CN115353565B - Magnetic particle labeled antibody and application thereof - Google Patents

Magnetic particle labeled antibody and application thereof Download PDF

Info

Publication number
CN115353565B
CN115353565B CN202210445210.6A CN202210445210A CN115353565B CN 115353565 B CN115353565 B CN 115353565B CN 202210445210 A CN202210445210 A CN 202210445210A CN 115353565 B CN115353565 B CN 115353565B
Authority
CN
China
Prior art keywords
saa
antibody
monoclonal antibody
magnetic
ser
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
CN202210445210.6A
Other languages
Chinese (zh)
Other versions
CN115353565A (en
Inventor
柳静
詹先发
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Beijing Key Biotechnology Co ltd
Original Assignee
Beijing Key Biotechnology Co ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Beijing Key Biotechnology Co ltd filed Critical Beijing Key Biotechnology Co ltd
Priority to CN202210445210.6A priority Critical patent/CN115353565B/en
Publication of CN115353565A publication Critical patent/CN115353565A/en
Application granted granted Critical
Publication of CN115353565B publication Critical patent/CN115353565B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/543Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
    • G01N33/54313Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals the carrier being characterised by its particulate form
    • G01N33/54326Magnetic particles
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/558Immunoassay; Biospecific binding assay; Materials therefor using diffusion or migration of antigen or antibody
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/577Immunoassay; Biospecific binding assay; Materials therefor involving monoclonal antibodies binding reaction mechanisms characterised by the use of monoclonal antibodies; monoclonal antibodies per se are classified with their corresponding antigens
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/775Apolipopeptides

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Cell Biology (AREA)
  • Biotechnology (AREA)
  • General Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Organic Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The invention relates to magnetic particle labeled antibodies and uses thereof. The invention provides a monoclonal antibody aiming at serum amyloid A, the antibody has strong binding capacity with SAA and good specificity, an SAA immunochromatographic test strip prepared from the antibody to prepare magnetic particles has better lower detection limit and detection specificity, can be used for detecting specific SAA, and has good market application prospect.

Description

Magnetic particle labeled antibody and application thereof
The invention relates to the field of biology, in particular to a monoclonal antibody marked by magnetic particles and application thereof in detection.
Background
Serum Amyloid A (SAA) is a positive acute phase response protein, a heterogeneous class of proteins in the apolipoprotein family, with a relative molecular weight of about 12000.SAA is an acute phase protein and binds to plasma High Density Lipoprotein (HDL).
SAA is a sensitive parameter that begins to rise after about 8 hours of inflammatory response and exceeds the upper limit of the reference range by a time earlier than CRP, whereas CRP differs from the upper limit of the reference range by about a factor of 10 in median values in normal humans. There is only a factor of 5 in SAA. Mild infections, e.g., many viral infections, are more common with elevated SAA than CRP. In infectious diseases, the absolute increase in SAA is higher than CRP, so SAA assays provide better discrimination, especially for "normal" versus minor acute phase reactions. Typically, SAA is elevated in about 2/3 of the cold patients, but CRP is also elevated in less than 1/2 of the patients. In the case of viral infections, elevated concentrations of SAA and CRP are seen in those infected with adenovirus. The reactive forms of SAA and CRP are parallel in the recovery phase of acute infection, which applies to both bacterial and viral infections. Lupus erythematosus and ulcerative colitis SAA did not rise. The metastatic stage of malignant tumors shows higher SAA elevation than the tumor-restricted organ stage. For transplant rejection, SAA detection is a rather sensitive indicator. In a study of one kidney transplant recipient, 97% of rejection was examined as elevated SAA. In the irreversible graft rejection test, the average concentration reaches 690 +/-29 mg/L, while the relevant level of reversible rejection attack cases is 271 +/-31 mg/L. Chronic elevation of SAA concentration in patients with rheumatoid arthritis, tuberculosis or leprosy is a prerequisite for the synthesis of AA-starch fibres, which are also used for the diagnosis of secondary amyloidosis. SAA also has certain auxiliary diagnosis effect on diseases such as transplant rejection, type 2 diabetes, chronic respiratory system diseases and the like.
Common detection methods for SAA include colloidal gold, enzyme linked immunosorbent assay (ELISA), latex-enhanced immunoturbidimetry. The latex enhanced immunoturbidimetry is the most advanced, has higher sensitivity, wider linear range and relatively simple and convenient operation, and is widely adopted in clinic. Research shows that the analysis sensitivity of the latex enhanced immunoturbidimetry is 3.52mg/L; the intra-batch variation coefficient is less than 8%, and the daytime is less than 10%; the anti-interference performance is strong, the hemoglobin is less than or equal to 4.0g/L, the bilirubin is less than or equal to 400 mu mol/L, the rheumatoid factor is less than or equal to 1621U/L, and the triglyceride is less than or equal to 10mmol/L, and the determination is not influenced. Latex-enhanced immunoturbidimetry captures SAA in a test sample using SAA antibodies adsorbed on latex microparticles of several tens to several hundreds of nanometers in diameter, thereby forming cross-links between the microparticles, changing the scattering degree or transmission absorbance (i.e., turbidity) of the solution.
With the development of scientific technology, particularly molecular biology, the antibody preparation technology has revolutionized the development of immunomagnetic particles. The magnetic particles coated with the monoclonal antibody can be specifically combined with a target substance containing a corresponding antigen to form a new complex. When passed through a magnetic field, the complex can be retained and separated from the other components, a process known as immunomagnetic separation. It is a new immunological technique which is a popular research in recent years at home and abroad, and is based on immunology and permeates into various fields such as physiology, pathology, pharmacology, microorganism, biochemistry and molecular genetics. The immunomagnetic separation is simple and easy to implement, has high separation purity, retains the activity of a target substance, is efficient, rapid and low-toxic, and is widely applied to the fields of cell separation and purification, immunodetection, nucleic acid analysis and genetic engineering, targeting drug release carriers and the like.
Magnetic immunoassay technology (Magnetic immunoassay technology Tes, tMICT) marked by Magnetic particles is a Magnetic analysis detection technology developed and produced by combining modern physics and biotechnology and is first applied to the field of basic medicine. Unlike other labeling techniques, one significant advantage of this technique is that labeling with magnetic particles is not disturbed by colored impurities and can be used to directly measure colored samples such as blood, food, sewage, etc. The principle is that superparamagnetic nanometer particle is used as label, and high sensitivity magnetic detecting instrument is used to detect the local magnetic field effect produced by the magnetic particle combined on the immune complex, so as to obtain the quantitative result of the detected analyte. . It is based on the benefits of magnetic particles including magnetic microspheres that the development of magnetic particle-labeled SAA monoclonal antibodies for the detection of SAA is becoming urgent, and particularly the development of high affinity SAA monoclonal antibodies is of great importance.
Disclosure of Invention
The invention overcomes the defects of the prior art and provides an improved monoclonal antibody aiming at SAA and application thereof.
In one aspect, the present invention provides a monoclonal antibody 3C5 against SAA, having a heavy chain variable region sequence as set forth in SEQ ID NO:1, and the following steps:
<xnotran> EVQLEESATELARPGASVKLSCKASGYIFSWDVCVWIKQRPGQGLEWIGIEQSMLTSRWCHYATWGKATLTADKSSSTAYMQLSSLASEDSAVYYCAGSGNYRTVWGLGTTLAVSS, SEQ ID NO: </xnotran> 2, as shown in the figure:
Figure BDA0003615367150000031
in another aspect of the present invention, the monoclonal antibody is preferably prepared by using ascites as a method for preparing ascites, and the method for preparing ascites is not particularly limited in the present invention and may be prepared by using a conventional method in the art. The monoclonal antibody of the invention has specific reaction with SAA, which shows that the monoclonal antibody has good specificity; can be used as the antibody of the SAA detection test strip.
In some embodiments, an antibody or fragment thereof (e.g., an anti-SAA antibody provided herein) specifically binds to a target (SAA) with a binding constant of at least 10 -9 M or greater binding constant. In some embodiments, an antibody (e.g., a monoclonal antibody), or fragment thereof, has an equilibrium constant (Kd) of 10nM or less, e.g., 9nM or less, 8.1nM or less, 8nM or less, 7nM or less, 6nM or less, 6.5nM or less, 6.3nM or less, 5nM or less, 4.3nM or less, 4nM or less, 3nM or less, 2nM or less, 5nM or less, 4nM or less, 3nM or less, or 1.2nM or less. For example, the antibody or fragment thereof binds to a target, e.g., GPC1, with a binding affinity of at least about 0.1X 106 -8 M, at least about 0.3X 10 -8 M, at least about 0.5X 10 -8 M, at least about 0.75X 10 -8 M, at least about 0X 10 -8 M, at least about 3X 10 -8 M is at least about 5X 10 -8 M, or at least about 2.0X 10 -8 M, at least about 2.5X 10 -8 At least about 3.0 x10 -8 At least about 3.5X 10 -8 At least about 4.0X 10 -8 At least about 4.5X 10 -8 At least about 5.0 x10 -8 M, at least about 1X 10 -9 M, at least about 3X 10 -9 M, at least about 5X 10 -9 M, at least about 2X10 -9 M, at least about 3X 10 -9 M, at least about 4X 10 -9 M, at least about 4.3X 10 -9 M, at least about 5X 10 -9 M, at least about 6X 10 -9 M, at least about 6.3X 10 -9 M, at least about 6.9X 10 0.9 M, at least about 7X 10 -9 M, at least about 8X 10 -9 M, at least about 8.1X 10 -9 M, or at least about 10X 10 -9 In certain embodiments, the specific binding agent that binds to the target has a dissociation constant (Kd) of<100nM,<10nM,<9nM,<8nM,<7nM,<6.9nM,<6.5nM,<6.3nM,<5nM,<4nM,<4.5nM,<3nM,<2nM,<1.5nM,<1nM,<0.1nM,<0.01nM or<0.001nM (e.g.,<10nM,<9nM,<8nM,<7nM,<6.9nM,<6.5nM,<6.3nM,<5nM,<4nM,<4.5nM,<3nM,<2nM,<1.5nM,<1nM,<0.1nM,<0.01nM or<0.001nM)。10 -8 M or less, e.g. 10 -8 M to 10 -13 M, e.g. 10 -9 M to 10 -13 In one embodiment, kd is measured by a radiolabeled antigen binding assay (RIA) performed with the Fab version of the antibody of interest and its antigen.
In some embodiments, the VH domain of the monoclonal antibody has an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, identical to SEQ ID NO 1% or greater than 99%; and/or the amino acid sequence of the VL domain of the monoclonal antibody is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID No. 2. In certain non-limiting embodiments, the sequence of the VH domain of the monoclonal antibody comprises the composition of SEQ ID NO. 1, and/or the sequence of the VL domain of the monoclonal antibody comprises the composition of SEQ ID NO. 2.
Further, the antibody may be conjugated to a detectable label; for example, a detectable label detectable by ELISA, spectrophotometry, flow cytometry, microscopy or diagnostic imaging techniques (e.g., computed Tomography (CT), computed Axial Tomography (CAT) scan, magnetic Resonance Imaging (MRI), magnetic resonance imaging (NMRI), magnetic resonance tomography (MTR), ultrasound, fiber optics and laparoscopy). Specific, non-limiting examples of detectable labels include fluorophores, chemiluminescent agents, enzymatic linkages, radioisotopes, and heavy metals or compounds (e.g., superparamagnetic iron oxide nanocrystals for MRI detection). For example, useful detectable labels include fluorescent compounds, including fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-1-naphthalenesulfonyl chloride, phycoerythrin, lanthanide phosphors, and the like. Bioluminescent markers are also useful, such as luciferase, green Fluorescent Protein (GFP) and Yellow Fluorescent Protein (YFP). The antibody or antigen-binding fragment may also be conjugated to an enzyme that can be used for detection, such as horseradish peroxidase, -galactosidase, luciferase, alkaline phosphatase, glucose oxidase, and the like. When the antibody or antigen-binding fragment is conjugated to a detectable enzyme, it may be detected by the addition of an additional reagent for the enzyme to produce a reaction product that can be recognized. For example, when the reagent horseradish peroxidase is present, the addition of hydrogen peroxide and diaminobenzidine results in a colored reaction product that is visually detectable. The antibody or antigen binding fragment may also be conjugated to biotin and detected by indirect measurement of avidin or streptavidin binding. It should be noted that the avidin itself may be conjugated to an enzyme or fluorescent label.
Further, the invention provides application of the SAA monoclonal antibody in preparation of a test strip for detecting SAA.
The invention also provides a test strip for rapidly detecting SAA, which comprises a detection line and a quality control line;
the preparation method of the detection line comprises the steps of spraying the monoclonal antibody on a nitrocellulose membrane;
the preparation method of the quality control line comprises the step of spraying the goat anti-mouse IgG antibody on the nitrocellulose membrane.
The structure of the test strip is not particularly limited, and preferably includes a test strip structure conventional in the art.
The invention also provides magnetic particle detection test paper for rapidly detecting the SAA, which comprises the following components that are sequentially stuck on a back plate from left to right: sample pad, magnetic particle pad, nitrocellulose membrane and absorbent paper.
Advantageous effects
The invention provides a monoclonal antibody aiming at serum amyloid A, the antibody has strong binding capacity with SAA and good specificity, an SAA immunochromatographic test strip prepared from the antibody to prepare magnetic particles has better lower detection limit and detection specificity, can be used for detecting specific SAA, and has good market application prospect.
Drawings
FIG. 1 is a graph showing the results of the surface charge conditions of magnetic particles before and after coupling
Detailed Description
In order to more clearly illustrate the embodiments of the present invention or the technical solutions in the prior art, the drawings used in the description of the embodiments or the prior art will be briefly described below, and it is obvious that the drawings in the following description are some embodiments of the present invention, and other drawings can be obtained by those skilled in the art without creative efforts.
EXAMPLE 1 preparation of monoclonal antibodies
Experimental animals BALB/C (SPF) female 10 mice, 6-8 weeks old, weight 18-22g. Serum amyloid A (cat # SX01146, shanghai Ningning Yongda Co., ltd.) was used as the immunizing antigen. Antigen 80. Mu.g/mouse was first immunized. 40 μ g/mouse was used as a booster. Antigen emulsification: preparing 0.01M PBS buffer solution with pH7.2PBS, and requiring sterility; if the particles are deposited on the bottom of the tube before emulsification, the emulsification should be carried out after ultrasonic pulverization, and two 5ml syringes are used for respectively sucking up the same amount of the PBS buffer solution containing the antigen and Freund's adjuvant. The disposable converter is connected with the injector, and the push-pull operation is repeated for 30-60min. The complete emulsification standard is that the emulsion is not dispersed in water after being dropped into the water, namely the emulsification is successful. Immune site: multiple injections can be performed at the same part in the process of preparing the antibody, or a multi-part combined method can be used for immunization, but subcutaneous injection is recommended for the first immunization, and intraperitoneal injection can be used for boosting the immunization. First immunization: the total amount injected per mouse was 0.4ml (80. Mu.g antigen/mouse). And (3) boosting immunity: the total amount of 0.2ml (40. Mu.g antigen/mouse) per mouse was injected, and the antibody peak in vivo was observed approximately 10 to 15 days after the first immunization of the mice, and the subsequent booster immunization was selected to be performed within 2 weeks of the first immunization. ELISA for detecting the serum titer of the mice: preheating the tail of the mouse in water at 37-40 deg.C for about 5min, subtracting the tip part of the mouse of about 1cm, and squeezing the blood along the tail of the mouse by hand into an EP tube. The blood was left at room temperature for 1h and then at 4 ℃ overnight. The next day, the ELISA measured the mouse serum titers, of which 7 mouse sera showed titers of polyclonal antibodies that exceeded 1. The best 3 mice were selected and re-immunized 3 days before the fusion experiment at a dose of 100. Mu.g/mouse. Mice with acceptable titer were selected by indirect ELISA.
NS-1 was selected as the hybrid myeloma cell and was in the logarithmic growth phase prior to the fusion procedure to satisfy the conditions suitable for fusion. On the day of fusion, NS-1 cells were collected, centrifuged at 1000rpm for 5min, and the supernatant was discarded. Adding pure culture medium, washing once, centrifuging under the above conditions, discarding supernatant, and resuspending in a certain amount of pure culture medium for fusion operation.
Mice were sacrificed and disinfected in 75% alcohol. The abdominal skin and peritoneum were cut open and the spleen was removed. Connective tissue and fat were washed in 10ml1640 dishes with medium alone. The spleen was gently squeezed by the inner core of the syringe and blown into a single cell suspension. Filtered through a copper mesh, 1000rpm, centrifuged for 5min. The medium alone was washed 1-2 times and resuspended in 10ml1640 medium alone.
Mouse NS-1 cells: splenocytes =1, gently mixed at this ratio, centrifuged at 1000rpm for 5min. The whole supernatant in the tube was discarded (ensuring the concentration of PEG 4000) and placed in a 37 ℃ water bath, where 1ml of 50% PEG4000 was added to a 50ml centrifuge 1-well tube and slowly agitated for 1 minute. 1ml of 371640 ℃ medium was added within 1 min. 10ml of 1640 medium was added over 2min, and centrifuged at 800rpm for 5min, and the supernatant was discarded. The cells were resuspended in HAT medium, plated in 96-well plates, and cultured in feeder cells in a CO2 incubator. The preparation method of the feeder cells comprises the following steps: mice were sacrificed and disinfected, abdominal skin was excised, and peritoneum was exposed. Lifting the peritoneum of the mouse by using surgical forceps, cutting a small opening, sucking a certain amount of 1640 pure culture medium, sucking the medium in the abdominal cavity of the mouse for several times, putting the medium into a centrifugal tube, centrifuging and counting. A96-well plate requires 2X104 feeder cells per well and is cultured in a 37 ℃ incubator.
5 days after the fusion, half-liquid HAT medium was changed. HAT medium was replaced with HT at day 8. Thereafter, the cells were cultured in 1640 complete medium. When the hybridoma cells grow to more than 1/8 of the bottom of the dish, the titer of the cell supernatant is detected by an indirect ELISA method, and positive wells are determined. Preparing hybridoma cells with qualified titer into cell suspension, diluting the cell suspension according to a certain proportion after counting the cells until each milliliter contains 10 hybridoma cells, laying a 96-hole culture plate, and culturing in a CO2 incubator at 37 ℃; individual hybridoma cell culture wells were selected and labeled. ELISA detects the titer of the antibody of the cell supernatant to obtain positive holes, 7 hybridoma cell strains capable of stably expressing the monoclonal antibody are finally obtained by screening through 2 times of subclone screening, and 2A4 and 3C5 with the best positive effects are selected for producing ascites.
SPF-grade BALB/C mice were 3 mice each, and the abdomen of the mice was first inoculated with Freund's incomplete adjuvant, each 0.3ml. After 10 days, hybridoma cells 2A4 and 3C5 in the logarithmic growth phase were collected and prepared into cell suspensions having a concentration of 106 cells/ml, respectively. Hybridoma cells were injected intraperitoneally at 0.3 ml/cell. Observing the growth condition of the ascites. If the abdomen is enlarged, ascites of the mouse can be extracted, and the ascites after mixing the ascites corresponding to each hybridoma is directly detected by ELISA, and the results are shown in Table 1.
TABLE 1 ELISA test results
Dilution factor 2A4 ascites 3C5 ascites
1:2000 1.532 1.418
1:5000 0.923 0.902
1:10000 0.574 0.539
1:20000 0.264 0.233
1:40000 0.132 0.109
As can be seen from the results in Table 1, the ascites effect of each hybridoma reached 1. The remaining ascites was centrifuged at 2000rpm for 5min. Taking the supernatant, purifying to obtain the 2A4 and 3C5 monoclonal antibodies, and respectively subpackaging at-80 ℃ for storage.
EXAMPLE 2 characterization of the C5 monoclonal antibody
The affinity constant for the monoclonal antibody was measured using a biosensor IAsysPlus manufactured by AffinitySensors corporation. The sample cell was pretreated with carboxymethyl dextran (CMD), different concentrations of SAA protein were added to the sample cell, and after 5min the free carboxyl groups were blocked with ethanolamine for 3min. Then, free and non-specifically bound protein molecules are washed away with 1mol/L formic acid. And (4) placing the sample pool coated with the SAA into a biosensor, and balancing for 10min. Baseline 50. Mu.l of 0.01mol/L PBS, pH7.2, was added and a stable baseline was established after 5min. Association (asso-association) PBS was aspirated, 45. Mu.l PBS and 5. Mu.l monoclonal antibody were added, and the monoclonal antibody solution was aspirated when the monoclonal antibody was saturated. Dissociation (dissociation) 50. Mu.l PBS was added and the monoclonal antibody binding and dissociation were equilibrated. Regeneration (regeneration) 20mmol/LHCl 50. Mu.l were allowed to act for 2min to completely elute bound mAb. Return to baseline PBS was changed and returned to baseline again, i.e. the next 1 cycle was started. Diluting each monoclonal antibody to 5 different concentrations by PBS, sequentially and respectively measuring the binding rate and the dissociation rate of each concentration monoclonal antibody and the envelope antigen, and calculating the affinity constant of each monoclonal antibody through special software FASTpit attached randomly. The results are shown in Table 2.
TABLE 2 affinity constants of antibodies
Name of antibody Affinity constants (nM)
3C5 monoclonal antibody 0.64±0.03
As can be seen from the results in Table 2, the 3C5 monoclonal antibody has better affinity and binding ability.
The subclass of the monoclonal antibody was identified using a mouse antibody subclass identification kit. ELISA plate coated antigen, 50 ul/hole, placed at 4 degrees C overnight. The supernatant was discarded, 200 ul/well of blocking solution was added, and the mixture was incubated at 37 ℃ for 1 hour. Washing with the washing solution for 3 times, and adding 3C5 monoclonal antibody into 9 different wells, 50 ul/well, and setting multiple wells. Positive controls were added to well 10 and incubated at 37 ℃ for l hours. The liquid was removed and the wash washed 3 times. Normal rabbit serum was added to well 1, specific antibodies against immunoglobulin class or subclass of rabbit were added to wells 2-9, respectively, positive control wells were added with rabbit anti-mouse IgGl antibody, 50 ul/well, and incubated at 37 ℃ for 1 hour. The liquid was removed and the wash washed 3 times. HRP-goat anti-rabbit lgG antibody was added at 50 ul/well and incubated at 37 ℃ for l h. The liquid was removed and the wash washed 3 times. TMB color development solution was added at 50 ul/well. Developing at room temperature for 5min, adding 100ul stop solution to terminate the reaction, measuring OD value at 450nm, recording and judging the result. The results showed that the 3C5 monoclonal antibody was of the IgM subtype and the light chain was of the kappa chain.
And extracting total RNA of the hybridoma cells by using the kit, and performing reverse transcription to synthesize cDNA. Designing primers, amplifying heavy chains and light chains, sequencing, analyzing sequencing results by software, and obtaining a monoclonal light and heavy chain sequence through sequence identification, wherein the heavy chain variable region sequence is shown as SEQ ID NO:1, and the following components:
<xnotran> EVQLEESATELARPGASVKLSCKASGYIFSWDVCVWIKQRPGQGLEWIGIEQSMLTSRWCHYATWGKATLTADKSSSTAYMQLSSLASEDSAVYYCAGSGNYRTVWGLGTTLAVSS, SEQ ID NO: </xnotran> 2, as shown in the figure:
Figure BDA0003615367150000081
example 3 specific identification of C5 monoclonal antibody
The specificity identification adopts a Western blot method: performing SDS-PAGE on SAA, BSA, AFP and beta globulin, transferring the gel protein to a nitrocellulose membrane after electrification, sequentially reacting with 3C5 and HRP-goat anti-mouse IgG, then performing DAB color development, performing cross reactivity detection, and adopting indirect ELISA.
Western blot identification results show that the 3C5 monoclonal antibody can recognize an SAA band with the Mr of about 12KD, which indicates that the SAA band is combined with the target SAA protein; and has no cross reaction with BSA, AFP, beta globulin and the like. The indirect ELISA method is used for determining that the 3C5 monoclonal antibody has no binding reaction with other proteins, and has better specificity.
Example 4 preparation of magnetic microparticle SAA Immunochromatographic test strip
1. Preparation of SAA paramagnetic microparticles:
magnetic particles were purchased from sienna millennium biotechnology limited, cat #: 82023 and 150nm in diameter.
1) Aspirating 200. Mu.L (2 mg) of magnetic microparticles, rinsing 3 times with 500. Mu.L of 10mmol/L MES buffer, pH5.5, wash buffer containing 0.05% Tween-20, adding freshly prepared EDC and NHS, respectively, at a concentration of 5mg/mL, and performing a rotary activation reaction at 37 ℃ for 4h; after activation, unreacted activating agent was removed by washing twice with MES buffer.
2) Washing the activated magnetic particles twice with 0.005M of pH9.0 BS coupling buffer (0.95 g of sodium tetraborate powder is weighed and dissolved in 50mL of pure water, 8mL is mixed with 2mL of 0.05M boric acid buffer, the pH is adjusted to 9.0 with 0.1M NaOH, then diluted 40 times, the pH is adjusted to 9.0 with 0.1M NaOH, and the magnetic particles are washed twice with 500. Mu.L of coupling buffer); adding 475 mul of coupling buffer solution to resuspend the washed magnetic particles, adding 25 mul of 3C5 monoclonal antibody of 150 mug, contacting the activated hydroxyl on the surface of the magnetic particles with the amino of the antibody, reacting for 3 hours at 37 ℃, and coupling the antibody on the surface of the magnetic particles to obtain the immune magnetic particles.
3) After removing supernatant by magnetic separation and adsorption of magnetic particles, adding 1mL of coupling buffer solution containing a blocking agent (0.25 g of skimmed milk powder and 10mL of 0.005M BS coupling buffer solution), and blocking at 37 ℃ overnight; 4) After the blocked magnetic microparticles were washed 4 times with the coupling buffer, they were stored in 500. Mu.L of an appropriate storage buffer (0.1 g BSA and 5mg Tween-20 were added to 10mL 0.005M BS coupling buffer, 0.01% NaN3 was added, and they were stored in a refrigerator at 4 ℃ until use. The content of the coupled magnetic particle antibodies is analyzed by a BCA protein quantitative detection kit, and the result shows that the amount of the coupled antibodies per milligram of the magnetic particle surface is 39.8 mu g, so that the coupling amount is better.
The measurement of the ZETA potential is sometimes referred to as a "charge" measurement and is used to evaluate the electrostatic force stabilization effect of the dispersion. And measuring the potentials of the magnetic particle stock solution and the coupled immune magnetic particles ZETA by using a high-performance nano-particle size analyzer at the temperature of 25 ℃. The results are shown in FIG. 1.
FIG. 1 shows the surface charge of magnetic particles before and after coupling. Carboxyl groups on the surface of the magnetic particles enable the magnetic particles to have negative charges (-7.94 +/-0.88) mV, after the antibody is coupled, the carboxyl groups are combined with amino groups of the antibody, the number of the carboxyl groups is reduced, and the surface charge amount of the immunized magnetic particles is reduced (-2.97 +/-0.43) mV. Since the reduction of the surface charge amount is not favorable for the stability of the magnetic particles, the total amount of the negative charges on the surface of the magnetic particles is increased, and the pH of the immune magnetic particle preservation solution is set to 9.0, so that the stability of the immune magnetic particles is improved.
2. Preparation of test paper strip
1) Sample pad pretreatment: the glass cellulose membrane cut to an appropriate size was completely immersed in a sample pad treatment solution (0.01 mol/L PBS, pH7.4, 0.5% BSA,0.5% Triton X-100) for 4 hours and then naturally dried at room temperature.
2) Preparation of magnetic particle bonding pad: and taking a proper amount of prepared monoclonal antibody-labeled magnetic particles, sucking the proper amount of magnetic particles by using a pipette gun, spotting the magnetic particles on the bonding pad, and ventilating and drying at room temperature for 5 hours.
3) Preparing an NC film: commercially available SAA monoclonal antibody (Shanghai Yu Bo Biotech Co., ltd., product No. MAA885Hu 22) diluted to a concentration of 1mg/mL and commercially available goat anti-mouse secondary antibody were sprayed onto the corresponding positions of the NC membrane with a film dispenser at a rate of 1. Mu.L/cm, respectively, to obtain a detection T-line and a quality control C-line.
4) Assembling the immunochromatography test strip: and sequentially sticking the prepared sample pad, the bonding pad, the NC membrane and the water absorption pad on the PVC back plate, overlapping the adjacent pad parts, cutting the assembled pad parts into test strips with the width of 3mm by using a test strip cutting machine, and putting the test strips into a sealing bag containing a drying agent for storage at 4 ℃.
Test sensitivity test of the test strip:
determination of detection sensitivity: the SAA standard antigen is diluted in human normal serum with the concentration range of 0-1000ng/mL. The constructed test strip is used for detecting serum samples of 0, 0.1ng/mL, 1ng/mL, 10ng/mL, 100ng/mL and 1000ng/mL respectively, and a magnetic intensity detector (MAR) is used for analyzing the relation between T/C and sample concentration after 15 minutes. The sensitivity of the test strip quantitative detection is the lowest concentration deviating from the test strip background signal, namely the quantitative detection sensitivity of the SAA detection calculated by adding 3 times of standard deviation to the T/C average value of the blank sample is 0.16ng/mL.
And (3) specific identification: the prepared SAA, CEA, BSA, AFP and HCG standard solutions are dropwise added onto a test strip, the detection result is observed after 15 minutes, the result shows that only the standard solution containing the SAA shows a positive result, and the rest are negative, as shown in Table 3, the detection system has higher specificity.
TABLE 3 test strip Cross-reactivity
Detection of antigens The result of the detection
SAA +
CEA -
BSA -
AFP -
HCG -
+ indicates positive and-negative.
It is to be understood that the invention is not necessarily limited in its application to the details of construction and the arrangement of components set forth in the following description and/or illustrated in the drawings. The invention is capable of embodiments in addition to those described and of being practiced or carried out in various ways. Also, it is to be understood that the phraseology and terminology employed herein, as well as the abstract, are for the purpose of description and should not be regarded as limiting.
As such, those skilled in the art will appreciate that the conception, upon which this disclosure is based, may readily be utilized as a basis for the designing of other structures, methods and systems for carrying out the several purposes of the present invention. It is important, therefore, that the claims be regarded as including such equivalent constructions insofar as they do not depart from the spirit and scope of the present invention.
While the invention has been described and exemplified in detail sufficient to enable those skilled in the art to make and use it, various alternatives, modifications, and improvements should be apparent without departing from the spirit and scope of the invention. The examples provided herein represent preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention. Modifications thereof and other uses will occur to those skilled in the art. Such modifications are encompassed within the spirit of the invention and are defined by the scope of the claims.
Sequence listing
<110> Beijing Ke Ji Zhong-Ji Biotechnology Co., ltd
<120> magnetic particle-labeled antibody and use thereof
<160> 2
<170> SIPOSequenceListing 1.0
<210> 1
<211> 116
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 1
Glu Val Gln Leu Glu Glu Ser Ala Thr Glu Leu Ala Arg Pro Gly Ala
1 5 10 15
Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Ile Phe Ser Trp Asp
20 25 30
Val Cys Val Trp Ile Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45
Gly Ile Glu Gln Ser Met Leu Thr Ser Arg Trp Cys His Tyr Ala Thr
50 55 60
Trp Gly Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr
65 70 75 80
Met Gln Leu Ser Ser Leu Ala Ser Glu Asp Ser Ala Val Tyr Tyr Cys
85 90 95
Ala Gly Ser Gly Asn Tyr Arg Thr Val Trp Gly Leu Gly Thr Thr Leu
100 105 110
Ala Val Ser Ser
115
<210> 2
<211> 108
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 2
Asp Ile Val Ile Thr Gln Arg Pro Ala Leu Met Ala Ala Ser Pro Gly
1 5 10 15
Glu Lys Val Thr Ile Thr Cys Thr His Asn Thr Val Lys Ser Asn Arg
20 25 30
Ser Trp Gly Trp Tyr Gln Gln Lys Ser Gly Ile Ser Pro Lys Pro Trp
35 40 45
Ile Tyr Pro Gln Glu Ala Glu Arg Leu Gly Val Pro Ala Arg Phe Ser
50 55 60
Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Thr Ser Met Glu
65 70 75 80
Ala Glu Asp Ala Ala Thr Tyr Tyr Cys Gly Ile Ser Met Ser Cys Tyr
85 90 95
Lys Val Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys
100 105

Claims (3)

1. A monoclonal antibody 3C5 directed against SAA, characterized in that: the heavy chain variable region sequence is shown as SEQ ID NO:1 is shown in the specification; the light chain variable region sequence is shown as SEQ ID NO:2, respectively.
2. Use of the monoclonal antibody 3C5 of claim 1 in the preparation of a magnetic microparticle labeled SAA detection kit.
3. Use according to claim 2, characterized in that the kit contains a magnetic microparticle-labelled antibody.
CN202210445210.6A 2022-04-26 2022-04-26 Magnetic particle labeled antibody and application thereof Active CN115353565B (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN202210445210.6A CN115353565B (en) 2022-04-26 2022-04-26 Magnetic particle labeled antibody and application thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN202210445210.6A CN115353565B (en) 2022-04-26 2022-04-26 Magnetic particle labeled antibody and application thereof

Publications (2)

Publication Number Publication Date
CN115353565A CN115353565A (en) 2022-11-18
CN115353565B true CN115353565B (en) 2023-03-10

Family

ID=84030764

Family Applications (1)

Application Number Title Priority Date Filing Date
CN202210445210.6A Active CN115353565B (en) 2022-04-26 2022-04-26 Magnetic particle labeled antibody and application thereof

Country Status (1)

Country Link
CN (1) CN115353565B (en)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105372434A (en) * 2015-08-13 2016-03-02 浙江卓运生物科技有限公司 Detection kit for human serum amyloid A protein
CN106124768A (en) * 2016-06-13 2016-11-16 南京普朗医疗设备有限公司 A kind of step homogeneous SAA detection kit and preparation and application thereof
CN107015004A (en) * 2017-03-21 2017-08-04 深圳市汇松科技发展有限公司 A kind of serum amyloid A protein determines kit and preparation method thereof
CN108169219A (en) * 2018-01-15 2018-06-15 浙江艾明德生物科技有限公司 A kind of kit and preparation method for quantitatively detecting serum amyloid A protein
CN110484512A (en) * 2019-08-12 2019-11-22 杭州伊佰新生物技术有限公司 Secrete hybridoma cell strain and its application of human serum amyloid A monoclonal antibody

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105628932A (en) * 2016-02-01 2016-06-01 苏州东尼生物技术有限公司 SAA (serum amyloid A) immunochromatographic test strip and preparation method and test method thereof
CN105785038A (en) * 2016-03-31 2016-07-20 广州市微米生物科技有限公司 Double detection line SAA (Serum amyloid A protein) immunofluorescence chromatography quantitative detection reagent and preparation method thereof
CN109503713B (en) * 2017-09-15 2020-04-28 德赛诊断系统(上海)有限公司 Anti-human SAA monoclonal antibody and preparation method and application thereof

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105372434A (en) * 2015-08-13 2016-03-02 浙江卓运生物科技有限公司 Detection kit for human serum amyloid A protein
CN106124768A (en) * 2016-06-13 2016-11-16 南京普朗医疗设备有限公司 A kind of step homogeneous SAA detection kit and preparation and application thereof
CN107015004A (en) * 2017-03-21 2017-08-04 深圳市汇松科技发展有限公司 A kind of serum amyloid A protein determines kit and preparation method thereof
CN108169219A (en) * 2018-01-15 2018-06-15 浙江艾明德生物科技有限公司 A kind of kit and preparation method for quantitatively detecting serum amyloid A protein
CN110484512A (en) * 2019-08-12 2019-11-22 杭州伊佰新生物技术有限公司 Secrete hybridoma cell strain and its application of human serum amyloid A monoclonal antibody

Also Published As

Publication number Publication date
CN115353565A (en) 2022-11-18

Similar Documents

Publication Publication Date Title
JP5807300B2 (en) Method and reagent for measuring C-reactive protein in sample
CN114539401B (en) Magnetic particle marking method and detection kit
US5500348A (en) Basophil-binding monoclonal antibody, method for separation of basophils, method for chemical mediator release from basophils, and method for testing release of basophil-derived chemical mediators
US6331402B1 (en) Reduction of interference of immunoassays by substances derived from the framework regions of antibodies
CN109112113B (en) Anti-human IgG monoclonal antibody, hybridoma cell strain, kit and application thereof
CN115353565B (en) Magnetic particle labeled antibody and application thereof
JP7022198B2 (en) Reagent kit, measurement kit and measurement method
CN109280644B (en) Anti-human IgG monoclonal antibody, hybridoma cell strain and application thereof
CN114989297B (en) Kit comprising horseradish peroxidase-labeled antibody
CN108588030B (en) Anti-human IgM monoclonal antibody, hybridoma cell strain and application thereof
CN114891103B (en) Calprotectin monoclonal antibody and kit
EP2707720A2 (en) Diagnosis and prognosis of triple negative breast and ovarian cancer
CN114736295A (en) Horseradish peroxidase labeled antibody and preparation method thereof
CN114560936A (en) Fluorescent microsphere marking method and detection kit
CN108517316B (en) Anti-human IgM monoclonal antibody, hybridoma cell strain and application thereof
CN111217910B (en) Monoclonal antibody pair and application thereof in detecting myeloperoxidase protein
CN109266620B (en) Anti-human IgG monoclonal antibody, hybridoma cell strain and application thereof
WO1997008549A1 (en) Method for detecting kidney diseases, diagnostic drug therefor, and diagnostic kit therefor
CN117607463B (en) EGFR (epidermal growth factor receptor) immune chromogenic detection reagent for circulating tumor cells
EP4342908A1 (en) Chimeric immunoglobulin
CN117607441B (en) Circulating tumor cell TROP-2 immune chromogenic detection reagent
CN116535511B (en) Immunohistochemical antibody for detecting PD-L1 and application thereof
CN118515772A (en) Anti-biotin monoclonal antibody, preparation method and application thereof
CN109055319B (en) Anti- C reactive protein monoclonal antibody, its hybridoma cell strain and application
US20150355170A1 (en) Compositions, systems and methods that detect and/or remove cross-reactive antibodies from a biological sample

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
CB02 Change of applicant information

Address after: 100000 Room 1788, 1st Floor, Building 1, No. 9 Xinghuo Road, Fengtai District, Beijing

Applicant after: BEIJING KEY-BIOTECHNOLOGY Co.,Ltd.

Address before: 100000 Room 308, block a, yard 18, Wangyuan Road, Fengtai District, Beijing

Applicant before: BEIJING KEY-BIOTECHNOLOGY Co.,Ltd.

CB02 Change of applicant information
GR01 Patent grant
GR01 Patent grant