CN115463208B - Oral hypoglycemic composition - Google Patents

Oral hypoglycemic composition Download PDF

Info

Publication number
CN115463208B
CN115463208B CN202111177413.3A CN202111177413A CN115463208B CN 115463208 B CN115463208 B CN 115463208B CN 202111177413 A CN202111177413 A CN 202111177413A CN 115463208 B CN115463208 B CN 115463208B
Authority
CN
China
Prior art keywords
glp
composition
seq
analogue
group
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
CN202111177413.3A
Other languages
Chinese (zh)
Other versions
CN115463208A (en
Inventor
彭文
黄星
杨俊朋
柏冠军
曹居祥
王艳
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Shandong Haibang Biotechnology Co ltd
Shanghai Hai'ao Biotechnology Co ltd
Original Assignee
Shandong Haibang Biotechnology Co ltd
Shanghai Hai'ao Biotechnology Co ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Shandong Haibang Biotechnology Co ltd, Shanghai Hai'ao Biotechnology Co ltd filed Critical Shandong Haibang Biotechnology Co ltd
Priority to CN202111177413.3A priority Critical patent/CN115463208B/en
Publication of CN115463208A publication Critical patent/CN115463208A/en
Application granted granted Critical
Publication of CN115463208B publication Critical patent/CN115463208B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/185Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
    • A61K31/19Carboxylic acids, e.g. valproic acid
    • A61K31/20Carboxylic acids, e.g. valproic acid having a carboxyl group bound to a chain of seven or more carbon atoms, e.g. stearic, palmitic, arachidic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/56Materials from animals other than mammals
    • A61K35/60Fish, e.g. seahorses; Fish eggs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0053Mouth and digestive tract, i.e. intraoral and peroral administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Public Health (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Diabetes (AREA)
  • Engineering & Computer Science (AREA)
  • Endocrinology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Emergency Medicine (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Nutrition Science (AREA)
  • Physiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Medicinal Preparation (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

The invention relates to the technical field of medicines, and discloses an oral hypoglycemic composition. The composition of the invention comprises GLP-1 analogues, sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and fish oil. The composition has high and durable blood glucose reducing effect, can maintain good blood glucose reducing effect when being taken orally, and can be used for developing oral blood glucose reducing medicines.

Description

Oral hypoglycemic composition
Technical Field
The invention relates to the technical field of polypeptides, in particular to an oral hypoglycemic composition.
Background
Type 2 diabetes is a chronic metabolic disease caused by insufficient insulin secretion or insulin resistance in the body, and currently worldwide diabetic patients are predicted to be 4 hundred million. GLP-1 receptor agonists have been increasingly used in recent years to lower blood glucose by entering the blood to bind with GLP-1 receptor, and by promoting insulin synthesis and secretion of islets, inhibiting glucagon secretion, enhancing the utilization of glucose by peripheral tissues, and reducing hepatic glucose output, thereby lowering blood glucose.
Human glucagon-like peptide-1 (GLP-1) is incretin produced by L cells of the ileum and colon, the activity of GLP-1 (1-37) is extremely low, GLP-1 (7-37) with biological activity is formed after removing N-terminal 6 peptide, and the sequence of human GLP-1 (7-37) is as follows:
Figure BDA0003295845410000011
however, human GLP-1 (7-37) is secreted into the blood and has a half-life of only 3 to 5 minutes because it is extremely easily degraded by DDP-IV and cleared by glomerular filtration.
Currently available GLP-1 analogs generally function by injection. However, the disadvantage of injections is evident: 1. the use is inconvenient; 2. injection often causes relatively significant pain. Therefore, the development of the medicine with high and durable oral hypoglycemic effect has great application significance for treating diabetes.
Disclosure of Invention
In view of the above, the present invention aims to provide an oral hypoglycemic composition. Experiments show that the hypoglycemic composition still has obvious hypoglycemic effect after being orally taken.
In order to achieve the above object, the present invention provides the following technical solutions:
an oral hypoglycemic composition comprising a GLP-1 analogue, sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and fish oil.
In some embodiments, the mass ratio of GLP-1 analog, sodium N- (8- (2-hydroxybenzoyl) amino) caprylate, and fish oil is (10-20): (25-280): (10-200).
In some embodiments, the mass ratio of GLP-1 analog, sodium N- (8- (2-hydroxybenzoyl) amino) caprylate, and fish oil is 10:60: 15. 15:200:60, 10:25:10 or 20:280:200.
In the oral hypoglycemic composition provided by the invention, the GLP-1 analogue is preferably at least one of I) to III):
i) A polypeptide having an amino acid sequence shown in SEQ ID NO.1, wherein the 5 th cysteine and the 10 th cysteine of the sequence shown in SEQ ID NO.1 form intramolecular disulfide bonds; or (b)
II) a polypeptide having the same or similar function as I) obtained by substitution, deletion or addition of one or more amino acids in the polypeptide of I); or (b)
III), a polypeptide having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% homology to the amino acid sequence shown in I) and having the same or similar function as I).
Preferably, the amino acid sequence of the GLP-1 analogue is that 5-6 common amino acids are additionally added at the C end on the basis of the amino acid sequence shown in SEQ ID NO.1, and the 5 th cysteine and the 10 th cysteine of the sequence shown in SEQ ID NO.1 form intramolecular disulfide bonds.
In the specific embodiment of the invention, the amino acid sequence is shown in any one of SEQ ID NO.2-3, and the 5 th cysteine and the 10 th cysteine of the sequence shown in any one of SEQ ID NO.2-3 form intramolecular disulfide bonds;
or at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% homologous to the amino acid sequence shown in any one of SEQ ID No.2 or SEQ ID No.3, and the 5 th and 10 th cysteines of the sequence shown in any one of SEQ ID No.2 or SEQ ID No.3 are cysteines, and the 5 th and 10 th cysteines form intramolecular disulfide bonds.
Experiments show that the GLP-1 analogue provided by the invention has better blood sugar control capability and longer effect compared with the existing product after optimization.
According to the preparation method of the GLP-1 analogue, a linear polypeptide is synthesized according to the amino acid sequence of the GLP-1 analogue by adopting a liquid phase synthesis, solid phase synthesis or solid-liquid combination synthesis process, and then disulfide bonds are formed by oxidation, so that the GLP-1 analogue is obtained.
In the specific embodiment of the invention, the GLP-1 analogue is synthesized by a solid phase synthesis process, the method for purifying the linear polypeptide adopts an HPLC method, and the disulfide bond is formed by oxidizing ammonium bicarbonate or DMSO.
The composition takes a specific GLP-1 analogue as an active ingredient, and reasonably matches the specific GLP-1 analogue with specific components of sodium N- (8- (2-hydroxybenzoyl) amino) octoate and fish oil according to a specific proportion. The blood sugar reducing experiment result shows that the obtained composition has lasting and effective blood sugar reducing effect after oral administration; based on the excellent technical effect, the invention provides application of the composition in preparing a medicament for treating or preventing diabetes.
The invention also provides a medicament for preventing or treating diabetes, which comprises the composition. As a further preferred embodiment it may also comprise pharmaceutically acceptable excipients and/or pharmaceutical ingredients for the treatment of other diseases without affecting the activity of the GLP-1 analogue.
The medicine can be prepared into any clinical dosage form, mainly comprises oral dosage forms or injection dosage forms, wherein the injection dosage forms comprise transfusion forms, and the dosage forms comprise but are not limited to tablets, granules, pills, oral liquid, freeze-dried powder, injection, capsules and microcapsules.
The composition of the invention comprises GLP-1 analogues, sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and fish oil. The composition has high and durable blood glucose reducing effect, can maintain good blood glucose reducing effect when being taken orally, and can be used for developing oral blood glucose reducing medicines.
Drawings
FIG. 1 is a graph showing the hypoglycemic effect of GLP-1 analogues in the composition of the invention;
FIG. 2 is a line graph of the average blood glucose over time for the composition of example 4 of the present invention.
Detailed Description
The embodiment of the invention discloses an oral hypoglycemic composition, which can be realized by appropriately improving process parameters by a person skilled in the art by referring to the content of the invention. It is expressly noted that all such similar substitutions and modifications will be apparent to those skilled in the art, and are deemed to be included within the present invention. While the oral hypoglycemic composition of the present invention has been described in terms of preferred embodiments, it will be apparent to those skilled in the relevant art that variations and suitable modifications and combinations of the oral hypoglycemic composition described herein can be made and used in the practice of the present invention without departing from the spirit or scope of the invention.
In the invention, in the specific embodiment, the experiment is compared, except for the due differences of each group, other experiment conditions, raw materials, reagents and the like which are not explicitly mentioned are kept consistent, and the comparability of the comparison experiment is ensured.
In the invention, the amino acid sequence shown in SEQ ID NO.1 is as follows:
HAEGCFTSDCSSYLEGQAAKVFIAWLVKGQH。
the GLP-1 analogue provided by the invention is further optimized on the basis of the amino acid sequence shown in SEQ ID NO.1, and the obtained polypeptide has high-efficiency and durable hypoglycemic effect and can be widely used in development of diabetes medicines.
In some embodiments, the GLP-1 analogue provided by the invention is additionally added with 5-6 common 20 amino acids at the C end of the amino acid sequence shown in SEQ ID NO.1, and the 5 th cysteine and the 10 th cysteine form intramolecular disulfide bonds.
In some specific embodiments, the GLP-1 analogue is additionally provided with 5 common amino acids at the C end of the amino acid sequence shown in SEQ ID NO.1, the amino acid sequence of the obtained polypeptide is shown in SEQ ID NO.2, and the 5 th cysteine and the 10 th cysteine form intramolecular disulfide bonds.
SEQ ID NO.2 sequence is as follows:
HAEGCFTSDCSSYLEGQAAKEFIAWLVKGQHIVVRG。
in some embodiments, the amino acid sequence of the GLP-1 analog is as follows:
Figure BDA0003295845410000041
the broken line represents the intramolecular disulfide bond formed by the two cysteines.
In some specific embodiments, the GLP-1 analogue is additionally provided with 6 common amino acids at the C end of the amino acid sequence shown in SEQ ID NO.1, the amino acid sequence of the obtained polypeptide is shown in SEQ ID NO.3, and the 5 th cysteine and the 10 th cysteine form intramolecular disulfide bonds.
SEQ ID NO.3 sequence is as follows:
HAEGCFTSDCSSYLEGQAAKVFIAWLVKGQHADLQEG。
in some embodiments, the amino acid sequence of the GLP-1 analog is as follows:
Figure BDA0003295845410000042
the broken line represents the intramolecular disulfide bond formed by the two cysteines.
The following describes a composition for oral hypoglycemic agent provided by the present invention.
EXAMPLE 1 preparation of GLP-1 analog
The solid-phase polypeptide synthesis method by Fmoc strategy was carried out with a polypeptide synthesizer according to the manufacturer's instructions. Sequentially synthesizing according to the amino acid sequence shown in SEQ ID NO.2, removing protecting groups and resin to obtain a GLP-1 analogue intermediate crude product, dissolving the GLP-1 analogue intermediate crude product with water, purifying by adopting a preparative HPLC C8 column, and using acetonitrile/water (V/V) =90: and 10, concentrating and freeze-drying to obtain a pure GLP-1 analogue intermediate product with free sulfhydryl groups. Dissolving a GLP-1 analogue intermediate pure product with water, oxidizing with ammonium bicarbonate or DMSO to form disulfide bonds, purifying to obtain a GLP-1 analogue, wherein the sequence of the GLP-1 analogue is as follows:
Figure BDA0003295845410000051
the broken line represents the intramolecular disulfide bond formed by the two cysteines.
SEQ ID NO.2:
HAEGCFTSDCSSYLEGQAAKEFIAWLVKGQHIVVRG
EXAMPLE 2 preparation of GLP-1 analog
The solid-phase polypeptide synthesis method by Fmoc strategy was carried out with a polypeptide synthesizer according to the manufacturer's instructions. Sequentially synthesizing according to the amino acid sequence shown in SEQ ID NO.3, removing protecting groups and resin to obtain a GLP-1 analogue intermediate crude product, dissolving the GLP-1 analogue intermediate crude product with water, purifying by adopting a preparative HPLC (high performance liquid chromatography) and a C8 column, and using acetonitrile/water (V/V) =90: and 10, concentrating and freeze-drying to obtain a pure GLP-1 analogue intermediate product with free sulfhydryl groups. Dissolving a GLP-1 analogue intermediate pure product with water, oxidizing with ammonium bicarbonate or DMSO to form disulfide bonds, purifying to obtain a GLP-1 analogue, wherein the sequence of the GLP-1 analogue is as follows:
Figure BDA0003295845410000052
the broken line represents the intramolecular disulfide bond formed by the two cysteines.
SEQ ID NO.3:
HAEGCFTSDCSSYLEGQAAKVFIAWLVKGQHADLQEG。
EXAMPLE 3 hypoglycemic assay of GLP-1 analog
Grouping:
24 normal mice were divided into 4 groups, 6 groups each, blank group, positive control group, drug 1 group, drug 2 group.
Dosing regimen:
the blank group injection medicine is normal saline;
the positive control group injection medicine is liraglutide;
the injection medicine of the medicine 1 group is GLP-1 analogue prepared in the embodiment 1 of the invention;
the drug 2 group injection drug is GLP-1 analogue prepared in the embodiment 2 of the invention.
Each group of mice was fasted for 12 hours before administration, fasting blood glucose of each group of mice was measured, then 200 μl of physiological saline was injected subcutaneously into the blank group, 200 μl of liraglutide was injected into the positive control group, 200 μl of 0.2mg/ml of the GLP-1 analogue prepared in example 1 of the present invention was injected into the drug 1 group, 200 μl of the GLP-1 analogue prepared in example 2 of the present invention was injected into the drug 2 group, 0.2mg/ml of the GLP-1 analogue prepared in example 2 of the present invention was injected into the drug 2 group, and 200mg of glucose/mouse was infused into the stomach immediately after administration of each group of mice, and 200mg of glucose/mouse was infused into the stomach repeatedly every 12 hours. Sugar tolerance was measured 6 hours, 24 hours and 36 hours after administration, blood glucose levels at 15 minutes, 30 minutes and 60 minutes were measured, and the blood glucose level AUC (mg/dL.min) was calculated. The results are shown in FIG. 1.
The blood sugar measurement method comprises the following steps: a blood glucose meter.
The results of fig. 1 show that:
after 4 hours of administration, the medicine 1 group and the medicine 2 group have the effect of reducing blood sugar;
after 24 hours of administration, the positive control group has no blood glucose reducing effect (the same as the blank group blood glucose reducing effect);
after 36 hours of administration, the drug 1 group and the drug 2 group still have remarkable hypoglycemic effect.
EXAMPLE 4 preparation of the hypoglycemic composition of the invention
(1) Composition A
Table 1 formulation composition
GLP-1 analog prepared in example 1 10mg
N- (8- (2-hydroxybenzoyl) amino) octanoic acid sodium salt 60mg
Fish oil 15mg
Preparation method
10mg of the GLP-1 analog prepared in example 1, 60mg of sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and 15mg of fish oil were mixed, and filled into a capsule and coated. Weighing Eudragit L30D, talcum powder and polyethylene glycol, dissolving with dichloromethane and isopropanol to obtain coating solution, and spraying the coating solution onto the surface of capsule to obtain enteric capsule. The flow rate of the coating liquid is 1.0ml/min, the coating temperature is 30 ℃, and the weight of the coating is increased by 5%. Wherein, eudragit L30D: talc powder: polyethylene glycol=9: 1:1 (weight ratio), dichloromethane: isopropanol=10:1 (volume ratio).
(2) Composition B
Table 2 formulation composition
GLP-1 analog prepared in example 1 15mg
N- (8- (2-hydroxybenzoyl) amino) octanoic acid sodium salt 200mg
Fish oil 60mg
Preparation method
15mg of the GLP-1 analog prepared in example 1, 200mg of sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and 60mg of fish oil were mixed, and filled into a capsule and coated. Weighing Eudragit L30D, talcum powder and polyethylene glycol, dissolving with dichloromethane and isopropanol to obtain coating solution, and spraying the coating solution onto the surface of capsule to obtain enteric capsule. The flow rate of the coating liquid is 1.0ml/min, the coating temperature is 40 ℃, and the weight of the coating is increased by 10%.
(3) Composition C
Table 3 formulation composition
GLP-1 analog prepared in example 2 10mg
N- (8- (2-hydroxybenzoyl) amino) octanoic acid sodium salt 25mg
Fish oil 10mg
Preparation method
10mg of the GLP-1 analog prepared in example 2, 25mg of sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and 10mg of fish oil were mixed, and filled into a capsule and coated. Weighing Eudragit L30D, talcum powder and polyethylene glycol, dissolving with dichloromethane and isopropanol to obtain coating solution, and spraying the coating solution onto the surface of capsule to obtain enteric capsule. The flow rate of the coating liquid is 0.5ml/min, the coating temperature is 35 ℃, and the coating weight is increased by 6%.
(4) Composition D
Table 4 formulation composition
GLP-1 analog prepared in example 2 20mg
N- (8- (2-hydroxybenzoyl) amino) octanoic acid sodium salt 280mg
Fish oil 200mg
Preparation method
20mg of the GLP-1 analog prepared in example 2, 280mg of sodium N- (8- (2-hydroxybenzoyl) amino) octoate and 200mg of fish oil were mixed, and filled into a capsule and coated. Weighing Eudragit L30D, talcum powder and polyethylene glycol, dissolving with dichloromethane and isopropanol to obtain coating solution, and spraying the coating solution onto the surface of capsule to obtain enteric capsule. The flow rate of the coating liquid is 0.8ml/min, the coating temperature is 45 ℃, and the weight of the coating is increased by 8%.
Comparative example 1 preparation of composition E (placebo)
TABLE 5
GLP-1 analog prepared in example 2 0mg
N- (8- (2-hydroxybenzoyl) amino) octanoic acid sodium salt 60mg
Fish oil 15mg
The preparation method comprises the following steps:
60mg of sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and 15mg of fish oil are mixed, and the mixture is filled into a capsule and coated. Weighing Eudragit L30D, talcum powder and polyethylene glycol, dissolving with dichloromethane and isopropanol to obtain coating solution, and spraying the coating solution onto the surface of capsule to obtain enteric capsule. The flow rate of the coating liquid is 1.5ml/min, the coating temperature is 40 ℃, and the weight gain of the coating is 12%.
EXAMPLE 5 hypoglycemic experiments of oral compositions
Group I:
the healthy beagle dogs are randomly divided into 5 groups, 15 beagle dogs are adopted, the weight of the beagle dogs is 10-12 kg, double cross administration is adopted, each group comprises 6 beagle dogs, the elution period is 1-2 weeks, and the group is (1) group A; (2) group B; (3) group C; (4) group D; group (5) E.
Dosage of administration:
group a oral composition a prepared in example 4;
group B oral composition B prepared in example 4;
group C oral composition C prepared in example 4;
group D oral composition D prepared in example 4;
group E orally administrated composition E prepared in comparative example 1.
Blood glucose monitoring:
each group of animals was fasted overnight for 12 hours, fasting blood glucose was measured, and then each group was orally administered one capsule of the corresponding group. After 30min of administration, each group of animals was given 8g/kg of glucose by gastric lavage. Blood glucose levels were measured for each group of animals at 0h, 0.5h, 1h, and 1.5h, respectively, after glucose administration. Blood glucose was measured using a glucometer. Each blood glucose value on the axis is the average blood glucose value of 6 beagle dogs in the corresponding group at the corresponding time. The experimental results are shown in FIG. 2.
Conclusion:
as can be seen from fig. 2, composition a, composition B, composition C, and composition D all showed hypoglycemic effects.
The foregoing is only for the understanding of the method of the present invention and the core idea thereof, and it should be noted that it will be apparent to those skilled in the art that several improvements and modifications can be made to the present invention without departing from the principle of the invention, and these improvements and modifications also fall within the protection scope of the claims of the invention.
Sequence listing
<110> Shanghai sea abstruse biological technology Co., ltd. Hefei Tianhui Anmo incubation technology Co., ltd
<120> an oral hypoglycemic composition
<130> MP21025483
<160> 3
<170> SIPOSequenceListing 1.0
<210> 1
<211> 31
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 1
His Ala Glu Gly Cys Phe Thr Ser Asp Cys Ser Ser Tyr Leu Glu Gly
1 5 10 15
Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Gln His
20 25 30
<210> 2
<211> 36
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 2
His Ala Glu Gly Cys Phe Thr Ser Asp Cys Ser Ser Tyr Leu Glu Gly
1 5 10 15
Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Gln His Ile
20 25 30
Val Val Arg Gly
35
<210> 3
<211> 37
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 3
His Ala Glu Gly Cys Phe Thr Ser Asp Cys Ser Ser Tyr Leu Glu Gly
1 5 10 15
Gln Ala Ala Lys Val Phe Ile Ala Trp Leu Val Lys Gly Gln His Ala
20 25 30
Asp Leu Gln Glu Gly
35

Claims (6)

1. An oral hypoglycemic composition is characterized by comprising GLP-1 analogues, N- (8- (2-hydroxybenzoyl) amino) sodium octoate and fish oil, wherein the amino acid sequence is shown as any one of SEQ ID NO.2 or SEQ ID NO.3, and 5 th cysteine and 10 th cysteine of any one of SEQ ID NO.2 or SEQ ID NO.3 form intramolecular disulfide bonds.
2. The oral hypoglycemic composition according to claim 1, wherein the mass ratio of the GLP-1 analogue, the sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and the fish oil is (10-20): (25-280): (10-200).
3. Use of an oral hypoglycemic composition according to any one of claims 1-2 in the preparation of a medicament for the treatment or prevention of diabetes.
4. A medicament for preventing or treating diabetes mellitus, comprising the oral hypoglycemic composition according to any one of claims 1 to 2.
5. The medicament according to claim 4, further comprising pharmaceutically acceptable excipients and/or pharmaceutical ingredients for the treatment of other diseases without affecting the activity of the GLP-1 analogue.
6. The medicament according to claim 4 or 5, wherein the medicament is in an oral or injectable form.
CN202111177413.3A 2021-10-09 2021-10-09 Oral hypoglycemic composition Active CN115463208B (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN202111177413.3A CN115463208B (en) 2021-10-09 2021-10-09 Oral hypoglycemic composition

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN202111177413.3A CN115463208B (en) 2021-10-09 2021-10-09 Oral hypoglycemic composition

Publications (2)

Publication Number Publication Date
CN115463208A CN115463208A (en) 2022-12-13
CN115463208B true CN115463208B (en) 2023-05-30

Family

ID=84364691

Family Applications (1)

Application Number Title Priority Date Filing Date
CN202111177413.3A Active CN115463208B (en) 2021-10-09 2021-10-09 Oral hypoglycemic composition

Country Status (1)

Country Link
CN (1) CN115463208B (en)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115947821A (en) * 2021-10-09 2023-04-11 合肥天汇生物科技有限公司 GLP-1 analogue

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102015761A (en) * 2007-06-19 2011-04-13 大塚化学株式会社 GLP-1 peptide having sugar chain attached thereto
CN102718858B (en) * 2011-03-29 2014-07-02 天津药物研究院 Glucagon-like peptide-1 (GLP-1) analogue monomer and dimer, preparation method therefor and application thereof
WO2013170636A1 (en) * 2012-05-18 2013-11-21 爱德迪安(北京)生物技术有限公司 Protein and protein conjugate for diabetes treatment, and applications thereof
CN104031141B (en) * 2014-05-30 2016-08-24 天津世传生物科技有限公司 For treating long-acting intestinal hormones polypeptide analog and the application of type 2 diabetes mellitus
CN113117050B (en) * 2021-05-06 2022-04-26 合肥天汇孵化科技有限公司 Polypeptide composition and application thereof
CN113171446B (en) * 2021-05-06 2022-03-29 合肥天汇孵化科技有限公司 Liraglutide compositions and uses thereof

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115947821A (en) * 2021-10-09 2023-04-11 合肥天汇生物科技有限公司 GLP-1 analogue

Also Published As

Publication number Publication date
CN115463208A (en) 2022-12-13

Similar Documents

Publication Publication Date Title
AU2015276203B2 (en) Exendin-4 derivatives as selective glucagon receptor agonists
TWI674271B (en) Novel oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same
US20170360895A1 (en) Long-acting insulin analogue preparations in insoluble and crystalline forms
DiMarchi et al. Preparation of an insulin with improved pharmacokinetics relative to human insulin through consideration of structural homology with insulin-like growth factor I
US20110195896A1 (en) Isoform-specific insulin analogues
EP2389388B1 (en) Treatment for obesity
EP2324853B1 (en) Lixisenatide as add-on to metformin in the treatment of diabetes type 2
CN102718858A (en) Glucagon-like peptide-1 (GLP-1) analogue monomer and dimer, preparation method therefor and application thereof
US20150299286A1 (en) Glutamic acid-stabilized insulin analogues
JP2022507627A (en) Single-chain insulin analog with subsegments of poly-alanine C-domain
KR20150021011A (en) Ultra-concentrated rapid-acting insulin analogue formulations
CN106255701A (en) Can peptide hormone analog that in the past Proglucagon derives
CN115947821B (en) GLP-1 analogues
CN115400205B (en) Oral hypoglycemic composition and application thereof
PL198190B1 (en) Novel insulin analogs with enhanced zinc binding
WO2024012589A1 (en) Polypeptide composition, pharmaceutical, pharmaceutical composition, and use thereof
CN115463208B (en) Oral hypoglycemic composition
JP2023510609A (en) Combination therapy comprising GLP-1 and/or GLP-1 analogues and insulin and/or insulin analogues
CN115960201B (en) GLP-1 analogue and preparation method thereof
CA2044511A1 (en) Pharmaceutical resorption-improved somatostatin compositions, their preparation and use
CN115960202B (en) GLP-1 analogue and preparation method and application thereof
CN115463209A (en) Oral hypoglycemic composition and application thereof
AU2013237740B2 (en) Insulin analogues containing penta-fluora-phenyalanine at position B24
JP2889374B2 (en) Pharmaceutical composition containing somatostatin active polypeptide as active ingredient
Chance et al. Symposium Session II: Hormone Receptor Physiology and Novel Therapeutic Approaches

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
TA01 Transfer of patent application right

Effective date of registration: 20221216

Address after: 200131 4th Floor, Unit 1, Building 5, No. 160, Basheng Road, China (Shanghai) Pilot Free Trade Zone, Pudong New Area, Shanghai

Applicant after: Shanghai Hai'ao Biotechnology Co.,Ltd.

Applicant after: Shandong Haibang Biotechnology Co.,Ltd.

Address before: 200131 4th Floor, Unit 1, Building 5, No. 160, Basheng Road, China (Shanghai) Pilot Free Trade Zone, Shanghai

Applicant before: Shanghai Hai'ao Biotechnology Co.,Ltd.

Applicant before: Hefei Tianhui Anchao Biotechnology Co.,Ltd.

TA01 Transfer of patent application right
GR01 Patent grant
GR01 Patent grant