NO:8),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLAGGPSSGAP PPS(SEQ ID NO:8),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQQDFIEWLLAGGPSSGAP PPS(SEQ ID NO:9),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQQDFIEWLLAGGPSSGAP PPS(SEQ ID NO:9),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGTFTSDYSIYLDKKAQRAFVEWLLAQGPSSGAPPPS(SEQ ID NO:10),
wherein K at position 17 is chemically modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 16 -CO 2 Conjugation of H to the K side chainEpsilon-amino group of (a).
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGTFTSDYSIYLDEKAAKEFIEWLESA(SEQ ID NO:11),
wherein K at position 17 is chemically modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the invention provides a compound of the formula:
Y-Aib-QGTFTSDYSIALDKKAQREFVEWLLSAGPSSGAPPPS(SEQ ID NO:12),
wherein K at position 17 is chemically modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRKAQRDFIEWLLAGGPSSGAP PPS(SEQ ID NO:13),
wherein K at position 17 is chemically modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRKAQRDFIEWLLEGGPSSGAPP PS(SEQ ID NO:14),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLEGGPSSGAP PPS(SEQ ID NO:15),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLEGGPSSGAP PPS(SEQ ID NO:15),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLEGGPSSGAP PPS(SEQ ID NO:15),
wherein K at position 17 is chemically modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 18 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAAHEFIEWLLAGGPSSGAP PPS(SEQ ID NO:16),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEKAAQEFIEWLLAGGPSSGAPP PS(SEQ ID NO:17),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSIYLDKKAQQDFIEWLLEGGPSSGAP PPS(SEQ ID NO:18),
wherein K at position 17 is chemically modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the invention provides a compound of the formula:
Y-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLAGGPSSGAP PPS(SEQ ID NO:19),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLAGGPSSGAP PPS(SEQ ID NO:19),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the invention provides a compound of the formula:
Y-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLAGGPSSGAP PPS(SEQ ID NO:19),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 18 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
H-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKIAAKDFIEWLLEGGPSSGAPP PS(SEQ ID NO:20),
wherein K at position 20 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the invention provides a compound of the formula:
H-Aib-QGTFTSDYSILLDKIAAKDFIEWLLEGGPSSGAPPPS(SEQ ID NO: 21),
wherein K at position 20 is chemically modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the invention provides a compound of the formula:
H-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQQDFIEWLLEGGPSSGAP PPS(SEQ ID NO:22),
wherein K at position 17 is chemically modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
H-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQQDFIEWLLEGGPSSGAP PPS(SEQ ID NO:22),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 18 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
H-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQHDFIEWLLEGGPSSGAP PPS(SEQ ID NO:23),
wherein K at position 17 is chemically modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (γGlu)-CO-(CH 2 ) 16 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the invention provides a compound of the formula:
H-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQHDFIEWLLEGGPSSGAP PPS(SEQ ID NO:23),
wherein K at position 17 is chemically modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 18 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEIAAKDFIEWLLEGGPSSGAPP PS(SEQ ID NO:24),
wherein K at position 20 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 18 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEIAQKAFIEYLLEGGPSSGAPPP S(SEQ ID NO:25),
wherein K at position 20 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 18 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the invention provides a compound of the formula:
H-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEIAAKAFIEYLLEGGPSSGAPP PS(SEQ ID NO:26),
wherein K at position 20 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 18 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRKAQQDFIEWLLEGGPSSGAP PPS(SEQ ID NO:27),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 18 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the invention provides a compound of the formula:
H-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRIAAKDFIEWLLEGGPSSGAPP PS(SEQ ID NO:28),
wherein K at position 20 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) 2 -(γGlu)-CO-(CH 2 ) 18 -CO 2 H is conjugated to the epsilon-amino group of the K side chain.
In one embodiment, the present invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRAFIEYLLAGGPSSGAPP PS(SEQ ID NO:29),
wherein K at position 17 is chemically modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 18 -CO 2 H is conjugated to the epsilon-amino group of the K side chain;
alternatively, SEQ ID NO: the C-terminal amino acid of 29 is amidated.
In one embodiment, the invention provides a compound of the formula:
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRAFIEWLLAGGPSSGAP PPS(SEQ ID NO:30),
wherein K at position 17 has the following chemical modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 18 -CO 2 H is conjugated to the epsilon-amino group of the K side chain;
alternatively, SEQ ID NO: the C-terminal amino acid of 30 was amidated.
In one embodiment, the invention provides a compound of the formula:
Y-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRAFIEWLLAGGPSSGAP PPS(SEQ ID NO:31),
wherein K at position 17 is chemically modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl) - (gamma Glu) -CO- (CH 2 ) 18 -CO 2 H is conjugated to the epsilon-amino group of the K side chain;
alternatively, SEQ ID NO: the C-terminal amino acid of 31 is amidated.
The compounds of the present invention may be pharmaceutically acceptable acid addition salts formed by reacting the peptides with any of a variety of inorganic and organic acids. Pharmaceutically acceptable salts and common methods for preparing them are well known in the art. See, e.g., P.Stahl et al, handbook of Pharmaceutical Salts: properties, selection and Use, second revision (Wiley VCH, 2011); berge, et al, "Pharmaceutical Salts," Journal of Pharmaceutical Sciences, vol.66, no.1, month 1 1977. The pharmaceutically acceptable salts include hydrochloride, bromate, sulfate, nitrate, perchlorate, fumarate, maleate, phosphate, glycolate, lactate, salicylate, succinate, toluene-p-sulfonate, tartrate, acetate, citrate, methanesulfonate, formate, benzoate, malonate, benzenesulfonate, trifluoroacetate and the like.
In another aspect, the invention provides methods for the preparation of the compounds.
The compounds of the present invention can be synthesized by methods known in the art, for example, stepwise in a solid phase or liquid phase method by an automatic peptide synthesizer or by fragment assembly, according to their sequences and fatty acid side chain structures, followed by isolation and purification to obtain the target compounds.
In another aspect, the invention provides agonists of the compounds for GLP-1, GCG, GIP receptors.
The compound has triple activities of GLP-1, GCG and GIP receptors.
In another aspect, the invention also provides compositions comprising the compounds of the invention.
In some embodiments, the composition is a pharmaceutical composition.
In some embodiments, the composition further comprises a pharmaceutically acceptable carrier, diluent or excipient. The pharmaceutically acceptable carrier, diluent or excipient is not an essential active ingredient per se and is not unduly toxic after administration; suitable carriers, diluents or excipients are well known to those of ordinary skill in the art. Pharmaceutically acceptable carriers may include binders, lubricants, disintegrants, solubilizers, dispersants, stabilizers, suspending agents, colorants, flavoring agents, buffers, solubilizers, isotonic agents, and the like.
In another aspect, the invention also provides therapeutic kits comprising a compound described herein and devices comprising a compound described herein.
In another aspect, the invention also provides the use of a compound and/or composition according to the invention in the manufacture of a medicament for the treatment and/or prevention of a metabolic disorder.
In another aspect, the present invention also provides a method for preventing and/or treating a metabolic disorder in a subject, comprising administering to the subject a compound and/or composition according to the present invention.
In some embodiments, the metabolic disorder comprises diabetes, diabetes-related disorders, obesity, fatty liver disease, non-alcoholic steatohepatitis, dyslipidemia, and metabolic syndrome-related disorders.
In some embodiments, diabetes comprises type I diabetes, type II diabetes.
In some embodiments, the diabetes-related disorders include insulin resistance, glucose intolerance, elevated fasting glucose, pre-diabetes, gestational diabetic hypertension, dyslipidemia, bone-related disorders, and the like.
In some embodiments, diabetes-related conditions further include arteriosclerosis, coronary heart disease, peripheral arterial disease, stroke, dyslipidemia, elevated blood pressure, thrombosis, and the like.
In some embodiments, the lipid disorder comprises high triglycerides, low HDL cholesterol, high LDL cholesterol, and plaque accumulation in the arterial wall.
Compared with the prior art, the invention has the beneficial effects that:
the compounds provided by the present invention, or pharmaceutically acceptable salts or solvates thereof, glucagon-like peptide-1 (GLP-1) receptor, glucagon (GCG) receptor and glucose-dependent incretin (GIP) receptor all have strong agonist activity and are therefore useful in the treatment of related metabolic syndrome.
Drawings
Various other advantages and benefits will become apparent to those of ordinary skill in the art upon reading the following detailed description of the preferred embodiments. The drawings are only for purposes of illustrating the preferred embodiments and are not to be construed as limiting the invention. In the drawings:
FIG. 1: blood glucose concentration-time curve of C57BL/6 mice 24h after single administration of Semaglutide, HEC-PT26, HEC-PT49 and HEC-PT 50;
FIG. 2 is a schematic diagram: blood glucose concentration-time profile of C57BL/6 mice after 72h administration of Semaglutide, HEC-PT26, HEC-PT49, HEC-PT 50;
FIG. 3: blood glucose concentration-time curves of C57BL/6 mice 24h after single administration of HEC-PT47, HEC-PT 48;
FIG. 4 is a schematic view of: effects of chronic administration of HEC-PT26 on blood glucose in db/db mice;
FIG. 5: effects of HEC-PT26, HEC-PT49, HEC-PT50 on blood glucose in db/db mice following a single administration;
FIG. 6: effects of HEC-PT26, HEC-PT49, HEC-PT50 on body weight in db/db mice following a single administration;
FIG. 7 is a schematic view of: effect on food intake in db/db mice following a single administration of HEC-PT26, HEC-PT49, HEC-PT 50;
FIG. 8: the effect of long-term administration of HEC-PT47, HEC-PT50, HEC-PT61 on the rate of body weight gain in DIO mice;
FIG. 9: the influence of long-term administration of HEC-PT47, HEC-PT50 and HEC-PT61 on the cumulative food intake of DIO mice;
FIG. 10: the influence of long-term administration of HEC-PT47, HEC-PT50 and HEC-PT61 on the liver weight of DIO mice;
FIG. 11: effect of long-term administration of HEC-PT47, HEC-PT50, HEC-PT61 on liver index in DIO mice.
Detailed Description
Exemplary embodiments of the present disclosure will be described in more detail below with reference to the accompanying drawings. While exemplary embodiments of the present disclosure are shown in the drawings, it should be understood that the present disclosure may be embodied in various forms and should not be limited to the embodiments set forth herein. Rather, these embodiments are provided so that this disclosure will be thorough and complete, and will fully convey the scope of the disclosure to those skilled in the art.
In the present invention, the conventional one-letter and three-letter codes for natural amino acids are used, as well as the commonly accepted three-letter codes for other (non-natural) amino acids, e.g., aib (2-aminoisobutyric acid). Unless explicitly indicated otherwise, all amino acid residues of the present invention are preferably in the L-configuration, e.g., dS denotes Ser in D-form.
Example 1
This example provides a method for synthesizing a compound of the invention.
1. Solid phase peptide synthesis was performed on a peptide synthesizer: the resin was placed in a 150ml reactor and soaked for 2 hours with 50ml Dichloromethane (DCM). The resin was washed with N, N-Dimethylformamide (DMF) and then drained, and this was repeated four times and the resin was drained. The first amino acid (protected) + DCM + N, N-Diisopropylethylamine (DIEA) at the Fmoc-C terminal was weighed into a reactor, and the reactor was placed in a shaker at 30 ℃ for 2 hours. Blocking with methanol solution (methanol: DIEA: DCM = 1) for half an hour, then washing four times with DMF and draining. The Fmoc protecting group was removed by adding a 20% piperidine solution to the reactor. After deprotection, four washes with DMF were performed, followed by suction drying.
2. The Fmoc-C terminal second amino acid (with protection) + 1-Hydroxybenzotriazole (HOBT) + N, N' -Diisopropylcarbodiimide (DIC) was weighed into a reactor, and then the reactor was placed in a shaker at 30 ℃ for 1 hour. Detecting a small amount of resin by an indantrione method, if the resin has a color, indicating that the condensation is incomplete, and continuing to react; after the reaction was complete, the resin was washed four times with DMF and then drained. The Fmoc protecting group on the resin was removed by adding a quantity of 20% piperidine (piperidine/DMF = 1) to the reactor and shaking on a decolourising shaker for 20 min. After the protection is removed, washing the mixture with DMF for four times, and then draining the mixture to detect whether the protection is removed.
3. The amino acids are linked in sequence according to step 2. Here, lys to which a fatty acid side chain should be bonded is prepared by using a specifically protected raw material, protecting the N-terminal amino group with Boc anhydride, removing the specific protecting group of the Lys side chain, and bonding the side chain structure in reference to step 2. The polypeptide protecting groups are cleaved off completely with a cleavage reagent and cleaved from the resin for purification.
4. After the target peptide is synthesized, separating the target peptide segment from impurities through reversed phase liquid chromatography purification, freeze-drying the collected target peptide into powder, and sending the powder to QC quality inspection for purity and mass spectrum identification. The purity is more than 95% by HPLC detection. The molecular weight of the polypeptide identified by mass spectrum is consistent with the theoretical molecular weight. Table 1 shows the synthesized compounds.
TABLE 1
Wherein B is 2-aminoisobutyric acid (Aib), dS represents Ser form D; x is (L) -alpha-Me- (2-F) -Phe.
The structural general formula of the fatty acid chain is as follows:
([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H, conjugated to the corresponding K side chain in the polypeptide backboneEpsilon-amino; wherein a is 1 or 2, b is 1 or 2, c is 16 or 18; part of the side chain structure is shown below, where- - -shows the point of attachment of the fatty acid chain to the lysine side chain:
when a is 1, b is 1, c is 16, the fatty acid chain structure is-OEG-gamma Glu-CO- (CH) 2 ) 16 -CO 2 H, the specific structure is as follows:
when a is 1, b is 1, c is 18, the fatty acid chain structure is-OEG-gamma Glu-CO- (CH) 2 ) 18 -CO 2 H, the specific structure is as follows:
when a is 2, b is 1, c is 16, the fatty acid chain structure is-OEG-OEG-gamma Glu-CO- (CH) 2 ) 16 -CO 2 H, the specific structure is as follows:
when a is 2, b is 1, c is 18, the fatty acid chain structure is-OEG-OEG-gamma Glu-CO- (CH) 2 ) 18 -CO 2 H, the specific structure is as follows:
example 2
This example provides a method for measuring the in vitro cell activity of a compound
The method comprises the following specific steps:
1. preparing an Assay buffer: taking complete culture solution (DMEM medium +10% FBS), adding 4/1000 of 500mM IBMX mother solution, and preparing cAMP-d2 working solution and anti-cAMP-cryptate working solution according to the kit specification;
2. diluting a sample to be detected and human reference polypeptides GLP-1 (SEQ ID NO: 58), GCG (SEQ ID NO: 59) and GIP (SEQ ID NO: 60) to a mother solution with the initial concentration of 500nM, and then gradually diluting the mother solution according to the gradient of adding 20 mu L of the diluted mother solution to 80 mu L of Assay buffer (diluted by 5 times), wherein the gradient comprises 8 compounds in total;
3. preparing a cell suspension: taking out the frozen cells HEK293-GLP-1R, HEK293-GCGR and HEK293-GIPR from a liquid nitrogen tank, immediately carrying out water bath at 37 ℃, completely melting the cells within 1.5min, dropwise adding the cells into a 15mL centrifuge tube filled with 8mL warm culture medium in an ultraclean bench, centrifuging the centrifuge tube at 900rpm for 5min, discarding the supernatant, resuspending the cells in 1mL complete culture solution (blowing for 15 times), immediately mixing 20 mu L of suspension with trypan equal volume of trypan blue, counting the number of viable cells by taking 20 mu L, diluting the cells to 4X 10 5 cells/mL;
4. Dividing a 384-well plate into GLP-1R cells, GCGR cells and GIPR cell areas, adding 5 mu L of cell suspension into the wells of the corresponding areas by using a 12-channel lane-changing adjustable dispenser according to each well, and adding 5 mu L of gradient diluent of a test sample and a positive control into the 384-well plate of the corresponding cells by using a 12-channel lane-changing adjustable dispenser, wherein each well is 5 mu L (samples with the same concentration are parallelly provided with 2 multiple wells); negative control: setting 3 holes in each 384-hole plate at 10 mu L of assay buffer per hole, covering a white sealing plate film, putting the plate into a constant-temperature incubator at 37 ℃, and taking out the plate after half an hour;
5. diluting a cAMP-d2 working solution and an anti-cAMP-cryptate working solution by 20 times by using a lysine buffer in a kit before use, then uniformly mixing 1;
6. the fluorescence values of 665nm and 620nm are detected in a multifunctional microplate reader. The signal ratio and sample concentration were fitted non-linearly in GraphPad Prism 6 using a four parameter equation to give EC50 values, with the specific results shown in table 2.
TABLE 2 results of in vitro cell Activity assay of polypeptide Compounds
Example 3
This example evaluates the effect of HEC-PT26, HEC-PT49, HEC-PT50 on glucose tolerance in normal C57BL/6 mice.
The experimental method comprises the following steps: normal C57BL/6 mice were randomly divided into 5 groups (control group, semaglutide group, HEC-PT26 group, HEC-PT49 group, HEC-PT50 group) by blood glucose and body weight, and 8 mice were administered to each group. For the Semaglutide group, the HEC-PT26 group, the HEC-PT49 group and the HEC-PT50 group, the corresponding drugs are injected into animals of each group by subcutaneous injection, and the administration dose is 3nmol/kg; for the control group, the corresponding vehicle was injected subcutaneously.
After 12h of single administration, animals are fasted for 12h and are freely drunk, blood is taken from tail veins to determine the blood sugar basic value of each group of animals, then 2g/kg of glucose solution is given by intraperitoneal injection, and blood sugar detection is carried out at the time points of 15 min, 30 min and 60min after the administration of the glucose. Drawing a blood glucose concentration-time curve according to blood glucose values measured at different time points, and calculating AUC of each dosage group 0~60min As shown in table 3 and fig. 1.
Animals fasted for 12h after a single administration of 60h, had free access to water. Blood was taken from the tail vein to determine the blood glucose basal value of each group of animals, followed by intraperitoneal injection of 2g/kg glucose solution, and blood glucose measurements were performed at time points 15, 30, 60, and 90min after administration of glucose. Drawing a blood glucose concentration-time curve according to blood glucose values measured at different time points, and calculating AUC (oral glucose value) of each dose group 0~90min As shown in table 4 and fig. 2.
The experimental results are as follows:
table 3: effect of single administration of HEC-PT26, HEC-PT49 and HEC-PT50 on glucose tolerance in Normal C57 mice after 24h
Table 4: effect of single administration of HEC-PT26, HEC-PT49 and HEC-PT50 on glucose tolerance of normal C57 mice for 72h
And (4) experimental conclusion: 24h, HEC-PT26, HEC-PT49 and HEC-PT50 can obviously reduce the blood sugar level of a normal C57 mouse after single administration, and the effect is equivalent to that of Semaglutide; the blood sugar level of normal C57 mice can be obviously reduced by HEC-PT26, HEC-PT49 and HEC-PT50 72h after single administration.
Example 4
This example evaluates the effect of HEC-PT47 and HEC-PT48 on glucose tolerance in normal C57BL/6 mice.
The experimental method comprises the following steps: normal C57BL/6 mice were divided into 4 groups (control group, HEC-PT47 group, HEC-PT48 group) of 8 mice per group according to blood glucose and body weight. For the HEC-PT47 group and the HEC-PT48 group, the corresponding medicines are administered by subcutaneous injection, and the administration dose is 3nmol/kg; for the control group, the corresponding vehicle was injected subcutaneously.
After a single administration for 12 hours, animals are fasted for 12 hours and have free water. Blood was taken from tail vein to determine the blood glucose basal value of each group of animals, followed by intraperitoneal injection of 2g/kg glucose solution, and blood glucose was measured 15, 30, and 60min after administration of glucose. Drawing a blood glucose concentration-time curve according to blood glucose values measured at different time points, and calculating AUC of each dosage group 0~60min As shown in fig. 3 and table 5.
The experimental results are as follows:
table 5: effect of a single administration of HEC-PT47 and HEC-PT48 on glucose tolerance in Normal C57 mice after 24h
And (4) experimental conclusion: HEC-PT47 and HEC-PT48 significantly reduced blood glucose levels in normal C57 mice.
Example 5
This example evaluates the effect of HEC-PT26 on blood glucose in db/db mice.
The experimental method comprises the following steps: the db/db mice 7-8 weeks old were randomly divided into 4 groups (Model group, LY3298176 group, semaglutide group, HEC-PT26 group) according to blood sugar and body weight values, and 8 mice were used in each group. For LY3298176 group, semaglutide group and HEC-PT26 group, the corresponding medicine is administered by subcutaneous injection to animals of each group, and the dosage of each administration is 10nmol/kg; for the Model group, the corresponding vehicle was injected subcutaneously. The Semaglutide group was administered once a day, and the LY3298176 group and the HEC-PT26 group were administered once every 3 days for 4 weeks; blood glucose measurements were performed on the animals prior to each dose.
The experimental results are as follows: the HEC-PT26 group can obviously reduce blood sugar after administration, the blood sugar reaches the lowest level at 24h, and the effect is superior to that of positive controls Semaglutide and LY3298176 of the same dose. Compared with the Model, the blood sugar value of mice in the HEC-PT26 group is obviously reduced after long-term repeated administration, the long-term stability is kept, the blood sugar reducing effect of the mice is similar to that of the Semaglutide group and is superior to that of the LY3298176 group, and the specific data are shown in the table 6 and the figure 4.
Table 6: effect of chronic administration of HEC-PT26 on blood glucose in db/db mice
And (4) experimental conclusion: the blood sugar level of a type II diabetes model db/db mouse can be obviously improved by long-term administration of HEC-PT 26.
Example 6
This example evaluates the effect of a single dose of HEC-PT47, HEC-PT48 and HEC-PT50 on blood glucose and body weight in db/db mice.
The experimental method comprises the following steps: after adaptive feeding of db/db mice of 6-7 weeks for 1 week, randomly dividing the mice into 4 groups (a Semaglutide group, an HEC-PT47 group, an HEC-PT48 group and an HEC-PT50 group) according to body weight and blood sugar value, wherein each group comprises 5 mice; a single subcutaneous injection was administered beginning at week 2, each group was dosed with the corresponding drug at 10nmol/kg, and blood glucose, body weight and food intake of each group of animals were examined before and after administration. The results are shown in tables 7-9 and FIGS. 5-7.
Table 7: effect of a Single administration of HEC-PT47, HEC-PT48, HEC-PT50 on blood glucose in db/db mice
Table 8: effect of a Single administration of HEC-PT47, HEC-PT48, HEC-PT50 on the body weight of db/db mice
Table 9: effect of Single administration of HEC-PT47, HEC-PT48, HEC-PT50 on food intake in db/db mice
The experimental results are as follows: blood sugar test results show that after single administration of HEC-PT47, HEC-PT48 and HEC-PT50, the blood sugar of db/db mice is remarkably reduced within 48 hours, and the blood sugar rises to a peak and is relatively constant at about 96 hours. The HEC-PT47, the HEC-PT48 and the HEC-PT50 also have a remarkable effect on controlling the body weight of db/db mice within 3 days after being administrated, and the body weight growth rate is reduced; moreover, the single administration of the preparation has better effect on controlling the food intake of db/db mice than the positive drug Semaglutide with the same dose.
Example 7
This example evaluates the effect of chronic repeated doses of HEC-PT47, HEC-PT50, and HEC-PT61 on body weight and food intake in DIO obese mice.
The experimental method comprises the following steps: C57/BL6 mice were randomized at the fifth week of age into normal group NFD, model group HFD, normal group given normal maintenance diet, and other groups given high fat diet D12492. Mice were monitored for changes in body mass and food intake every 3 weeks. After being raised for 16 weeks, the body masses of the mice in the model group and the normal group are respectively (47.7 +/-3.1) g and (30.9 +/-2.3) g, and the comparison difference between the two groups has statistical significance. The normal group was divided into Control group(s) (PBS injected subcutaneously); the model group mice successfully molded are divided into a Vehicle group, a Semaglutide group, an HEC-PT47 group, an HEC-PT50 group and an HEC-PT61 group, and each group comprises 10 mice. For the Semaglutide group, the HEC-PT47 group, the HEC-PT50 group and the HEC-PT61 group, animals in each group were administered the corresponding drugs by subcutaneous injection; for the Vehicle group, PBS was injected subcutaneously. The first dose was observed 7 days later, and each group was dosed every 3 days at a dose of 10nmol/kg. Body weight and food intake were measured before each administration. After 3 weeks of administration, an abdominal glucose tolerance test is carried out, the sample is slaughtered and collected 72 hours after the last administration, the weight of the liver is recorded, and the pathological condition of the liver and the blood biochemical index of each group are detected. The results are shown in tables 10-13 and FIGS. 8-11.
Table 10: effect of Long-term administration of HEC-PT47, HEC-PT50, HEC-PT61 on body weight of DIO mice
Note: the lower case letter a in the same column with shoulder marks indicates significant difference (P < 0.05)
Table 11: effect of long-term administration of HEC-PT47, HEC-PT50, HEC-PT61 on food intake of DIO mice
Note: the same column of shoulder marks are marked with lower case letters to indicate significant difference (P < 0.05)
Table 12: effect of HEC-PT47, HEC-PT50, HEC-PT61 Long-term administration on physical quality and liver index of DIO mice
Group of | Mass/g | Liver/g | Liver index% |
Control | 29.1±2.2 a | 1.0±0.1 a | 3.5±0.0 a |
Vehicle | 48.0±1.9 | 2.0±0.4 | 4.1±0.0 |
Semaglutide | 41.0±4.3 a | 1.1±0.2 a | 2.6±0.0 a |
HEC-PT47 | 30.5±2.2 a | 1.5±0.1 a | 5.0±0.0 a |
HEC-PT50 | 34.0±2.0 a | 1.0±0.1 a | 2.8±0.0 a |
HEC-PT61 | 31.8±3.3 a | 0.9±0.1 a | 2.8±0.0 a |
Note: the same column of shoulder marks are marked with lower case letters to indicate significant difference (P < 0.05)
Table 13: effect of long-term administration of HEC-PT47, HEC-PT50 and HEC-PT61 on liver function and blood fat of DIO mice
Note: the same column of shoulder marks are marked with lower case letters to indicate significant difference (P < 0.05)
The experimental results are as follows: after administration for 4 weeks, the weight loss effect of HEC-PT47, HEC-PT50 and HEC-PT61 is obviously superior to that of the positive medicament Semaglutide under the same dose and the same administration frequency. The control effect of HEC-PT47, HEC-PT50 and HEC-PT61 on the food intake of DIO mice is basically similar and is obviously superior to that of Semaglutide.
The above description is only for the preferred embodiment of the present invention, but the scope of the present invention is not limited thereto, and any changes or substitutions that can be easily conceived by those skilled in the art within the technical scope of the present invention are included in the scope of the present invention. Therefore, the protection scope of the present invention shall be subject to the protection scope of the claims.
Sequence listing
<110> Guangdong Dongyuang pharmaceutical Co., ltd
<120> triple agonists of GLP-1, GCG and GIP receptors
<150> 202110685293.1
<151> 2021-06-21
<160> 60
<170> PatentIn version 3.5
<210> 1
<211> 30
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (1)..(1)
<223> Xaa is Tyr or His
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is Ser or Aib
<220>
<221> VARIANT
<222> (3)..(3)
<223> Xaa is Gln or His
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is Phe or α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (13)..(13)
<223> Xaa is Leu, tyr or Ala
<220>
<221> VARIANT
<222> (16)..(16)
<223> Xaa is Lys, glu or Arg
<220>
<221> VARIANT
<222> (17)..(17)
<223> Xaa is Ile or Lys unmodified or modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the Lys side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<220>
<221> VARIANT
<222> (19)..(19)
<223> Xaa is Gln or Ala
<220>
<221> VARIANT
<222> (20)..(20)
<223> Xaa is Arg, gln, his, or Lys either unmodified or modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the Lys side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18, c is
<220>
<221> VARIANT
<222> (21)..(21)
<223> Xaa is Asp, ala or Glu
<220>
<221> VARIANT
<222> (23)..(23)
<223> Xaa is Ile or Val
<220>
<221> VARIANT
<222> (25)..(25)
<223> Xaa is Trp or Tyr
<220>
<221> VARIANT
<222> (27)..(27)
<223> Xaa is Leu or Glu
<220>
<221> VARIANT
<222> (28)..(28)
<223> Xaa is Ala, ser or Glu
<220>
<221> VARIANT
<222> (29)..(29)
<223> Xaa is Gly, gln or Ala
<220>
<221> VARIANT
<222> (30)..(30)
<223> Xaa is Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser, pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser or is absent
<400> 1
Xaa Xaa Xaa Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Xaa Leu Asp Xaa
1 5 10 15
Xaa Ala Xaa Xaa Xaa Phe Xaa Glu Xaa Leu Xaa Xaa Xaa Xaa
20 25 30
<210> 2
<211> 10
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 2
Gly Pro Ser Ser Gly Ala Pro Pro Pro Ser
1 5 10
<210> 3
<211> 9
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 3
Pro Ser Ser Gly Ala Pro Pro Pro Ser
1 5
<210> 4
<211> 8
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 4
Pro Ser Ser Gly Ala Pro Pro Ser
1 5
<210> 5
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 5
Tyr Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Ala Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 6
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> D form Ser
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 6
Tyr Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Ala Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 7
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 7
Tyr Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Ala Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 8
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 8
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Ala Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 9
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 9
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Gln Asp Phe Ile Glu Trp Leu Leu Ala Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 10
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 10
Tyr Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Ile Tyr Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Ala Phe Val Glu Trp Leu Leu Ala Gln Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 11
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 11
Tyr Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Ile Tyr Leu Asp Glu
1 5 10 15
Lys Ala Ala Lys Glu Phe Ile Glu Trp Leu Glu Ser Ala
20 25
<210> 12
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 12
Tyr Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Ile Ala Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Glu Phe Val Glu Trp Leu Leu Ser Ala Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 13
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 13
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Arg
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Ala Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 14
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 14
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Arg
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Glu Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 15
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 15
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Glu Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 16
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 16
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Ala His Glu Phe Ile Glu Trp Leu Leu Ala Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 17
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 17
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Glu
1 5 10 15
Lys Ala Ala Gln Glu Phe Ile Glu Trp Leu Leu Ala Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 18
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 18
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Tyr Leu Asp Lys
1 5 10 15
Lys Ala Gln Gln Asp Phe Ile Glu Trp Leu Leu Glu Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 19
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 19
Tyr Xaa His Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Ala Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 20
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (20)..(20)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 20
His Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Ile Ala Ala Lys Asp Phe Ile Glu Trp Leu Leu Glu Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 21
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (20)..(20)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 21
His Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Ile Ala Ala Lys Asp Phe Ile Glu Trp Leu Leu Glu Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 22
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 22
His Xaa His Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Gln Asp Phe Ile Glu Trp Leu Leu Glu Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 23
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 23
His Xaa His Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln His Asp Phe Ile Glu Trp Leu Leu Glu Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 24
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (20)..(20)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 24
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Glu
1 5 10 15
Ile Ala Ala Lys Asp Phe Ile Glu Trp Leu Leu Glu Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 25
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (20)..(20)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 25
