CN115109161A

CN115109161A - Weight-losing pharmaceutical composition containing mesenchymal stem cells

Info

Publication number: CN115109161A
Application number: CN202210747385.2A
Authority: CN
Inventors: 曹立烜; 熊建勋
Original assignee: Beijing Renli Jinghe Biotechnology Co ltd
Current assignee: Guangdong Cel Biotechnology Co ltd
Priority date: 2022-06-28
Filing date: 2022-06-28
Publication date: 2022-09-27
Anticipated expiration: 2042-06-28
Also published as: CN115109161B

Abstract

The invention relates to a weight-losing pharmaceutical composition containing mesenchymal stem cells. The invention develops a specific monoclonal antibody aiming at DPP4, the antibody can have the effects of promoting proliferation and resisting apoptosis on pancreatic beta cells, and the monoclonal antibody can be used together with adipose-derived mesenchymal stem cells to further enhance the weight-losing effect and the blood sugar-reducing effect of obese mice, so that the monoclonal antibody has better application prospect and application value.

Description

Weight-losing pharmaceutical composition containing mesenchymal stem cells

Technical Field

The application relates to the field of biology, in particular to a weight-losing pharmaceutical composition containing mesenchymal stem cells.

Background

With the development of economy in China and the improvement of living standard of people, the dietary structure and the living style of people are greatly changed from the original 'inadaptation' to the current 'wantonly eating', and the staple food on the dining table is changed from 'light' to 'greasy', so that a plurality of problems are brought to the health of residents for a long time, wherein the morbidity and mortality of chronic diseases are on an obviously rising trend. Obesity, characterized by excessive fat extrusion and/or abnormal distribution in the body, was listed as an international disease classification list (ICD code E66) as early as 1948. Obesity presents a health hazard to humans characterized by progressive and persistent damage. The treatment of obesity has no advanced medical means and no long-term effective method.

It is found that obesity is always accompanied by a chronic low-grade inflammation, the visceral adipose tissues of obese people can release a large amount of inflammatory factors, including some chemokines such as CCL2, CCL5 and IP-10, and there are many reports that the serum of obese people contains more IGF-1, estradiol, IL-1, IL-6, IL-8, tumor necrosis factor TNF, leptin and inflammatory response factors. Therefore, if the excessive activation of signal regulation networks such as certain cytokines or chemokines caused by obesity can be effectively reduced or blocked, the effect of obesity on promoting the development of tumors can be greatly delayed.

The accumulation of white adipose tissue in adipose tissue is related to insulin resistance, dyslipidemia, diabetes, cardiovascular diseases; on the contrary, brown adipose tissue has the most prominent physiological functions of consuming energy, generating heat and playing an important role in regulating body temperature, and is similar to the brown adipose tissue. White fat cells and brown fat cells have common precursor cells, and the improvement of the differentiation of the brown fat cells and the reduction of the differentiation of the white fat cells can increase energy consumption, contribute to weight loss, and provide a new treatment way for metabolic disorders such as diabetes, hypertension and the like. Therefore, adipose tissue is a complex endocrine organ, obesity causes the change of the level of secreted fat factors and the impaired regulation of the fat factors and is closely related to the occurrence and the development of metabolic syndrome, and the adipose tissue influences the whole process of the occurrence and the development of the metabolic syndrome through the fat factors and the fat metabolism. The cytokines secreted by the fat cells mainly comprise leptin, adiponectin, visfatin, chemotaxin and the like; in addition, adipocytes express on their surface a variety of receptors that mediate their differentiation, maturation, metabolism, and apoptosis, and known major receptors include insulin receptor, leptin receptor, tumor necrosis factor alpha receptor, peroxisome proliferator-activated receptor (PPAR), adrenoceptor, adrenocorticoid receptor, and the like.

At present, the medicines for treating obesity mainly comprise an appetite inhibitor and a digestive absorption retarder according to the action mechanism, and other medicines comprise a hypoglycemic medicine, a metabolic stimulant, a local fat decomposition agent and the like. Appetite suppressants act on the central nervous system and are an important class of weight-loss drugs. Appetite is regulated by the satiety center on the medial side of the hypothalamus and the feeding center on the lateral area of the hypothalamus, and the central enhancement or inhibition of regulation of feeding function is primarily through changes in catecholamine neurotransmitters such as norepinephrine, dopamine, 5-Hydroxytryptamine (HT), and the like. One of the representative medicines is amphetamine and analogues thereof, including methamphetamine, benzyltolylpropylamine, amfepramone, dextroamphetamine and the like, and the action mechanism of the amphetamine is to block reuptake of nerve endings to noradrenaline, promote central release of the noradrenaline and increase the noradrenaline content in synaptic cleft so as to generate the action of pseudonoradrenaline. The principal representative drug for digestive absorption blockers is Orlistat (Orlistat), which is Xenike (xeniel), which is currently the only non-centrally acting antiobesity drug approved by the FDA in the United states and has been approved for marketing by the FDA in 1999. After 2 years, CFDA was also approved for marketing in china. Orlistat is a potent and selective gastrointestinal lipase inhibitor, and its action mechanism is to reduce the decomposition and absorption of fat in food by inhibiting pancreatin and lipase in gastrointestinal tract. At therapeutic doses, combined with a diet with low calorie content, fat absorption is reduced by approximately 30%, and this inhibition results in a negative energy balance of 200kcal, resulting in weight loss. The alpha-glucosidase inhibitor takes acarbose as an example, and the acarbose reduces the decomposition of polysaccharide by competitively inhibiting the activity of the alpha-glucosidase on the brush edge of epithelial cells of small intestine, delays the absorption of glucose by the intestinal tract after meal, has the function of obviously reducing the blood sugar after meal, relieves the stimulation of overhigh blood sugar after meal to beta cells of insulin, increases the insulin sensitivity and improves IR. The metabolism stimulant comprises a central stimulant and a hormone, and the drugs have more adverse reactions and are limited in clinical application. The mechanism of action is mainly through increasing metabolic rate, increasing thermogenesis and promoting lipolysis. It has been found that agents that stimulate the beta adrenergic receptor promote lipolysis in human adipocytes, whereas agents that stimulate the alpha 2 adrenergic receptor inhibit lipolysis: the beta adrenergic agonist and the alpha 2 adrenergic antagonist are suggested to mobilize local adipose tissues so as to achieve the purpose of losing weight. The efficacy of these therapeutic agents is yet to be further improved.

The DPP4 is a newly discovered adipokine, which is expressed on the surface of various cells and is also dissolved in serum, recent researches show that the occurrence of obesity is accompanied by the increase of serum DPP4, and the DPP4 plays a role in remarkably promoting the development of obesity and obesity-related metabolic syndrome. In liver disease research, the DPP4 concentration in serum of patients with viral hepatitis, liver cirrhosis and liver cancer is obviously increased, while active DPP4 in liver cancer tissues of patients shows abnormal shapes, including distortion complex type and deletion type. Accordingly, it is speculated that in the process of promoting the occurrence and development of tumors by obesity, the activity of serum DPP4 may be increased, and a series of biological effects are exerted to promote the occurrence and development of cancers; however, whether the function of the inhibitor is to promote the process of tumor generation and development or play a natural inhibitory effect is not known at present.

DPP4 inhibitor has become a new generation of hypoglycemic agents, and has been widely accepted by clinicians in recent years for the treatment of type II diabetes; the use of the DPP4 inhibitor Sitagliptin (Sitagliptin) was first approved by the Food and Drug Administration (FDA) in 2006. Generally, after a human body eats, the small intestine can release Glucagon-like peptide-1 (GLP-1) and Gastric Inhibitory Peptide (GIP) into the blood, and the hormones can regulate the synthesis and secretion of insulin and the release of Glucagon (Glucagon) into the study by sensing blood sugar, thereby forming a more complex mechanism for negative feedback regulation of blood sugar; since glucagon-like peptide-1 and pepstatin are generally very short half-lives in the blood and are inactivated by cleavage with DPP4, they do not produce a long lasting effect in promoting insulin secretion and regulating blood glucose; the DPP4 inhibitor slows down the inactivation of the DPP4 to glucagon-like peptide-1 and gastric inhibitory peptide, so that the concentration of glucagon-like peptide-1 and gastric inhibitory peptide in blood is increased to generate the ability of increasing serum insulin, and simultaneously, the release of glucagon is inhibited, thereby achieving the effect of reducing the blood sugar of patients with type II diabetes. At present, 5DPP4 inhibitors are available on the market, including the more commonly used sitagliptin, vildagliptin and the like.

However, at present, the number of types of domestic inhibitors developed for DPP4 is not sufficient, and the number of alternative forms is not sufficient, and therefore, there is an urgent need for the development of new drugs.

Disclosure of Invention

The invention overcomes the defects of the prior art and provides a medicinal composition for losing weight.

Specifically, the invention provides a weight-losing pharmaceutical composition containing adipose-derived mesenchymal stem cells and a DPP4 inhibitor.

Further, the DPP4 inhibitor is a monoclonal antibody specific for DPP 4.

Further, the monoclonal antibody to DPP4 is 7E 13. The amino acid sequence of the variable region of the light chain of the antibody is shown as SEQ ID NO. 1:

the amino acid sequence of the heavy chain variable region is shown as SEQ ID NO. 2:

further, the invention also provides application of the monoclonal antibody of the DPP4 in preparing a pharmaceutical composition for losing weight.

Further, the invention also provides application of the monoclonal antibody of the DPP4 in preparing a pharmaceutical composition for losing weight, wherein a second therapeutic agent can be further added for increasing the effect of losing weight.

Further, the invention also provides application of the monoclonal antibody of the DPP4 and adipose-derived mesenchymal stem cells in preparation of a pharmaceutical composition for losing weight.

Further, the invention also provides application of the monoclonal antibody of the DPP4 and adipose-derived mesenchymal stem cells in preparing a weight-losing pharmaceutical composition for treating diabetes and obesity.

Furthermore, the pharmaceutical composition of the invention also comprises a pharmaceutically acceptable carrier.

The pharmaceutical composition further comprises one or more agents selected from the group consisting of anti-obesity agents, appetite suppressants, diacylglycerol acyltransferase (DGAT) inhibitors, lipase inhibitors and type II diabetes agents.

Further, exemplary NSAIDs include, but are not limited to, aceclofenac, acemetacin, acetaminophen, acetanilide, acetylsalicylic acid, alclofenac, minoprofen, aminopyridine, aminopiroxicam, amitocetidine, antipyrine, apalone, aspirin, azinazine, benzoate, benzoxaprofen, bromfenac, butoxygenic acid, carprofen, celecoxib, choline magnesium trisalicylate, cetriline, clofenac, lonicin, clofenamic acid, cobiroxib, D-indobufen, dapsone, dabrafilon, dexketoprofen, diclofenac, difluoromethanesulfonic acid, dipyranone, droxicam, etodolac, ethylpolyxib, cyanamide, fenbufen, fipronil, fenzatecan, fenzaticoat, flurazone, flutriazone, flufenamic acid, flubenprolide, fipronil, fifuracil, furacil, heteroaryl acetic acid derivatives, bufenon, ibuprofen, indomethacin, indoprofen, isobutylphenylpropionic acid, isoxeptatriene, isoxicam, ketoprofen, ketorolac, licofelone, lomoxicam, loxoprofen, lumiracoxib, meclofen, meclofenamate, meclofenamic acid, mefenamic acid, meloxicam, methyl salicylate, milofine, mofebiazole, nabumetone, naproxen sodium, niflumic acid, nimesulide, salzine, enolic acid, oxicam derivatives, oxicam acid, oxibutoxib, p-aminophenol derivatives, parecoxib, phenacetin, phenylbutazone, piroxicam, pivoxib, podophyllotoxin derivatives, pranoprofen, prolene, proglumin, propionic acid derivatives, pyrazolone derivatives, salicylic acid salts, salicylate, salicylic acid, salicylate, meclofenamate sodium, sudoxicam, sulfadiazine, sulindac, suprofen, tenoxicam, tiaprofenic acid, tiafenamic acid, thiasaprofen, tialoxide, tolfenamic acid, tolmetin, valdecoxib, zaltoprofen, zidoxine, zomepirac, a pharmacological salt thereof, a hydrate thereof, and a solvate thereof.

Further, the pharmaceutical composition can be made into injection, tablet, capsule, granule, oral preparation, etc.

In certain embodiments, the pharmaceutical compositions of the present invention are released over a time interval of from about 2 to about 12 hours, or from about 1 to about 24 hours. Alternatively, the release may be in about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10 hours, about 11 hours, or about 12 hours. In other embodiments, the active agent is released within about 5 to about 8 hours after administration.

In some embodiments, the pharmaceutical compositions of the present invention are prepared as sustained release formulations comprising an active core comprised of one or more inert particles, each in the form of beads, granules, pellets, particles, microcapsules, microspheres, microparticles, nanocapsules or nanospheres coated on their surface with a drug, for example, in the form of a drug-containing coating or film-forming composition using, for example, fluidized bed techniques or other methods known to those skilled in the art. The inert particle may be of various sizes as long as it is large enough to remain poorly soluble. Alternatively, the active core may be prepared by granulating and milling a polymer composition containing the drug substance and/or by extrusion and spheronization.

The pharmaceutical compositions of the present invention may be incorporated into inert carriers by techniques known to those skilled in the art, such as drug layering, powder coating, extrusion spheronization, roller compaction or granulation. The amount of drug in the drug core will depend on the desired dosage and will generally vary from about 5 to 90% by weight. Typically, the polymer coating on the active core will be about 1-50% based on the weight of the coated particle, depending on the desired lag time and/or the polymer and coating solvent selected. One skilled in the art can select the appropriate amount of drug to coat on or incorporate into the core to achieve the desired dosage. In one embodiment, the passive core may be a sugar sphere or a buffer crystal or an encapsulated buffer crystal, such as calcium carbonate, sodium bicarbonate, fumaric acid, tartaric acid, and the like.

In some embodiments, the release agent of the present invention comprises a polymer that controls release by dissolution controlled release. In a particular embodiment, the drug is incorporated into a matrix comprising insoluble polymer and drug particles or particles coated with polymeric material of varying thickness. The polymeric material may comprise a lipid barrier comprising waxy materials such as camel wax, beeswax, spermaceti wax, candelilla wax, SHALAVAC wax, cocoa butter, cetostearyl alcohol, partially hydrogenated vegetable oils, waxes, paraffins, waxes, myristyl alcohol, stearyl alcohol, cetyl alcohol and stearic acid, and surfactants such as polyoxyethylene sorbitan monooleate. When contacted with an aqueous medium, such as a biological fluid, the polymer coating emulsifies or erodes after a predetermined lag time depending on the thickness of the polymer coating. The lag time is independent of gastrointestinal motility, pH or gastric retention. In some embodiments, the sustained release formulation is in the form of an orally disintegrating tablet, powder or liquid suspension. However, the active agent or agents are present in the coated particles or embedded in particles that slowly release the active agent over a desired period of time.

Advantageous effects

The invention develops a specific monoclonal antibody aiming at DPP4, the antibody can have the effects of promoting proliferation and resisting apoptosis on pancreatic beta cells, and the monoclonal antibody can be used together with adipose-derived mesenchymal stem cells to further enhance the weight-losing effect and the blood sugar-reducing effect of obese mice, so that the monoclonal antibody has better application prospect and application value.

Drawings

FIG. 1 is a graph showing the result of identifying the specificity of an antibody

FIG. 2 Western blot identification of monoclonal antibodies

FIG. 3 Effect of monoclonal antibodies on pancreatic islet beta cell proliferation

FIG. 4 Effect of monoclonal antibodies on early apoptosis of islet beta cells

Detailed Description

In order to more clearly illustrate the embodiments of the present invention or the technical solutions in the prior art, the drawings used in the description of the embodiments or the prior art will be briefly described below, and it is obvious that the drawings in the following description are some embodiments of the present invention, and other drawings can be obtained by those skilled in the art without creative efforts.

EXAMPLE 1 preparation of DPP4 monoclonal antibody

Animal immunization: mixing 1mg/ml dipeptidyl peptidase IV (DPP4) recombinant protein (cargo number: FS-D3371, Shanghai Sheng's actual industry Co., Ltd.) with an equal volume of complete Freund's adjuvant, immunizing 3 BALB/c mice with 0.2 ml/mouse, completely mixing an immunogen with an equal volume of Freund's incomplete adjuvant after two weeks, strengthening the immunity, taking blood from the tail vein, detecting antibody titer by using an indirect ELISA method, and selecting the 2 # mouse with higher titer for abdominal cavity impact immunization after 2 weeks. After 3 days of mouse treatment after the face impact immunization, splenocytes were taken for cell fusion and screening of hybridoma cells: fusing splenocytes of immunized mice and SP2/0 cells by PEG method, and adding 5% CO ₂ And cultured at 37 ℃. And (2) performing antibody detection on the cell culture supernatant by using an indirect ELISA method on the 9 th day after fusion, selecting hybridoma cells with high antibody titer to perform subcloning by using a limiting dilution method until all antibody detections of wells with cell growth are positive and OD (value A) is similar after the subcloning, transferring the hybridoma cells stably secreting the antibody into a 24-well plate to perform amplification culture, and obtaining two better hybridoma cells which obtain the stable antibody secretion, wherein the hybridoma cells are named as 2C9 and 7E13, and the antibody titers of the cell culture supernatant detected by the ELISA method are respectively 1: 20000 (strain 2C 9) and 1: 40000 (strain 7E 13).

Production and purification of ascites antibody: 2C9 and 7E13 hybridoma cells were intraperitoneally injected with BALB/C mice, 2X10, respectively ⁶ And (3) after 10 days, the abdomen of the mouse rises, ascites is extracted by puncture of a living body, the monoclonal antibody is primarily purified by a protein A affinity chromatography method, and the titer of the antibody is identified by an ELISA method. The titer of the two purified antibodies respectively reaches 10 ⁶ 。

Monoclonal antibody specificity determination: and adding an antibody diluted by 1:4000 into an enzyme label plate coated with immunogen DPP4 recombinant protein, BSA, normal mouse serum and escherichia coli lysate. Negative and blank control wells were also set. The microplate reader measures A450 nm. P/N [ (a dilution of the purified antibody A450 nm-blank A450 nm)/(the negative control A450 nm-blank A450nm) ] > 2.1 is positive. The results are shown in FIG. 1.

As can be seen from the specificity identification results of the ELISA system shown in FIG. 1, the P/N values of the two monoclonal antibodies against DPP4 protein are both greater than 2.1, and the two monoclonal antibodies are positive, and the detection results against other substances are negative, which indicates that the system can specifically detect the target antigen protein.

Identification of monoclonal antibody IgG subclasses: the hybridoma cell supernatant was added to the recombinant protein-coated microplate, 50. mu.l/well and incubated at 37 ℃ for 1 h. Diluted IgG typing secondary antibody was added 50. mu.l/well and incubated at 37 ℃ for 1 h. Goat anti-mouse HRP (1: 5000) was added at 50. mu.l/well and incubated at 37 ℃ for 1 h. Finally adding TMB for color development, and measuring A450nm by a microplate reader. High-value wells are of the antibody subclass. The results are shown in Table 1.

TABLE 1 antibody subtype identification

As can be seen from the results in table 1, 2C9 mab was of the IgG1 subtype, 7E13 mab was of the IgG2a subtype, and both were kappa chains.

Example 2 specific identification of DPP4 monoclonal antibody 7E13

And (3) identifying the specificity of the monoclonal antibody: and taking the recombinant DPP4 protein and a control protein to perform SDS-PAGE electrophoresis. After the electrophoresis, transfer electrophoresis was performed to transfer the protein band to a Nitrocellulose (NC) membrane. After the transfer printing is finished, the NC membrane is put into a human monoclonal antibody solution, the temperature is kept for lh at 37 ℃, then the NC membrane is soaked in a goat anti-mouse IgG solution marked by human HRP, the temperature is kept for lh at 37 ℃, ECL (extracellular matrix) hypersensitive luminescent solution acts for 3min, and the image is exposed and developed in a dark room. The results are shown in FIG. 2.

As can be seen from the results in FIG. 2, the 7E13 monoclonal antibody prepared by the invention has better ability to specifically bind to DPP 4.

Example 3DPP4 monoclonal antibody 7E13 affinity and sequence identification

The affinity of monoclonal antibody 7E13 was determined using fortebio. Specifically, the antibody affinity is determined by a method of capturing the Fc region of the antibody using a capture antibody biological probe for the Fc region of an anti-mouse antibody. Antibodies were diluted to 4. mu.g/mL in PBS buffer and passed over the AHC probe surface for 120 s. DPP4 recombinant protein was used as mobile phase at concentrations of 1, 5, 10, 15, 30, 45 and 60nM, respectively. The binding time was 100s and the dissociation time was 300 s. After the experiment, blank control response values were deducted, and the software was run for 1: 1Langmuir binding mode is fitted, and the dissociation constant KD value of antigen-antibody binding is 2.59nM, so that the antibody has better affinity.

Reverse transcribing the total RNA of the hybridoma cells into cDNA; amplifying antibody light chain variable region IgVL (kappa) and heavy chain variable region VH sequences by using degenerate primers and a Phusion kit; purifying PCR amplification products by using a gel recovery kit; connecting the amplified PCR product to a T vector according to the specification of the T vector cloning kit, converting escherichia coli competent cells, amplifying strains, extracting plasmids, and then performing DNA sequencing to obtain a variable region sequence of the monoclonal antibody. The sequencing result shows that the amino acid sequence of the light chain variable region of the DPP4 monoclonal antibody 7E13 is shown in SEQ ID NO.1, and the sequence of the heavy chain variable region is shown in SEQ ID NO. 2.

Example 4 Effect of DPP4 monoclonal antibody 7E13 on pancreatic islet beta cell proliferation

Mouse pancreatic beta cell line Min6 (cat # C0883, Shanghai Guanguan bioengineering Co., Ltd.) was cultured in RPMI-1640 medium containing 10% FBS (11.1 mmol/L glucose) at 37 ℃ with 5% CO ₂ And (4) growing under the environment. When the cell fusion degree reaches 80-90%, the culture solution is discarded, 0.25% of pancreatin is added, digestion is carried out for about 30s at 37 ℃, human 10% FBS culture medium is added to neutralize the pancreatin, and digestion is stopped. Gently blowing and beating cells by using a pipette to form a single cell suspension, sucking the cell suspension, centrifuging for 5min at 1000 rpm, discarding supernatant, and resuspending a culture medium in a ratio of 1:3 ratio in the culture flask amplification culture, every 2d change culture fluid. LPS lipopolysaccharide was able to induce an inflammatory response of pancreatic islet beta cells, and lipopolysaccharide was used as an inducer in the following experiments.

Grouping experiments: a blank control group,Lipopolysaccharide group (1. mu.g/mL), 7E13 monoclonal antibody group (10. mu.g/mL), positive control group (lipopolysaccharide (1. mu.g/mL) + sitagliptin (10. mu.g/mL)), synergistic experimental group: 7E13 mAb 10. mu.g/mL + lipopolysaccharide (1. mu.g/mL). And (3) detecting cell proliferation by a CCK-8 colorimetric method: inoculating cells in logarithmic growth phase to 96-well plate, treating the cells with different intervention reagents according to experimental groups after the cells are completely attached to the wall, and continuing to treat the cells at 37 ℃ and 5% CO ₂ The cells were incubated in the environment for 96h, followed by addition of 1O. mu.l CCK-8 reagent per well and incubation at 37 ℃ for 2h, followed by detection of absorbance at 450nm using a microplate reader.

As can be seen from the results of fig. 3, the high-concentration lipopolysaccharide group significantly inhibited the proliferation of Min6 cells, compared to the control group; after the 7E13 monoclonal antibody is independently acted with the Min6 cell, compared with a blank control, the proliferation of the Min6 cell can be obviously promoted; compared with the control group, the lipopolysaccharide +7E13 monoclonal antibody synergistic experiment group and the positive control group lipopolysaccharide + sitagliptin group show the proliferation promoting effect on Min6 cells compared with the lipopolysaccharide group alone, and the difference has statistical significance (P < 0.05). Moreover, the OD value of the lipopolysaccharide +7E13 monoclonal antibody synergistic experimental group reaches (0.77 +/-0.04), and is obviously improved compared with that of the lipopolysaccharide group (0.53 +/-0.04).

Example 5 Effect of DPP4 monoclonal antibody 7E13 on early apoptosis of islet beta cells

Annexin v (annexin v)/propidium iodide (propidium iodide) staining flow cytometry to detect apoptosis: and (3) inoculating the human islet beta cells in the logarithmic growth phase to a 6-well plate until the cells are completely attached to the wall. Grouping and drug treatment the same as example 4, after 96h, trypsinizing after 24h, collecting all cells, centrifuging at 1000 rpm for 10min, discarding the culture medium, rinsing with PBS, and preparing into 1 × 10 ⁵ Adding annexin V-FITC into the single cell suspension per ml, incubating for 10min at room temperature, adding 20 mu g/ml PI after rinsing, and detecting the early apoptosis condition of the cells (annexin V +/PI-cell group) by a flow cytometer. The results are shown in FIG. 4.

As shown in fig. 4, the difference of the lipopolysaccharide group apoptosis rate is significantly higher than that of the control group, which is statistically significant (P < 0.05). After the 7E13 monoclonal antibody is used for treatment, the apoptosis rate is reduced relative to a blank control group, the positive control group, the 7E13 monoclonal antibody and lipopolysaccharide group have obvious effect of reducing the apoptosis rate relative to a single lipopolysaccharide treatment group, and the apoptosis rate of the 7E13 monoclonal antibody and lipopolysaccharide group is only (8.04 +/-0.02)%.

Example 6 Effect of DPP4 monoclonal antibody 7E13 on IL-6 expression in pancreatic islet beta cells

RT-PCR detection of interleukin 6(IL-6) mRNA expression: and (3) inoculating human islet beta cells in a logarithmic growth phase into a 6-well plate, grouping according to the same manner as in example 5, treating with a medicament for 96 hours, extracting total RNA of the cells, detecting the concentration by an enzyme-labeling instrument, and performing reverse transcription according to the kit instructions to synthesize cDNA. Housekeeping gene GAPDH was used as a control. A10 ul PCR reaction system was established, and 1 uL of cDNA template was added with 0.5 uL of each primer, and GAPDH gene was selected as the reference, and the experimental conditions were 95 ℃ for 10min, 58 ℃ for 20s, and 72 ℃ for 30s, for 30 cycles. The specific primer is an IL-6 upstream primer: AAATTCGGTACATCCTCGAC, downstream primer: CAGGAACTGGATCAGGACTT, respectively; GAPDH is used as an internal reference gene, and an upstream primer: AGCCACATCGCTCAGACAC; a downstream primer: GCCCAATACGACCAAATCC are provided. After IL-6 and GAPDH were amplified, the gel was electrophoresed in agarose gel, and the electrophoresed band was observed in a UV transilluminator and photographed. IL-6mRNA levels were expressed as the ratio of the optical density of the IL-6 to GAPDH bands. The results are shown in Table 1.

TABLE 1 IL-6mRNA levels (IL-6/GAPDH) for each group

Each group of	IL-6/GAPDH
		Blank control group	0.004±0.001
Lipopolysaccharide group	1.527±0.120
		7E13 monoclonal antibody group	0.502±0.007
Positive control group	0.530±0.063
		7E13 monoclonal antibody and lipopolysaccharide test group	0.357±0.019

The results of RT-PCR detection of IL-6mRNA show that: the expression level of IL-6mRNA in the LPS lipopolysaccharide group cells is higher than that in a blank control group; the 7E13 monoclonal antibody group, the positive control group and the 7E13 monoclonal antibody and lipopolysaccharide experimental group are obviously lower than the LPS group; compared with a blank control group, the positive control group and the 7E13 monoclonal antibody and lipopolysaccharide experimental group still have the advantages that the expression level of IL-6mRNA is increased, the difference has statistical significance, but the expression level is obviously reduced compared with that of an LPS group, and particularly the expression level of the 7E13 monoclonal antibody and lipopolysaccharide experimental group is reduced more obviously.

The appropriate increase of islet IL-6 is probably the physiological need of maintaining the function of islet beta cells, and is a protection mechanism for resisting the injury of islet beta cells by other inflammatory factors, and sitagliptin and the 7E13 monoclonal antibody of the invention are both used as DPP4 inhibitors, and can realize the anti-inflammatory protection effect on islet beta cells by interfering LPS to activate NF-kB pathway and reduce IL-6 expression.

Example 7 preparation of adipose-derived mesenchymal stem cells

Human subcutaneous adipose tissue samples were provided by the Beijing cooperative Hospital and signed informed consent with the patients. Placing adipose tissue without blood vessel and fascia in a plate, washing with PBS for 3 times, cutting, adding 2 times volume of collagenase I, digesting at 37 deg.C for 60min, filtering on cell sieve after digestion is stopped, centrifuging at 1500r/min for 5min, collecting cells, and centrifuging at 2x10 ⁵ The cells/mL of the culture medium were inoculated in a culture flask and placed at 37 ℃ in 5% CO ₂ The culture is carried out in a saturated humidity incubator, and the liquid is changed for 1 time in 12d according to the adherent condition of the cell. Until the cell proliferation reaches 80%At-90%, the passage at 1:3 was designated as P1. And (3) detecting and identifying the hADSCs by an immunofluorescence method, namely placing the treated clean cover plate into a 6-well plate. At 2x10 ⁵ hADSCs were plated onto the coverslips at individual/mL concentrations. When the cell confluence reaches 70-80%, fixing 4% paraformaldehyde for 20min at room temperature, washing 1xPBS for 5min and repeating for 3 times, sealing 1% bovine serum albumin for 30min at room temperature, diluting primary anti-CD 90, CD105, CD34 and CD45 according to the proportion of 1:100, covering the surface of a cover glass, placing the cover glass in a wet box, and washing 1xPBS for 5min after overnight standing at 4 ℃. After incubation of the secondary antibody for 1h at room temperature, the cells were stained for 1min with DAPI, mounted in 95% glycerol and observed under a fluorescence microscope. The results show that more than 95% of the hADSCs expressed CD90 and CD 105. But hardly expresses CD45, CD34, which indicates that the isolation of the adipose-derived mesenchymal stem cells is successful.

Example 8 blood sugar and body weight reduction of adipose derived mesenchymal Stem cells in combination with 7E13 monoclonal antibody

A healthy Kunming mouse with the weight of about 20g is adaptively raised for one week, and is injected with an STZ solution with the concentration of 5mg/ml into the abdominal cavity every morning, 35mg/kg of the mouse body weight is injected every day, and the injection is continuously carried out for 3 days, and the mouse is fed with high-fat high-sugar feed by drinking tap water. Control mice were injected intraperitoneally daily with an equal amount of sodium citrate buffer. Mice were fed tap water with conventional mouse feed. Observing the drinking and eating conditions every day, detecting the body weight once a day after the model is made, detecting the blood sugar once a week after the model is made, and selecting a mouse as a model group when the blood sugar value of the mouse reaches 11.1mmol/L and the total cholesterol level is obviously increased.

(1) Normal control group: kunming mice were fed 10 normal diets and were left untreated.

(2) Model group: model group Kunming mice 10 normal diet, weekly intraperitoneal injection of normal saline 200 u l, total 3 times. No treatment is done.

(3) Adipose-derived mesenchymal stem cell treatment group: model group Kunming mouse 10 normal diets, weekly intraperitoneal injection of adipose mesenchymal stem cells 1.0 × 10 ⁶ 200 μ l (physiological saline as solvent), for a total of 3 treatments.

(4) Adipose-derived mesenchymal stem cell combined monoclonal antibody treatment group: model group Kunming mouse 10 normal diets, weekly intraperitoneal injection of adipose mesenchymeStem cells 1.0X 10 ⁶ 200 μ l (physiological saline as solvent), for a total of 3 treatments; after 2h intervals, 3 treatments were given with monoclonal antibody 7E 13100. mu.g/mouse.

(5) Adipose-derived mesenchymal stem cells combined with sitagliptin treatment group: model group Kunming mouse 10 normal diets, weekly intraperitoneal injection of adipose mesenchymal stem cells 1.0 × 10 ⁶ 200 μ l (physiological saline as solvent), for a total of 3 treatments; sitagliptin was injected at 100 μ g/mouse after 2h intervals for 3 treatments. The weight of the mice in each group after treatment was measured 1 week after treatment, and the weight before treatment was subtracted to obtain the net weight gain over the entire treatment period, and the results are shown in table 2 below.

TABLE 2 weight gain (g) of mice in each group

Each group of	Increase in weight (g)
		Normal control group	8.24±0.12
Model set	16.56±0.24
		Adipose-derived mesenchymal stem cell treatment group	10.76±0.17
Adipose-derived mesenchymal stem cell combined monoclonal antibody treatment group	8.31±0.05
		Adipose-derived mesenchymal stem cell combined sitagliptin treatment group	9.25±0.13

The results are shown in table 2, the weight of the AD-MSC transplanted treated mice is significantly reduced (P <0.05) compared to the model group, and the adipose-derived mesenchymal stem cell-monoclonal antibody-treated group has a better weight reduction effect than the adipose-derived mesenchymal stem cell-sitagliptin-treated group.

After the treated mice are fasted for 10 hours, blood is taken from the tail part and dripped on the reaction end of the blood glucose test paper, and the blood glucose concentration is displayed by a blood glucose tester.

TABLE 3 blood glucose values of the groups of mice

As can be seen from the results in table 3, the use of adipose derived mesenchymal stem cells in combination with either mab or sitagliptin resulted in the model group showing significant effect of reducing blood glucose in mice, with statistical difference (P <0.05) compared to the model group. Wherein the treatment effect of the AD-MSC combined monoclonal antibody is better than that of the AD-MSC combined sitagliptin. The fact fully shows that the monoclonal antibody and the adipose-derived mesenchymal stem cells have a good synergistic effect, and the treatment effect of the stem cells can be remarkably improved.

It is to be understood that the invention is not necessarily limited in its application to the details of construction and the arrangement of components set forth in the following description and/or illustrated in the drawings. The invention is capable of embodiments in addition to those described and of being practiced or carried out in various ways. Also, it is to be understood that the phraseology and terminology employed herein, as well as the abstract, are for the purpose of description and should not be regarded as limiting.

Sequence listing

<110> Beijing Renli Bihe Biotech Co Ltd

<120> weight-losing pharmaceutical composition containing mesenchymal stem cells

<160> 2

<170> SIPOSequenceListing 1.0

<210> 1

<211> 112

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 1

Asp Leu Val Met Thr Gln Thr Ala Pro Ser Val Pro Val Thr Pro Gly

1 5 10 15

Glu Ser Val Ser Ile Ser Cys Arg Ser Thr Gln Asn Glu Gln Trp Ser

20 25 30

Ala Pro Gln Asn Trp Leu Tyr Trp Phe Leu Gln Arg Pro Gly Gln Ser

35 40 45

Pro Gln Leu Leu Ile Tyr Glu Thr Asp Asn Leu Ala Ser Gly Val Pro

50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Ala Phe Thr Leu Arg Ile

65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Glu Ile Arg

85 90 95

Gly Arg Cys Val Phe Leu Phe Gly Ser Gly Thr Lys Leu Glu Ile Lys

100 105 110

<210> 2

<211> 106

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 2

Val Lys Pro Gly Gly Ser Leu Lys Leu Ser Cys Ala Ala Ser Thr Gly

1 5 10 15

Ile Met Trp Asp Asn Arg Met Ser Trp Val Arg Gln Thr Pro Asp Lys

20 25 30

Arg Leu Glu Trp Val Ala Ile Trp Asp Ser Val His Trp Leu Trp Tyr

35 40 45

Tyr Pro Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Gln Asp

50 55 60

Lys Gln Thr Leu Tyr Leu Gln Met Ser Ser Leu Lys Ser Glu Asp Thr

65 70 75 80

Ala Met Tyr Tyr Cys Met Asn Gln Thr Met Gln Met Lys Glu Ala Gln

85 90 95

Trp Gly Gln Gly Thr Thr Val Thr Val Ser

100 105

Claims

1. Monoclonal antibody 7E13 directed against DPP4, characterized in that the amino acid sequence of the light chain variable region of the antibody is:

DLVMTQTAPSVPVTPGESVSISCRSTQNEQWSAPQNWLYWFLQRPGQSPQLLIYETDNLASGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCEIRGRCVFLFGSGTKLEIK

the amino acid sequence of the heavy chain variable region is:

VKPGGSLKLSCAASTGIMWDNRMSWVRQTPDKRLEWVAIWDSVHWLWYYPDSVKGRFTISRDQDKQTLYLQMSSLKSEDTAMYYCMNQTMQMKEAQWGQGTTVTVS。

2. use of a monoclonal antibody to DPP4 as defined in claim 1 for the preparation of a pharmaceutical composition for weight loss.

3. Use of the DPP4 monoclonal antibody and adipose mesenchymal stem cells according to claim 1 for the preparation of a pharmaceutical composition for weight loss for the treatment of diabetes combined with obesity.

4. Use according to claim 2 or 3, characterized in that the pharmaceutical composition comprises a pharmaceutically acceptable carrier.

5. The use according to claim 4, wherein the pharmaceutical composition is formulated as an injectable formulation.