Disclosure of Invention
In view of the above, the present invention aims to provide an oral hypoglycemic composition. Experiments show that the hypoglycemic composition still has obvious hypoglycemic effect after being orally taken.
In order to achieve the above object, the present invention provides the following technical solutions:
an oral hypoglycemic composition comprising a GLP-1 analogue, sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and fish oil.
In some embodiments, the mass ratio of GLP-1 analog, sodium N- (8- (2-hydroxybenzoyl) amino) caprylate, and fish oil is (10-20): (25-280): (10-200).
In some embodiments, the mass ratio of GLP-1 analog, sodium N- (8- (2-hydroxybenzoyl) amino) caprylate, and fish oil is 10:60: 15. 15:200:60, 10:25:10 or 20:280:200.
In the oral hypoglycemic composition provided by the invention, the GLP-1 analogue is preferably at least one of I) to III):
i) A polypeptide having an amino acid sequence shown in SEQ ID NO.1, wherein the 5 th cysteine and the 10 th cysteine of the sequence shown in SEQ ID NO.1 form intramolecular disulfide bonds; or (b)
II) a polypeptide having the same or similar function as I) obtained by substitution, deletion or addition of one or more amino acids in the polypeptide of I); or (b)
III), a polypeptide having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% homology to the amino acid sequence shown in I) and having the same or similar function as I).
Preferably, the amino acid sequence of the GLP-1 analogue is that 5-6 common amino acids are additionally added at the C end on the basis of the amino acid sequence shown in SEQ ID NO.1, and the 5 th cysteine and the 10 th cysteine of the sequence shown in SEQ ID NO.1 form intramolecular disulfide bonds.
In the specific embodiment of the invention, the amino acid sequence is shown in any one of SEQ ID NO.2-3, and the 5 th cysteine and the 10 th cysteine of the sequence shown in any one of SEQ ID NO.2-3 form intramolecular disulfide bonds;
or at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% homologous to the amino acid sequence shown in any one of SEQ ID No.2 or SEQ ID No.3, and the 5 th and 10 th cysteines of the sequence shown in any one of SEQ ID No.2 or SEQ ID No.3 are cysteines, and the 5 th and 10 th cysteines form intramolecular disulfide bonds.
Experiments show that the GLP-1 analogue provided by the invention has better blood sugar control capability and longer effect compared with the existing product after optimization.
According to the preparation method of the GLP-1 analogue, a linear polypeptide is synthesized according to the amino acid sequence of the GLP-1 analogue by adopting a liquid phase synthesis, solid phase synthesis or solid-liquid combination synthesis process, and then disulfide bonds are formed by oxidation, so that the GLP-1 analogue is obtained.
In the specific embodiment of the invention, the GLP-1 analogue is synthesized by a solid phase synthesis process, the method for purifying the linear polypeptide adopts an HPLC method, and the disulfide bond is formed by oxidizing ammonium bicarbonate or DMSO.
The composition takes a specific GLP-1 analogue as an active ingredient, and reasonably matches the specific GLP-1 analogue with specific components of sodium N- (8- (2-hydroxybenzoyl) amino) octoate and fish oil according to a specific proportion. The blood sugar reducing experiment result shows that the obtained composition has lasting and effective blood sugar reducing effect after oral administration; based on the excellent technical effect, the invention provides application of the composition in preparing a medicament for treating or preventing diabetes.
The invention also provides a medicament for preventing or treating diabetes, which comprises the composition. As a further preferred embodiment it may also comprise pharmaceutically acceptable excipients and/or pharmaceutical ingredients for the treatment of other diseases without affecting the activity of the GLP-1 analogue.
The medicine can be prepared into any clinical dosage form, mainly comprises oral dosage forms or injection dosage forms, wherein the injection dosage forms comprise transfusion forms, and the dosage forms comprise but are not limited to tablets, granules, pills, oral liquid, freeze-dried powder, injection, capsules and microcapsules.
The composition of the invention comprises GLP-1 analogues, sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and fish oil. The composition has high and durable blood glucose reducing effect, can maintain good blood glucose reducing effect when being taken orally, and can be used for developing oral blood glucose reducing medicines.
Detailed Description
The embodiment of the invention discloses an oral hypoglycemic composition, which can be realized by appropriately improving process parameters by a person skilled in the art by referring to the content of the invention. It is expressly noted that all such similar substitutions and modifications will be apparent to those skilled in the art, and are deemed to be included within the present invention. While the oral hypoglycemic composition of the present invention has been described in terms of preferred embodiments, it will be apparent to those skilled in the relevant art that variations and suitable modifications and combinations of the oral hypoglycemic composition described herein can be made and used in the practice of the present invention without departing from the spirit or scope of the invention.
In the invention, in the specific embodiment, the experiment is compared, except for the due differences of each group, other experiment conditions, raw materials, reagents and the like which are not explicitly mentioned are kept consistent, and the comparability of the comparison experiment is ensured.
In the invention, the amino acid sequence shown in SEQ ID NO.1 is as follows:
HAEGCFTSDCSSYLEGQAAKVFIAWLVKGQH。
the GLP-1 analogue provided by the invention is further optimized on the basis of the amino acid sequence shown in SEQ ID NO.1, and the obtained polypeptide has high-efficiency and durable hypoglycemic effect and can be widely used in development of diabetes medicines.
In some embodiments, the GLP-1 analogue provided by the invention is additionally added with 5-6 common 20 amino acids at the C end of the amino acid sequence shown in SEQ ID NO.1, and the 5 th cysteine and the 10 th cysteine form intramolecular disulfide bonds.
In some specific embodiments, the GLP-1 analogue is additionally provided with 5 common amino acids at the C end of the amino acid sequence shown in SEQ ID NO.1, the amino acid sequence of the obtained polypeptide is shown in SEQ ID NO.2, and the 5 th cysteine and the 10 th cysteine form intramolecular disulfide bonds.
SEQ ID NO.2 sequence is as follows:
HAEGCFTSDCSSYLEGQAAKEFIAWLVKGQHIVVRG。
in some embodiments, the amino acid sequence of the GLP-1 analog is as follows:
the broken line represents the intramolecular disulfide bond formed by the two cysteines.
In some specific embodiments, the GLP-1 analogue is additionally provided with 6 common amino acids at the C end of the amino acid sequence shown in SEQ ID NO.1, the amino acid sequence of the obtained polypeptide is shown in SEQ ID NO.3, and the 5 th cysteine and the 10 th cysteine form intramolecular disulfide bonds.
SEQ ID NO.3 sequence is as follows:
HAEGCFTSDCSSYLEGQAAKVFIAWLVKGQHADLQEG。
in some embodiments, the amino acid sequence of the GLP-1 analog is as follows:
the broken line represents the intramolecular disulfide bond formed by the two cysteines.
The following describes a composition for oral hypoglycemic agent provided by the present invention.
EXAMPLE 1 preparation of GLP-1 analog
The solid-phase polypeptide synthesis method by Fmoc strategy was carried out with a polypeptide synthesizer according to the manufacturer's instructions. Sequentially synthesizing according to the amino acid sequence shown in SEQ ID NO.2, removing protecting groups and resin to obtain a GLP-1 analogue intermediate crude product, dissolving the GLP-1 analogue intermediate crude product with water, purifying by adopting a preparative HPLC C8 column, and using acetonitrile/water (V/V) =90: and 10, concentrating and freeze-drying to obtain a pure GLP-1 analogue intermediate product with free sulfhydryl groups. Dissolving a GLP-1 analogue intermediate pure product with water, oxidizing with ammonium bicarbonate or DMSO to form disulfide bonds, purifying to obtain a GLP-1 analogue, wherein the sequence of the GLP-1 analogue is as follows:
the broken line represents the intramolecular disulfide bond formed by the two cysteines.
SEQ ID NO.2:
HAEGCFTSDCSSYLEGQAAKEFIAWLVKGQHIVVRG
EXAMPLE 2 preparation of GLP-1 analog
The solid-phase polypeptide synthesis method by Fmoc strategy was carried out with a polypeptide synthesizer according to the manufacturer's instructions. Sequentially synthesizing according to the amino acid sequence shown in SEQ ID NO.3, removing protecting groups and resin to obtain a GLP-1 analogue intermediate crude product, dissolving the GLP-1 analogue intermediate crude product with water, purifying by adopting a preparative HPLC (high performance liquid chromatography) and a C8 column, and using acetonitrile/water (V/V) =90: and 10, concentrating and freeze-drying to obtain a pure GLP-1 analogue intermediate product with free sulfhydryl groups. Dissolving a GLP-1 analogue intermediate pure product with water, oxidizing with ammonium bicarbonate or DMSO to form disulfide bonds, purifying to obtain a GLP-1 analogue, wherein the sequence of the GLP-1 analogue is as follows:
the broken line represents the intramolecular disulfide bond formed by the two cysteines.
SEQ ID NO.3:
HAEGCFTSDCSSYLEGQAAKVFIAWLVKGQHADLQEG。
EXAMPLE 3 hypoglycemic assay of GLP-1 analog
Grouping:
24 normal mice were divided into 4 groups, 6 groups each, blank group, positive control group, drug 1 group, drug 2 group.
Dosing regimen:
the blank group injection medicine is normal saline;
the positive control group injection medicine is liraglutide;
the injection medicine of the medicine 1 group is GLP-1 analogue prepared in the embodiment 1 of the invention;
the drug 2 group injection drug is GLP-1 analogue prepared in the embodiment 2 of the invention.
Each group of mice was fasted for 12 hours before administration, fasting blood glucose of each group of mice was measured, then 200 μl of physiological saline was injected subcutaneously into the blank group, 200 μl of liraglutide was injected into the positive control group, 200 μl of 0.2mg/ml of the GLP-1 analogue prepared in example 1 of the present invention was injected into the drug 1 group, 200 μl of the GLP-1 analogue prepared in example 2 of the present invention was injected into the drug 2 group, 0.2mg/ml of the GLP-1 analogue prepared in example 2 of the present invention was injected into the drug 2 group, and 200mg of glucose/mouse was infused into the stomach immediately after administration of each group of mice, and 200mg of glucose/mouse was infused into the stomach repeatedly every 12 hours. Sugar tolerance was measured 6 hours, 24 hours and 36 hours after administration, blood glucose levels at 15 minutes, 30 minutes and 60 minutes were measured, and the blood glucose level AUC (mg/dL.min) was calculated. The results are shown in FIG. 1.
The blood sugar measurement method comprises the following steps: a blood glucose meter.
The results of fig. 1 show that:
after 4 hours of administration, the medicine 1 group and the medicine 2 group have the effect of reducing blood sugar;
after 24 hours of administration, the positive control group has no blood glucose reducing effect (the same as the blank group blood glucose reducing effect);
after 36 hours of administration, the drug 1 group and the drug 2 group still have remarkable hypoglycemic effect.
EXAMPLE 4 preparation of the hypoglycemic composition of the invention
(1) Composition A
Table 1 formulation composition
GLP-1 analog prepared in example 1
|
10mg
|
N- (8- (2-hydroxybenzoyl) amino) octanoic acid sodium salt
|
60mg
|
Fish oil
|
15mg |
Preparation method
10mg of the GLP-1 analog prepared in example 1, 60mg of sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and 15mg of fish oil were mixed, and filled into a capsule and coated. Weighing Eudragit L30D, talcum powder and polyethylene glycol, dissolving with dichloromethane and isopropanol to obtain coating solution, and spraying the coating solution onto the surface of capsule to obtain enteric capsule. The flow rate of the coating liquid is 1.0ml/min, the coating temperature is 30 ℃, and the weight of the coating is increased by 5%. Wherein, eudragit L30D: talc powder: polyethylene glycol=9: 1:1 (weight ratio), dichloromethane: isopropanol=10:1 (volume ratio).
(2) Composition B
Table 2 formulation composition
GLP-1 analog prepared in example 1
|
15mg
|
N- (8- (2-hydroxybenzoyl) amino) octanoic acid sodium salt
|
200mg
|
Fish oil
|
60mg |
Preparation method
15mg of the GLP-1 analog prepared in example 1, 200mg of sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and 60mg of fish oil were mixed, and filled into a capsule and coated. Weighing Eudragit L30D, talcum powder and polyethylene glycol, dissolving with dichloromethane and isopropanol to obtain coating solution, and spraying the coating solution onto the surface of capsule to obtain enteric capsule. The flow rate of the coating liquid is 1.0ml/min, the coating temperature is 40 ℃, and the weight of the coating is increased by 10%.
(3) Composition C
Table 3 formulation composition
GLP-1 analog prepared in example 2
|
10mg
|
N- (8- (2-hydroxybenzoyl) amino) octanoic acid sodium salt
|
25mg
|
Fish oil
|
10mg |
Preparation method
10mg of the GLP-1 analog prepared in example 2, 25mg of sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and 10mg of fish oil were mixed, and filled into a capsule and coated. Weighing Eudragit L30D, talcum powder and polyethylene glycol, dissolving with dichloromethane and isopropanol to obtain coating solution, and spraying the coating solution onto the surface of capsule to obtain enteric capsule. The flow rate of the coating liquid is 0.5ml/min, the coating temperature is 35 ℃, and the coating weight is increased by 6%.
(4) Composition D
Table 4 formulation composition
GLP-1 analog prepared in example 2
|
20mg
|
N- (8- (2-hydroxybenzoyl) amino) octanoic acid sodium salt
|
280mg
|
Fish oil
|
200mg |
Preparation method
20mg of the GLP-1 analog prepared in example 2, 280mg of sodium N- (8- (2-hydroxybenzoyl) amino) octoate and 200mg of fish oil were mixed, and filled into a capsule and coated. Weighing Eudragit L30D, talcum powder and polyethylene glycol, dissolving with dichloromethane and isopropanol to obtain coating solution, and spraying the coating solution onto the surface of capsule to obtain enteric capsule. The flow rate of the coating liquid is 0.8ml/min, the coating temperature is 45 ℃, and the weight of the coating is increased by 8%.
Comparative example 1 preparation of composition E (placebo)
TABLE 5
GLP-1 analog prepared in example 2
|
0mg
|
N- (8- (2-hydroxybenzoyl) amino) octanoic acid sodium salt
|
60mg
|
Fish oil
|
15mg |
The preparation method comprises the following steps:
60mg of sodium N- (8- (2-hydroxybenzoyl) amino) caprylate and 15mg of fish oil are mixed, and the mixture is filled into a capsule and coated. Weighing Eudragit L30D, talcum powder and polyethylene glycol, dissolving with dichloromethane and isopropanol to obtain coating solution, and spraying the coating solution onto the surface of capsule to obtain enteric capsule. The flow rate of the coating liquid is 1.5ml/min, the coating temperature is 40 ℃, and the weight gain of the coating is 12%.
EXAMPLE 5 hypoglycemic experiments of oral compositions
Group I:
the healthy beagle dogs are randomly divided into 5 groups, 15 beagle dogs are adopted, the weight of the beagle dogs is 10-12 kg, double cross administration is adopted, each group comprises 6 beagle dogs, the elution period is 1-2 weeks, and the group is (1) group A; (2) group B; (3) group C; (4) group D; group (5) E.
Dosage of administration:
group a oral composition a prepared in example 4;
group B oral composition B prepared in example 4;
group C oral composition C prepared in example 4;
group D oral composition D prepared in example 4;
group E orally administrated composition E prepared in comparative example 1.
Blood glucose monitoring:
each group of animals was fasted overnight for 12 hours, fasting blood glucose was measured, and then each group was orally administered one capsule of the corresponding group. After 30min of administration, each group of animals was given 8g/kg of glucose by gastric lavage. Blood glucose levels were measured for each group of animals at 0h, 0.5h, 1h, and 1.5h, respectively, after glucose administration. Blood glucose was measured using a glucometer. Each blood glucose value on the axis is the average blood glucose value of 6 beagle dogs in the corresponding group at the corresponding time. The experimental results are shown in FIG. 2.
Conclusion:
as can be seen from fig. 2, composition a, composition B, composition C, and composition D all showed hypoglycemic effects.
The foregoing is only for the understanding of the method of the present invention and the core idea thereof, and it should be noted that it will be apparent to those skilled in the art that several improvements and modifications can be made to the present invention without departing from the principle of the invention, and these improvements and modifications also fall within the protection scope of the claims of the invention.
Sequence listing
<110> Shanghai sea abstruse biological technology Co., ltd. Hefei Tianhui Anmo incubation technology Co., ltd
<120> an oral hypoglycemic composition
<130> MP21025483
<160> 3
<170> SIPOSequenceListing 1.0
<210> 1
<211> 31
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 1
His Ala Glu Gly Cys Phe Thr Ser Asp Cys Ser Ser Tyr Leu Glu Gly
1 5 10 15
Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Gln His
20 25 30
<210> 2
<211> 36
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 2
His Ala Glu Gly Cys Phe Thr Ser Asp Cys Ser Ser Tyr Leu Glu Gly
1 5 10 15
Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Gln His Ile
20 25 30
Val Val Arg Gly
35
<210> 3
<211> 37
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 3
His Ala Glu Gly Cys Phe Thr Ser Asp Cys Ser Ser Tyr Leu Glu Gly
1 5 10 15
Gln Ala Ala Lys Val Phe Ile Ala Trp Leu Val Lys Gly Gln His Ala
20 25 30
Asp Leu Gln Glu Gly
35