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Glu
1 5 10 15
Ile Ala Gln Lys Ala Phe Ile Glu Tyr Leu Leu Glu Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 26
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (20)..(20)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 26
His Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Glu
1 5 10 15
Ile Ala Ala Lys Ala Phe Ile Glu Tyr Leu Leu Glu Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 27
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 27
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Arg
1 5 10 15
Lys Ala Gln Gln Asp Phe Ile Glu Trp Leu Leu Glu Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 28
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (20)..(20)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 28
His Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Arg
1 5 10 15
Ile Ala Ala Lys Asp Phe Ile Glu Trp Leu Leu Glu Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 29
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 29
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Ala Phe Ile Glu Tyr Leu Leu Ala Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 30
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 30
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Ala Phe Ile Glu Trp Leu Leu Ala Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 31
<211> 39
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 31
Tyr Xaa His Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Ala Phe Ile Glu Trp Leu Leu Ala Gly Gly Pro Ser
20 25 30
Ser Gly Ala Pro Pro Pro Ser
35
<210> 32
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 32
Tyr Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Ala Gly
20 25
<210> 33
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> D form Ser
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 33
Tyr Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Ala Gly
20 25
<210> 34
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 34
Tyr Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Ala Gly
20 25
<210> 35
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 35
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Ala Gly
20 25
<210> 36
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 36
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Gln Asp Phe Ile Glu Trp Leu Leu Ala Gly
20 25
<210> 37
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 37
Tyr Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Ile Tyr Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Ala Phe Val Glu Trp Leu Leu Ala Gln
20 25
<210> 38
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 38
Tyr Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Ile Ala Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Glu Phe Val Glu Trp Leu Leu Ser Ala
20 25
<210> 39
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 39
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Arg
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Ala Gly
20 25
<210> 40
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 40
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Arg
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Glu Gly
20 25
<210> 41
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 41
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Glu Gly
20 25
<210> 42
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 42
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Ala His Glu Phe Ile Glu Trp Leu Leu Ala Gly
20 25
<210> 43
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 43
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Glu
1 5 10 15
Lys Ala Ala Gln Glu Phe Ile Glu Trp Leu Leu Ala Gly
20 25
<210> 44
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 44
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Tyr Leu Asp Lys
1 5 10 15
Lys Ala Gln Gln Asp Phe Ile Glu Trp Leu Leu Glu Gly
20 25
<210> 45
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 45
Tyr Xaa His Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Asp Phe Ile Glu Trp Leu Leu Ala Gly
20 25
<210> 46
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (20)..(20)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 46
His Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Ile Ala Ala Lys Asp Phe Ile Glu Trp Leu Leu Glu Gly
20 25
<210> 47
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (20)..(20)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 47
His Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Ile Ala Ala Lys Asp Phe Ile Glu Trp Leu Leu Glu Gly
20 25
<210> 48
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 48
His Xaa His Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Gln Asp Phe Ile Glu Trp Leu Leu Glu Gly
20 25
<210> 49
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 49
His Xaa His Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln His Asp Phe Ile Glu Trp Leu Leu Glu Gly
20 25
<210> 50
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (20)..(20)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 50
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Glu
1 5 10 15
Ile Ala Ala Lys Asp Phe Ile Glu Trp Leu Leu Glu Gly
20 25
<210> 51
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (20)..(20)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 51
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Glu
1 5 10 15
Ile Ala Gln Lys Ala Phe Ile Glu Tyr Leu Leu Glu Gly
20 25
<210> 52
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (20)..(20)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 52
His Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Glu
1 5 10 15
Ile Ala Ala Lys Ala Phe Ile Glu Tyr Leu Leu Glu Gly
20 25
<210> 53
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 53
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Arg
1 5 10 15
Lys Ala Gln Gln Asp Phe Ile Glu Trp Leu Leu Glu Gly
20 25
<210> 54
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (20)..(20)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 54
His Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Arg
1 5 10 15
Ile Ala Ala Lys Asp Phe Ile Glu Trp Leu Leu Glu Gly
20 25
<210> 55
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 55
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Ala Phe Ile Glu Tyr Leu Leu Ala Gly
20 25
<210> 56
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or the following modifications are present: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 56
Tyr Xaa Gln Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Ala Phe Ile Glu Trp Leu Leu Ala Gly
20 25
<210> 57
<211> 29
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<220>
<221> VARIANT
<222> (2)..(2)
<223> Xaa is 2-aminoisobutyric acid (Aib)
<220>
<221> VARIANT
<222> (6)..(6)
<223> Xaa is α -Me- (2-F) -Phe
<220>
<221> VARIANT
<222> (17)..(17)
<223> Lys is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy ] -acetyl) a- (gammaglu) b-CO- (CH 2) c-CO2H conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18
<400> 57
Tyr Xaa His Gly Thr Xaa Thr Ser Asp Tyr Ser Ile Leu Leu Asp Lys
1 5 10 15
Lys Ala Gln Arg Ala Phe Ile Glu Trp Leu Leu Ala Gly
20 25
<210> 58
<211> 31
<212> PRT
<213> Intelligent (Homo sapiens)
<400> 58
His Ala Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly
1 5 10 15
Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Arg Gly
20 25 30
<210> 59
<211> 29
<212> PRT
<213> Intelligent (Homo sapiens)
<400> 59
His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Ser
1 5 10 15
Arg Arg Ala Gln Asp Phe Val Gln Trp Leu Met Asn Thr
20 25
<210> 60
<211> 42
<212> PRT
<213> Intelligent (Homo sapiens)
<400> 60
Tyr Ala Glu Gly Thr Phe Ile Ser Asp Tyr Ser Ile Ala Met Asp Lys
1 5 10 15
Ile His Gln Gln Asp Phe Val Asn Trp Leu Leu Ala Gln Lys Gly Lys
20 25 30
Lys Asn Asp Trp Lys His Asn Ile Thr Gln
35 40
Claims (10)
1. A compound which is a peptide having the general formula I:
xaa1-Xaa2-Xaa3-Gly-Thr-Xaa6-Thr-Ser-Asp-Tyr-Ser-Ile-Xaa13-Leu-Asp-Xaa16-Xaa17-Ala-Xaa19-Xaa20-Xaa21-Phe-Xaa23-Glu-Xaa25-Leu-Xaa27-Xaa28-Xaa29-R1 (general formula I, SEQ ID NO: 1);
wherein Xaa1 is Tyr or His;
xaa2 is Ser, or Aib;
xaa3 is Gln, or His;
xaa6 is Phe, or α -Me- (2-F) -Phe;
xaa13 is Leu, tyr, or Ala;
xaa16 is Lys, glu, or Arg;
xaa17 is Lys, or Ile;
xaa19 is Gln, or Ala;
xaa20 is Arg, gln, lys, or His;
xaa21 is Asp, ala, or Glu;
xaa23 is Ile, or Val;
xaa25 is Trp, or Tyr;
xaa27 is Leu, or Glu;
xaa28 is Ala, ser, or Glu;
xaa29 is Gly, gln, or Ala;
r1 is Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser (SEQ ID NO: 2), pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser (SEQ ID NO: 3), pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser (SEQ ID NO: 4) or does not exist;
at least one of Xaa17 and Xaa20 is unmodified or modified Lys, and the modification is: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the Lys side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18.
2. The compound of claim 1, wherein in formula I,
xaa1 is Tyr or His;
xaa2 is Ser, or Aib;
xaa3 is Gln or His;
xaa6 is Phe, or α -Me- (2-F) -Phe;
xaa13 is Leu, or Ala;
xaa16 is Lys, glu, or Arg;
xaa17 is Lys, or Ile;
xaa19 is Gln, or Ala;
xaa20 is Arg, gln, lys, or His;
xaa21 is Asp, ala, or Glu;
xaa23 is Ile, or Val;
xaa25 is Trp or Tyr;
xaa27 is Leu;
xaa28 is Ala, ser, or Glu;
xaa29 is Gly, or Ala;
r1 is Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser (SEQ ID NO: 2), pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser (SEQ ID NO: 3), pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser (SEQ ID NO: 4) or deleted;
at least one of Xaa17 and Xaa20 is unmodified or modified Lys, and the modification is: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the Lys side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18.
3. The compound of claim 1, wherein in formula I,
xaa1 is Tyr or His;
xaa2 is Aib;
xaa3 is Gln, or His;
xaa6 is α -Me- (2-F) -Phe;
xaa13 is Leu;
xaa16 is Lys;
xaa17 is Lys modified as follows: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the Lys side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18;
xaa19 is Gln;
xaa20 is Arg, gln, or His;
xaa21 is Asp;
xaa23 is Ile;
xaa25 is Trp;
xaa27 is Leu;
xaa28 is Ala, or Glu;
xaa29 is Gly;
r1 is Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser (SEQ ID NO: 2), pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser (SEQ ID NO: 3), or Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser (SEQ ID NO: 4).
4. The compound of claim 1, wherein positions 1 to 29 of formula I are the following sequence:
YSQGTFTSDYSILLDKKAQRDFIEWLLAG(SEQ ID NO:32);
Y(dS)QGTFTSDYSILLDKKAQRDFIEWLLAG(SEQ ID NO:33);
Y-Aib-QGTFTSDYSILLDKKAQRDFIEWLLAG(SEQ ID NO:34);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLAG(SEQ ID NO:35);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQQDFIEWLLAG(SEQ ID NO:36);
Y-Aib-QGTFTSDYSIYLDKKAQRAFVEWLLAQ(SEQ ID NO:37);
Y-Aib-QGTFTSDYSIYLDEKAAKEFIEWLESA(SEQ ID NO:11);
Y-Aib-QGTFTSDYSIALDKKAQREFVEWLLSA(SEQ ID NO:38);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRKAQRDFIEWLLAG(SEQ ID NO:39);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRKAQRDFIEWLLEG(SEQ ID NO:40);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLEG(SEQ ID NO:41);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAAHEFIEWLLAG(SEQ ID NO:42);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEKAAQEFIEWLLAG(SEQ ID NO:43);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSIYLDKKAQQDFIEWLLEG(SEQ ID NO:44);
Y-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLAG(SEQ ID NO:45);
H-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKIAAKDFIEWLLEG(SEQ ID NO:46);
H-Aib-QGTFTSDYSILLDKIAAKDFIEWLLEG(SEQ ID NO:47);
H-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQQDFIEWLLEG(SEQ ID NO:48);
H-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQHDFIEWLLEG(SEQ ID NO:49);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEIAAKDFIEWLLEG(SEQ ID NO:50);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEIAQKAFIEYLLEG(SEQ ID NO:51);
H-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEIAAKAFIEYLLEG(SEQ ID NO:52);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRKAQQDFIEWLLEG(SEQ ID NO:53);
H-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRIAAKDFIEWLLEG(SEQ ID NO:54);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRAFIEYLLAG(SEQ ID NO:55);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSLDLKKAQRAFIEWLAG (SEQ ID NO: 56); or
Y-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRAFIEWLLAG(SEQ ID NO:57);
Wherein the K at position 17 and/or 20 is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the K side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18;
r1 is GPSSGAPPPS (SEQ ID NO: 2), PSSGAPPPS (SEQ ID NO: 3), PSSGAPPPS (SEQ ID NO: 4) or null.
5. The compound of claim 1, wherein formula I is the following sequence:
YSQGTFTSDYSILLDKKAQRDFIEWLLAGGPSSGAPPPS(SEQ ID NO:5);
Y(dS)QGTFTSDYSILLDKKAQRDFIEWLLAGGPSSGAPPPS(SEQ ID NO:6);
Y-Aib-QGTFTSDYSILLDKKAQRDFIEWLLAGGPSSGAPPPS(SEQ ID NO:7);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLAGGPSSGAPPPS(SEQ ID NO:8);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQQDFIEWLLAGGPSSGAPPPS(SEQ ID NO:9);
Y-Aib-QGTFTSDYSIYLDKKAQRAFVEWLLAQGPSSGAPPPS(SEQ ID NO:10);
Y-Aib-QGTFTSDYSIYLDEKAAKEFIEWLESA(SEQ ID NO:11);
Y-Aib-QGTFTSDYSIALDKKAQREFVEWLLSAGPSSGAPPPS(SEQ ID NO:12);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRKAQRDFIEWLLAGGPSSGAPPPS(SEQ ID NO:13);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRKAQRDFIEWLLEGGPSSGAPPPS(SEQ ID NO:14);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLEGGPSSGAPPPS(SEQ ID NO:15);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAAHEFIEWLLAGGPSSGAPPPS(SEQ ID NO:16);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEKAAQEFIEWLLAGGPSSGAPPPS(SEQ ID NO:17);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSIYLDKKAQQDFIEWLLEGGPSSGAPPPS(SEQ ID NO:18);
Y-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRDFIEWLLAGGPSSGAPPPS(SEQ ID NO:19);
H-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKIAAKDFIEWLLEGGPSSGAPPPS(SEQ ID NO:20);
H-Aib-QGTFTSDYSILLDKIAAKDFIEWLLEGGPSSGAPPPS(SEQ ID NO:21);
H-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQQDFIEWLLEGGPSSGAPPPS(SEQ ID NO:22);
H-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQHDFIEWLLEGGPSSGAPPPS(SEQ ID NO:23);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEIAAKDFIEWLLEGGPSSGAPPPS(SEQ ID NO:24);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEIAQKAFIEYLLEGGPSSGAPPPS(SEQ ID NO:25);
H-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDEIAAKAFIEYLLEGGPSSGAPPPS(SEQ ID NO:26);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRKAQQDFIEWLLEGGPSSGAPPPS(SEQ ID NO:27);
H-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDRIAAKDFIEWLLEGGPSSGAPPPS(SEQ ID NO:28);
Y-Aib-QGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRAFIEYLLAGGPSSGAPPPS(SEQ ID NO:29);
Y-Aib-QGT- (α -Me- (2-F) -Phe) -TSDYSLDLKKAQRAFIEWLAGLGSGAGPPPS (SEQ ID NO: 30); or
Y-Aib-HGT-(α-Me-(2-F)-Phe)-TSDYSILLDKKAQRAFIEWLLAGGPSSGAPPPS(SEQ ID NO:31);
Wherein, is located at 1 stLysine in position 7 and/or 20 is unmodified or there is a modification: ([ 2- (2-amino-ethoxy) -ethoxy]-acetyl group) a -(γGlu) b -CO-(CH 2 ) c -CO 2 H is conjugated to the epsilon-amino group of the lysine side chain, wherein a is 1 or 2, b is 1 or 2, c is 16 or 18.
6. A compound according to any one of claims 1-5 for use as an agonist of GLP-1, GCG, GIP receptors.
7. A composition comprising a compound of any one of claims 1-5.
8. The composition of claim 7, further comprising a pharmaceutically acceptable carrier, diluent or excipient.
9. Use of a compound according to any one of claims 1 to 5 and/or a composition according to any one of claims 7 to 8 for the manufacture of a medicament for the treatment and/or prevention of a metabolic disorder.
10. The use according to claim 9, wherein the metabolic disorder comprises diabetes, diabetes-related disorders, obesity, fatty liver disease, non-alcoholic steatohepatitis, dyslipidemia and disorders associated with metabolic syndrome.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN2021106852931 | 2021-06-21 | ||
CN202110685293 | 2021-06-21 |
Publications (1)
Publication Number | Publication Date |
---|---|
CN115572326A true CN115572326A (en) | 2023-01-06 |
Family
ID=84544965
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202210698013.5A Pending CN115572326A (en) | 2021-06-21 | 2022-06-20 | Triplex agonists of GLP-1, GCG and GIP receptors |
Country Status (2)
Country | Link |
---|---|
CN (1) | CN115572326A (en) |
WO (1) | WO2022268029A1 (en) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2024067662A1 (en) * | 2022-09-28 | 2024-04-04 | 广东东阳光药业股份有限公司 | Glp-1/gcg/gip triple-receptor agonist and use thereof |
Family Cites Families (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
SG11201503526UA (en) * | 2012-12-21 | 2015-06-29 | Sanofi Sa | Dual glp1/gip or trigonal glp1/gip/glucagon agonists |
US10093713B2 (en) * | 2013-11-06 | 2018-10-09 | Zealand Pharma A/S | GIP-GLP-1 dual agonist compounds and methods |
TR201902516T4 (en) * | 2013-11-06 | 2019-03-21 | Zealand Pharma As | Glucagon-glp-1-envy triple agonist compounds. |
WO2018104558A1 (en) * | 2016-12-09 | 2018-06-14 | Zealand Pharma A/S | Acylated glp-1/glp-2 dual agonists |
WO2018103868A1 (en) * | 2016-12-09 | 2018-06-14 | Zealand Pharma A/S | Acylated glp-1/glp-2 dual agonists |
TWI767095B (en) * | 2017-12-21 | 2022-06-11 | 美商美國禮來大藥廠 | Incretin analogs and uses thereof |
CN111171135B (en) * | 2018-11-12 | 2023-04-07 | 天津药物研究院有限公司 | Glucagon-derived peptides with dual receptor agonism and uses thereof |
-
2022
- 2022-06-20 CN CN202210698013.5A patent/CN115572326A/en active Pending
- 2022-06-20 WO PCT/CN2022/099856 patent/WO2022268029A1/en unknown
Also Published As
Publication number | Publication date |
---|---|
WO2022268029A1 (en) | 2022-12-29 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11111285B2 (en) | Glucagon-GLP-1-GIP triple agonist compounds | |
TWI700291B (en) | Glucagon and glp-1 co-agonist compounds | |
RU2385878C2 (en) | Peptide having amylin properties (versions) and use thereof (versions) | |
US20230220033A1 (en) | Glp-1 agonist polypeptide compound and salt thereof, synthesis method therefor and use thereof | |
CN104395338B (en) | People's amylin analog | |
BR112015001451B1 (en) | Compound, nucleic acid construct, expression vector, host cell, pharmaceutical composition, use of a compound or its pharmaceutically acceptable salt or solvate | |
CN101035806A (en) | Amylin family polypeptide-6 (AFP-6) analogs and methods of making and using them | |
EP4345105A1 (en) | Polypeptide derivative having effect of dual targeted activation of glp-1r and gipr, preparation method therefor, and use thereof | |
CN113429471B (en) | Long-acting GLP-1 polypeptide analogue, and preparation method and application thereof | |
CN115572326A (en) | Triplex agonists of GLP-1, GCG and GIP receptors | |
WO2004078195A1 (en) | Agent for converting intestinal cell into insulin-producing cell and remedy for diabetes | |
TW201917134A (en) | Novel acylated insulin analogues and uses thereof | |
KR20230126712A (en) | long-acting glucagon derivatives | |
CN116589536B (en) | Long-acting GLP-1/GIP receptor dual agonist and application thereof | |
CN115785249B (en) | GLP-1 analogues and application thereof | |
US20230183310A1 (en) | Polypeptide Compounds and Use Thereof in the Prevention or Treatment of Diabetes or Diabetic Complications | |
WO2023207106A1 (en) | Glp-1/gip receptor co-agonist, pharmaceutical composition comprising same, and use thereof | |
CN114685642B (en) | Pharmaceutically acceptable salt of incretin analogue, and preparation method and application thereof | |
CN113493503B (en) | Incretin analogue and preparation method and application thereof | |
WO2024067662A1 (en) | Glp-1/gcg/gip triple-receptor agonist and use thereof | |
US20210317178A1 (en) | Pharmaceutical composition comprising polypeptide | |
RU2777095C1 (en) | Pharmaceutical composition including a polypeptide | |
CN115073582A (en) | Polypeptide compound and application thereof in preventing or treating diabetes or diabetic complications | |
CN117143221A (en) | GLP-1R, GIPR and GCGR triple agonist compound | |
CN117603364A (en) | GLP-1/glucon/Y 2 Receptor triple agonists and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
CB02 | Change of applicant information | ||
CB02 | Change of applicant information |
Address after: 523808 No.1, Gongye North Road, Songshanhu Park, Dongguan City, Guangdong Province Applicant after: Guangdong Dongyangguang Pharmaceutical Co.,Ltd. Address before: 523808 No.1, Gongye North Road, Songshanhu Park, Dongguan City, Guangdong Province Applicant before: SUNSHINE LAKE PHARMA Co.,Ltd. |
|
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination |