CN115448986A - Bispecific antibody of novel coronavirus SARS-CoV-2 and application thereof - Google Patents
Bispecific antibody of novel coronavirus SARS-CoV-2 and application thereof Download PDFInfo
- Publication number
- CN115448986A CN115448986A CN202210120487.1A CN202210120487A CN115448986A CN 115448986 A CN115448986 A CN 115448986A CN 202210120487 A CN202210120487 A CN 202210120487A CN 115448986 A CN115448986 A CN 115448986A
- Authority
- CN
- China
- Prior art keywords
- cov
- bispecific antibody
- novel coronavirus
- heavy chain
- sars
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 241001678559 COVID-19 virus Species 0.000 title claims abstract 10
- 241000711573 Coronaviridae Species 0.000 claims abstract description 31
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 25
- 239000003153 chemical reaction reagent Substances 0.000 claims abstract description 6
- 201000010099 disease Diseases 0.000 claims abstract description 6
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 6
- 239000003814 drug Substances 0.000 claims abstract description 6
- 238000002360 preparation method Methods 0.000 claims abstract description 5
- 230000003472 neutralizing effect Effects 0.000 claims description 9
- 102100031673 Corneodesmosin Human genes 0.000 claims description 7
- 101710139375 Corneodesmosin Proteins 0.000 claims description 6
- 101000629318 Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein Proteins 0.000 claims description 3
- 238000003745 diagnosis Methods 0.000 claims 1
- 208000025721 COVID-19 Diseases 0.000 abstract description 4
- 238000013461 design Methods 0.000 abstract description 4
- 208000037847 SARS-CoV-2-infection Diseases 0.000 abstract description 3
- 230000002401 inhibitory effect Effects 0.000 abstract description 2
- 238000011160 research Methods 0.000 abstract description 2
- 229940079593 drug Drugs 0.000 abstract 1
- 238000012216 screening Methods 0.000 description 11
- 108090000623 proteins and genes Proteins 0.000 description 8
- 239000000427 antigen Substances 0.000 description 7
- 108091007433 antigens Proteins 0.000 description 7
- 102000036639 antigens Human genes 0.000 description 7
- 210000004027 cell Anatomy 0.000 description 5
- 239000012634 fragment Substances 0.000 description 5
- 230000005764 inhibitory process Effects 0.000 description 5
- 238000002965 ELISA Methods 0.000 description 4
- 108060001084 Luciferase Proteins 0.000 description 4
- 239000005089 Luciferase Substances 0.000 description 4
- 241000315672 SARS coronavirus Species 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 238000010828 elution Methods 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 238000000034 method Methods 0.000 description 3
- 238000006386 neutralization reaction Methods 0.000 description 3
- 238000002823 phage display Methods 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 2
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 2
- 229940096437 Protein S Drugs 0.000 description 2
- 241001112090 Pseudovirus Species 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000005090 green fluorescent protein Substances 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 238000012917 library technology Methods 0.000 description 2
- 239000007791 liquid phase Substances 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 102000053723 Angiotensin-converting enzyme 2 Human genes 0.000 description 1
- 108090000975 Angiotensin-converting enzyme 2 Proteins 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 241000713869 Moloney murine leukemia virus Species 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 108091005609 SARS-CoV-2 Spike Subunit S1 Proteins 0.000 description 1
- 101710198474 Spike protein Proteins 0.000 description 1
- 239000012505 Superdex™ Substances 0.000 description 1
- 108010031318 Vitronectin Proteins 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 238000010170 biological method Methods 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 230000014509 gene expression Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 210000005087 mononuclear cell Anatomy 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000003908 quality control method Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 239000012089 stop solution Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/005—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies constructed by phage libraries
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/165—Coronaviridae, e.g. avian infectious bronchitis virus
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2469/00—Immunoassays for the detection of microorganisms
- G01N2469/10—Detection of antigens from microorganism in sample from host
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Hematology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Urology & Nephrology (AREA)
- Biophysics (AREA)
- Biomedical Technology (AREA)
- Genetics & Genomics (AREA)
- Pharmacology & Pharmacy (AREA)
- Cell Biology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Tropical Medicine & Parasitology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biotechnology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Microbiology (AREA)
- Communicable Diseases (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention discloses a bispecific antibody of a novel coronavirus SARS-CoV-2 and application thereof, belonging to the technical field of antibody research. The invention designs a bispecific antibody by combining non-overlapping specificities, and provides the bispecific antibody capable of effectively inhibiting SARS-CoV-2 infection, wherein the antibody comprises a first heavy chain and a second heavy chain, and the amino acid sequence of the variable region of the first heavy chain is SEQ ID NO:1 and the variable region amino acid sequence of the second heavy chain is SEQ ID NO:3. the antibody can be applied to the preparation of reagents or medicines for diagnosing or treating diseases caused by the novel coronavirus.
Description
Technical Field
The invention belongs to the technical field of antibody research, and particularly relates to a bispecific antibody of a novel coronavirus SARS-CoV-2 and application thereof.
Background
The phage antibody library technology (phage antibody library) is a new molecular biology technology developed in recent years, and more researchers in recent years use the technology to obtain target antibodies to be applied to various fields such as medical pharmacy, safety detection and the like. The development and application of phage antibody library technology brings great changes to the technical field of antibodies, and greatly promotes the development and application of various genetic engineering antibodies with excellent performance. Obtaining large antibody libraries is a prerequisite for screening to obtain specific antibodies.
The new coronavirus is named severe acute respiratory syndrome coronavirus type 2 (SARS-CoV-2) by the world health organization. The new coronavirus is a novel coronavirus of beta genus, and has envelope, round or elliptical particle, usually polymorphism, and diameter of 60-140nm. The whole genome comparison finds that the homology of the novel coronavirus and severe acute respiratory syndrome virus (SARS-CoV) reaches 70%, and the sequence difference is mainly reflected in a key spike gene (coding S-protein) which acts with a host cell.
The emergence of severe acute respiratory syndrome coronavirus type 2 (SARS-CoV-2) variation threatens the effectiveness of existing vaccines and therapeutic antibodies and emphasizes the need for additional antibody-based tools to effectively neutralize the variant strain by targeting multiple sites of the spike protein. We isolated multiple monoclonal antibodies against SARS-CoV-2 from mononuclear cells (PBMC) from patients with COVID-19. A bispecific antibody is a specific antibody that is made by man and can bind to two different antigens or different sites of the same antigen simultaneously. The natural antibodies targeting two sites on SARS-CoV-2 virus are connected together to prepare a bispecific antibody simultaneously targeting two independent virus sites, which can embody the advantages of cocktail in a single molecule, and more effectively target the treatment resistance caused by the virus variant and block the infection of new coronavirus to human cells, thereby solving the problem.
Disclosure of Invention
The invention designs the bispecific antibody by combining non-overlapping specificities, provides the bispecific antibody which can effectively inhibit SARS-CoV-2 infection, and can be applied to the preparation of reagents or medicaments for diagnosing or treating diseases caused by novel coronaviruses.
In order to achieve the purpose, the invention adopts the technical scheme that:
a bispecific antibody of novel coronavirus SARS-CoV-2, comprising a first heavy chain and a second heavy chain, wherein the variable region amino acid sequence of the first heavy chain is SEQ ID NO:1 and the variable region amino acid sequence of the second heavy chain is SEQ ID NO:3.
further, the bispecific antibody of the novel coronavirus SARS-CoV-2 further comprises a first light chain and a second light chain, wherein the variable region amino acid sequence of the first light chain is SEQ ID NO:2 and the variable region amino acid sequence of the second light chain is SEQ ID NO:4.
further, the variable region of the first heavy chain of the bispecific antibody of the novel coronavirus SARS-CoV-2 recognizes one of amino acid positions Ser447, glu484, val445, gly446 and Lys444 of the RBD domain of the S protein, and the variable region of the second heavy chain recognizes one of amino acid positions Thr333, leu335, glu340, thr345 and Asn440 of the RBD domain of the S protein.
Further, the bispecific antibody of the novel coronavirus SARS-CoV-2 can specifically bind to novel coronavirus SARS-CoV-2S protein.
The application of bispecific antibody of new coronavirus SARS-CoV-2 in preparing reagent or medicine for diagnosing or treating diseases caused by new coronavirus.
Compared with the prior art, the invention has the following beneficial effects:
the invention designs the bispecific antibody by combining non-overlapping specificity, provides the bispecific antibody which can effectively inhibit SARS-CoV-2 infection, has high affinity, can be specifically combined with the novel coronavirus SARS-CoV-2S protein, and can be applied to the preparation of reagents or medicaments for diagnosing or treating diseases caused by the novel coronavirus.
Drawings
FIG. 1 is a graph showing the inhibition curve of specific neutralizing antibodies against SARS-CoV-2, a novel coronavirus of the present invention.
Detailed Description
The technical solutions and effects of the present invention will be further described with reference to the drawings and specific embodiments, but the scope of the present invention is not limited thereto.
Example 1
A bispecific antibody of novel coronavirus SARS-CoV-2, comprising a first heavy chain and a second heavy chain, wherein the variable region amino acid sequence of the first heavy chain is SEQ ID NO:1,
EVQLVQSGGGLVQPGGSLRLSCAASGITVNSNYMSWVRQAPGKGLEWVSIIYSGGSTYYTDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSYGDYYFDYWGQGTLVTVSS;
the variable region amino acid sequence of the second heavy chain is SEQ ID NO:3,
QITLKESGGGLVQTGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGSSWNSGTIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDIRQKYYDISTGYYKYGEQDYGMDVWGQGTLVTVSS。
further, the bispecific antibody of the novel coronavirus SARS-CoV-2 further comprises a first light chain and a second light chain, wherein the variable region amino acid sequence of the first light chain is SEQ ID NO:2,
DIQMTQSPSSLSASVGDRVTITCQASQDIRNYLNWYQQKPGRAPDLLIFDASDLETGVPSRFSGSGSGTDFTFTISSLQPEDIGTYYCQQYGNLPLTFGGGTKVEIK;
the variable region amino acid sequence of the second light chain is SEQ ID NO:4,
QAVLTQPASVSGSPGQSITISCTGTSSDVGAYNYVSWYQHHPGKAPELMIYDVTKRPAGLPNRFSGSKSGNTASLTISGLQAEDEASYYCSSYTTSSTVIFGGGTKLTVL。
the first heavy chain amino acid sequence of the bispecific antibody Fab of the novel coronavirus SARS-CoV-2 is SEQ ID NO:5,
EVQLVQSGGGLVQPGGSLRLSCAASGITVNSNYMSWVRQAPGKGLEWVSIIYSGGSTYYTDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSYGDYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT;
the Fab first light chain amino acid sequence is SEQ ID NO:6,
DIQMTQSPSSLSASVGDRVTITCQASQDIRNYLNWYQQKPGRAPDLLIFDASDLETGVPSRFSGSGSGTDFTFTISSLQPEDIGTYYCQQYGNLPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC;
the second heavy chain amino acid sequence of the Fab is SEQ ID NO:7,
QITLKESGGGLVQTGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGSSWNSGTIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDIRQKYYDISTGYYKYGEQDYGMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT;
the second light chain amino acid sequence of the Fab is SEQ ID NO:8,
QAVLTQPASVSGSPGQSITISCTGTSSDVGAYNYVSWYQHHPGKAPELMIYDVTKRPAGLPNRFSGSKSGNTASLTISGLQAEDEASYYCSSYTTSSTVIFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS。
further, the variable region of the first heavy chain of the bispecific antibody of the novel coronavirus SARS-CoV-2 recognizes one of amino acid positions Ser447, glu484, val445, gly446 and Lys444 of the RBD domain of the S protein, and the variable region of the second heavy chain recognizes one of amino acid positions Thr333, leu335, glu340, thr345 and Asn440 of the RBD domain of the S protein.
Application of bispecific antibody of novel coronavirus SARS-CoV-2 in preparing reagent or medicine for diagnosing or treating diseases caused by novel coronavirus is provided.
Example 2
The preparation method of the bispecific antibody of the novel coronavirus SARS-CoV-2 comprises the following steps:
1. obtaining total RNA/mRNA of immune material
Total RNA was extracted from peripheral blood lymphocytes of convalescent patients infected with the novel coronavirus, and mRNA was further isolated from the RNA (Takara Cat # Z652N/636592, see product Specification for specific experimental procedures).
2. Design of synthetic primers
The primers for the human complete set of antibodies are designed according to the gene sequence information of the human complete set of antibodies provided in the V-BASE website (http:// vbase. Mrc-cpe.cam. Ac.uk /), and are introducedThe material was synthesized by Jinwei Zhi Co. Primers in H 2 Dissolve in O at 100 pmol/. Mu.l and store at-20 ℃.
3. Synthesis of cDNA first chain and amplification of complete set of IgG1 light chain full-length gene and heavy chain variable region gene
Amplifying a component antibody gene library by a two-step method: 1. using the obtained mRNA as a template, performing reverse transcription by using MMLV of Promega to synthesize cDNA (according to the instruction of Promega company, wherein the primer is ThermoCat # N8080127, and the reverse transcriptase is Promega Cat # M1701); 2. the KLC, LLC and VH gene libraries of the module antibodies were amplified by PCR (Takara Cat # RR900A, according to the instructions of the company products) using the cDNA obtained in the first step as template and the primers designed in 2. After gel electrophoresis purification and recovery (using a gel recovery kit of the leveng according to the record operation in the molecular cloning experimental manual), PCR products, namely a KLC fragment, an LLC fragment and a VH fragment are respectively obtained.
4. Construction of Fab phage display libraries
And connecting the target fragment with a vector through T4 ligase to construct a Fab phage display library. Calculating the original library capacity of the constructed Fab phage display phage library to be 1.44 multiplied by 10 according to the number of bacterial clones growing on the LB plate with ampicillin resistance 8 . The results of randomly selecting 10 monoclonals from antibody Fab phage library for sequence determination show that there are 6 different light and heavy chain gene coding sequence combinations with diversity of 60%, i.e. 8.64X 10 7 。
5. Specific antibody screening
Screening antigen specific Fab by liquid phase screening method of SARS-CoV-2 S1 antigen marked by biotin combined with avidin marked magnetic bead adsorption. The antigen concentration of the four rounds of liquid phase screening is 10ug/ml, 1ug/ml and 1ug/ml respectively. Phage collected from the first round of screening elution were only amplified for the second round of screening. Phage collected in the second and third screening elution are not amplified and are directly used in the subsequent screening process.
3. Four rounds of screening, elution of the collected phages, infection of TG1 bacteria, ampicillin plating, 37 ℃ culture overnight. The following day, monoclonal cultures were expanded from each antigen-specific plate and induced overnight with IPTG (final concentration of 1 nM). The culture broth was analyzed for antigen-specific Fab by ELISA. Clones with ELISA readings greater than twice the lowest ELISA reading were scored as positive clones. And selecting a proper number of positive clones for sequencing analysis to obtain a unique amino acid sequence with a high ELISA reading.
6. Screening by neutralization test to obtain SARS-CoV-2 specific neutralizing antibody
The test antibody sample and positive control antibody (Kisrey) were pre-incubated with HRP-RBD to allow binding of neutralizing antibody to HRP-RBD. The mixture was then added to capture plates pre-coated with hACE2 protein. Unbound HRP-RBD and HRP-RBD bound to non-neutralizing antibody will be captured on the plate, while HRP-RBD-neutralizing antibody complex bound to neutralizing antibody is in the supernatant and washed away during the wash. After the washing step was completed, TMB solution was added to turn blue. The stop solution was added and the reaction quenched and turned yellow in color. The plate was read at 450nm and the absorbance of the sample was inversely proportional to the titer of neutralizing antibody against SARS-CoV-2.
Finally, 2 SARS-CoV-2 specific neutralizing antibodies were obtained. Cut-off value (cut-off): signal value inhibition =20% calculation, antibody S82 signal value inhibition 71.4%, EC50 0.03ug/ml; the inhibition rate of the antibody S126 signal value is 58 percent, and the EC50 is 0.02ug/ml.
7. Bispecific antibody expression
Using plasmid containing monoclonal antibody as template, using correspondent restriction enzyme to make enzyme digestion to obtain light chain and heavy chain variable region molecular fragment of antibody, adding N-terminal signal peptide and C-terminal 6 × His Tag by means of conventional molecular biological method, and inserting the molecular fragment into mammalian expression vector pcDNA3.1 (+). Bispecific antibody molecules were generated by transfection of Expi 293F-cell lines, 6 days after transfection, cell supernatants were collected and purified by HiLoad Superdex columns to recover the antibody. All antibodies were subjected to quality control and characterization analysis to assess stability and reproducibility.
8. Neutralization activity was verified in a pseudovirus neutralization assay
A plasmid with a Luciferase (LUC) or Green Fluorescent Protein (GFP) reporter gene and over-expression of ACE2 is constructed, and a 293T cell strain is stably transfected. The antibody was incubated with SARS-CoV-2 pseudovirus at 4-fold serial dilutions for 1 hour at 37 ℃. The mixture was then incubated with 293T cells for 48h; after washing twice with PBS, the cells were lysed. Luciferase activity in the lysates was measured using a luciferase detection system.
The inhibition curve of the bispecific neutralizing antibody of the novel coronavirus SARS-CoV-2 of the invention is shown in FIG. 1. The results show that the half inhibitory concentrations (IC 50) of bispecific antibody against the novel coronavirus WT, variant strains Alpha and Delta are 0.4505 ng/ml, 0.1822 ng/ml and 0.2349 ng/ml, respectively.
Although embodiments of the present invention have been shown and described, it will be appreciated by those skilled in the art that changes, modifications, substitutions and alterations can be made in these embodiments without departing from the principles and spirit of the invention, the scope of which is defined in the appended claims and their equivalents.
Claims (5)
1. A bispecific antibody of novel coronavirus SARS-CoV-2, which comprises a first heavy chain and a second heavy chain, wherein the variable region amino acid sequence of the first heavy chain is SEQ ID NO:1 and the variable region amino acid sequence of the second heavy chain is SEQ ID NO:3.
2. the bispecific antibody against the novel coronavirus SARS-CoV-2 of claim 1, wherein the bispecific antibody against the novel coronavirus SARS-CoV-2 further comprises a first light chain and a second light chain, wherein the variable region amino acid sequence of the first light chain is SEQ ID NO:2 and the variable region amino acid sequence of the second light chain is SEQ ID NO:4.
3. the bispecific antibody against SARS-CoV-2 according to claim 2, wherein the variable region of the first heavy chain of said bispecific antibody against SARS-CoV-2 recognizes one of amino acid positions Ser447, glu484, val445, gly446, lys444 of the RBD domain of the S protein, and the variable region of the second heavy chain recognizes one of amino acid positions Thr333, leu335, glu340, thr345, asn440 of the RBD domain of the S protein.
4. The bispecific antibody against novel coronavirus SARS-CoV-2 according to claim 2, wherein the bispecific antibody against novel coronavirus SARS-CoV-2 is capable of specifically binding to novel coronavirus SARS-CoV-2S protein.
5. Use of a specific neutralizing antibody against the novel coronavirus SARS-CoV-2 according to any one of claims 1 to 4 for the preparation of a reagent or a medicament for the diagnosis or treatment of a disease caused by the novel coronavirus.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202210120487.1A CN115448986A (en) | 2022-02-09 | 2022-02-09 | Bispecific antibody of novel coronavirus SARS-CoV-2 and application thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202210120487.1A CN115448986A (en) | 2022-02-09 | 2022-02-09 | Bispecific antibody of novel coronavirus SARS-CoV-2 and application thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
CN115448986A true CN115448986A (en) | 2022-12-09 |
Family
ID=84296249
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202210120487.1A Pending CN115448986A (en) | 2022-02-09 | 2022-02-09 | Bispecific antibody of novel coronavirus SARS-CoV-2 and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN115448986A (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN117603358A (en) * | 2023-02-24 | 2024-02-27 | 中国科学院微生物研究所 | Bispecific antibody of broad-spectrum novel coronavirus |
-
2022
- 2022-02-09 CN CN202210120487.1A patent/CN115448986A/en active Pending
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN117603358A (en) * | 2023-02-24 | 2024-02-27 | 中国科学院微生物研究所 | Bispecific antibody of broad-spectrum novel coronavirus |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN113264998B (en) | Single-chain antibody of S1 protein on surface of anti-new coronavirus SARS-CoV-2 and application thereof | |
CN111995676B (en) | Monoclonal antibody aiming at non-RBD (radial basis function) region of new coronavirus spike protein and application thereof | |
CN114163523B (en) | Single-domain antibody for novel coronavirus and application thereof | |
Anand et al. | Phage display technique as a tool for diagnosis and antibody selection for coronaviruses | |
CN113336844B (en) | Shark single domain antibody targeting novel coronavirus N protein, and preparation method and application thereof | |
CN111693712A (en) | Method for detecting new coronavirus SARS-CoV-2N protein by adopting aptamer | |
CN113150129A (en) | Single-chain antibody of S2 protein on surface of anti-new coronavirus SARS-CoV-2 and application thereof | |
CN104650195B (en) | EV71 virus VP 1 recombinant antigen and its monoclonal antibody and application | |
WO2008031133A3 (en) | Borrelia antigens | |
CN113354733B (en) | Monoclonal antibody 20D8 for resisting SARS-CoV-2 epidemic mutant strain | |
JP2013508719A5 (en) | ||
CN108892723B (en) | Single-domain heavy chain antibody for detecting porcine epidemic diarrhea virus, preparation method and application | |
Jonsson et al. | Generation of tumour‐necrosis‐factor‐α‐specific affibody 1 molecules capable of blocking receptor binding in vitro | |
CN115448986A (en) | Bispecific antibody of novel coronavirus SARS-CoV-2 and application thereof | |
CN113461810B (en) | Fully human monoclonal antibody for resisting novel coronavirus spike protein and application thereof | |
CN114213532B (en) | Preparation and application of high-affinity anti-chicken infectious bursal disease virus scFv antibody | |
CN114316040B (en) | Fully human monoclonal antibody for resisting novel coronavirus and application thereof | |
CN110903385B (en) | H1N1 influenza virus antibody and preparation method and application thereof | |
Shiakolas et al. | Cross-reactive coronavirus antibodies with diverse epitope specificities and extra-neutralization functions | |
CN103694352B (en) | A kind of anti-CD26 antibody and preparation method thereof | |
CN103724431B (en) | A kind of people source anti-CD 26 antibodies and application thereof | |
CN115710310A (en) | Specific neutralizing antibody of novel coronavirus SARS-CoV-2 and application thereof | |
CN106636105B (en) | The aptamer C203 and its screening technique of staphylococcus aureus enterotoxin C 2 and application | |
Lee et al. | Chicken single-chain variable fragments against the SARS-CoV spike protein | |
WO2022071581A1 (en) | Sars-cov-2-binding peptide |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination |