CN115010807B

CN115010807B - Application of monoclonal antibody and drug-loaded stem cells in preparation of drugs for treating cervical cancer

Info

Publication number: CN115010807B
Application number: CN202210754748.5A
Authority: CN
Inventors: 史皓羽; 刘燕武
Original assignee: Guangdong Cel Biotechnology Co ltd
Current assignee: Guangdong Cel Biotechnology Co ltd
Priority date: 2022-06-29
Filing date: 2022-06-29
Publication date: 2023-10-17
Anticipated expiration: 2042-06-29
Also published as: CN115010807A

Abstract

The application relates to application of monoclonal antibodies and drug-loaded stem cells in preparation of drugs for treating cervical cancer. The application specifically develops the monoclonal antibody aiming at the HSP70, and the antibody can effectively inhibit the activity of the HSP70 and inhibit the proliferation of cervical cancer cells. And simultaneously, after the antibody is combined with bone marrow mesenchymal stem cells loaded with chemical drugs, the tumor can be better targeted for treatment, the sensitivity and the treatment effect of the drugs can be improved, and the application prospect is excellent.

Description

Application of monoclonal antibody and drug-loaded stem cells in preparation of drugs for treating cervical cancer

Technical Field

The application relates to the field of biology, in particular to the field of cancer treatment, and relates to application of monoclonal antibodies and drug-loaded stem cells in preparation of drugs for treating cervical cancer.

Background

Cervical cancer is the second most common malignant tumor of women next to breast cancer in the world, the incidence rate of cervical pain is increased in recent years, and the trend of patient younger is seen, but the operation and radiotherapy of cervical cancer patients are becoming mature day by day, but the effective rate of combined chemotherapy based on cisplatin widely applied is fluctuated by 20% -30% and the total lifetime is less than 10 months, because of the higher treatment success rate of cytotoxic drugs and the poor prognosis of patients, more and more researches are focused on targeted treatment of cervical cancer, and molecular targeted treatment has become a future development trend.

Currently the main molecular targeted therapies include Vascular Endothelial Growth Factor (VEGF) inhibitors, epidermal Growth Factor Receptor (EGFR) inhibitors, mammalian target of rapamycin (MammaIian Target of Rapamycin, mTOR) inhibitors, and other targeted drugs.

Vascular Endothelial Growth Factor (VEGF) is involved in processes such as mitosis, angiogenesis, endothelial cell survival and hematopoiesis. It is not only involved in angiogenesis, but also involved in the rapid production of tumors, inhibiting apoptosis. A significant increase in the expression of VEGF and hypoxia inducible factor 1 alpha (HIF-1 alpha) in cervical dysplasia and invasive cervical cancer was observed. Thus targeted inhibition of the VEGF signaling pathway will have an important role in inhibiting tumor growth. Methods of inhibiting VEGF signaling are by neutralizing the receptor with antibodies, or blocking VEGF receptor activation and signaling by tyrosine kinase inhibitors. Bevacizumab (bevacizumab) is a humanized, VEGF-neutralizing monoclonal antibody. On day 14 of 8 2014, the U.S. Food and Drug Administration (FDA) approved the anti-angiogenic drug bevacizumab for patients with advanced cervical cancer based on an increase in Overall Survival (OS), and bevacizumab was the first biological agent approved for the treatment of advanced cervical cancer. Tewarks et al found that combination chemotherapy with bevacizumab increased the median overall survival of recurrent, persistent or metastatic cervical cancer patients by 3.7 months, and that bevacizumab-containing chemotherapy regimens significantly reduced the risk of mortality and increased remission. Even if the target lesion is located in the pelvis that was previously subjected to radiation therapy, the combination bevacizumab and chemotherapy regimen is still effective. The Epidermal Growth Factor Receptor (EGFR) is a 170-kDa transmembrane glycoprotein belonging to the receptor family of ErbB/HER, including HER2 (ErbB 2), HER3 (ErbB 3) and HER4 (ErbB 4). The EGFR family is involved in the pathogenesis of solid tumors by controlling apoptosis, angiogenesis, and the regulation of invasion and metastatic potential through the cell cycle. The epidermal growth factor receptor is the first tyrosine kinase transmembrane receptor directly associated with human cancers. EGFR inhibitors are largely divided into monoclonal antibodies that interfere with ligand binding and small molecule kinase inhibitors that selectively block receptor activation. anti-EGFR monoclonal antibodies are important molecular targeted drugs for tumor treatment. EGFR tyrosine kinase inhibitors have also been FDA approved and tested in lung, gastric and breast cancer patients. In the cervical cancer treatment area, EGFR was found to be expressed in 98% of women with advanced or recurrent cervical cancer. EGFR-1 is highly expressed in primary and recurrent cervical tumors. Therefore, EGFR blockers are expected to be novel targeted therapeutic agents for cervical cancer. Erlotinib (erlotinib) is a small molecule inhibitor that reversibly competes with ATP for binding to the tyrosine kinase domain of EGFR. Erlotinib is administered orally to patients and side effects are generally well tolerated. Erlotinib has been FDA approved for first line therapy for the treatment of recurrent non-small cell lung cancer and for the treatment of advanced pancreatic cancer with gemcitabine. mTOR is one of the most important downstream proteins in the PI3K/AKT/mTOR signaling pathway, the primary activating effector of which is the serine/threonine protein kinase. mTOR is a key kinase that regulates many cellular events, such as cell proliferation, growth, survival, differentiation, adhesion, motility, angiogenesis, and metastasis. As catalytic subunits, mTOR is involved in two different complexes, rapamycin sensitive mTORC1 and rapamycin insensitive mTORC2, which have different physiological functions and are regulated differently. Inputs from intracellular and extracellular cues, such as amino acids, stress, oxygen, energy, and growth factors, can activate mTORC1.mTORC1 can regulate mRNA translation initiation and progression, thereby controlling the rate of protein synthesis. mTORC1 also controls adipogenesis and energy metabolism, inhibits autophagy and lysosomal biosynthesis, thereby promoting cell growth and proliferation. In vitro experiments show that the combined use of the mTOR inhibitor everolimus and the taxol can obviously inhibit proliferation and cloning of human cervical cancer cells, and the combined treatment has better curative effect than the independent treatment of everolimus or the taxol. Everolimus and paclitaxel have synergistic effects on the induction of apoptosis of cervical cancer cells.

In addition, with the development of stem cell theory and technology, a new idea is provided for clinical treatment of cervical cancer. Studies have shown that mesenchymal stem cells have migratory properties and the ability to modulate immune responses based on the surrounding environment can chemotactic migration to sites of trauma including tumor tissue, and thus mesenchymal stem cells become ideal carriers for performing tumor-targeted therapies. And the human mesenchymal stem cells can secrete certain bioactive factors, and have certain influence on the cell signal path of the tumor, so that the proliferation of the tumor cells is inhibited. In the other direction, the MSC and the anti-tumor drug can be directly incubated to effectively absorb the drug, so that the drug loading is realized. Compared to tumor cells, MSCs have lower sensitivity to anti-tumor drugs and can exhibit better tolerance to chemotherapeutic drugs over a relatively large concentration range.

However, at present, the types of targeted drugs are not enough, and the research on the combined use of mesenchymal stem cells and the targeted drugs is also not enough, and the provision of alternative alternatives is not mature enough, so that the further research is still needed.

Disclosure of Invention

The application overcomes the defects of the prior art and provides an improved pharmaceutical composition for treating cervical cancer.

On the one hand, it has been found through studies that inhibition of HSP70 expression can inhibit proliferation of cervical cancer cells, and at the same time, treatment with the administration of a second therapeutic agent while inhibiting HSP70 expression can synergistically increase the therapeutic effect.

In another aspect, the application also provides a monoclonal antibody HSP70-2F13 specific for HSP70, the variable region of said antibody having the specific sequence:

the amino acid sequence of the heavy chain variable region is shown in SEQ ID NO:1, the amino acid sequence of which is EVQLVESGGGLVQPGGSLRLSCAASGFSLSDVVRDWVRQAPGKGLEWVGRQFADNWIRQAGRCTLRFTI SKDNSKNTLYLQMNSLRAEDTAVYYCARYTFHEKGRNLSDRWGQGTLVTVSS;

the amino acid sequence of the light chain variable region is shown in SEQ ID NO:2, the amino acid sequence is AYQMTQSPSSVSASVGDRVTITCHTLMFWWDTYMWYQQKPGKAPKLLIYNPERNGVGVPSRFSGSGSGT DFTLTISSLQPEDFATYYCAQGPMKGTLAWGYFGGGTKVEIK.

Specifically, the 6 CDR sequences of the antibodies of the present application are shown below, respectively:

the amino acid sequence of CDR-H1 (in this specification CDR-H1 represents heavy chain CDR 1) is shown in DVVRD;

the amino acid sequence of CDR-H2 (in this specification CDR-H2 represents heavy chain CDR 2) is shown as RQFADNWIRQAGRCTL;

the amino acid sequence of CDR-H3 (in this specification CDR-H3 represents heavy chain CDR 3) is shown as YTFHEKGRNLSDR;

the amino acid sequence of CDR-L1 (in this specification CDR-L1 represents light chain CDR 1) is shown as HTLMFWWDTYM;

the amino acid sequence of CDR-L2 (in this specification CDR-L2 represents light chain CDR 2) is shown as NPERNGV;

the amino acid sequence of CDR-L3 (in this specification CDR-L3 represents light chain CDR 3) is shown as AQGPMKGTLAWGY.

Further, the antibodies of the application include individual substitutions, deletions or additions to the antibody sequence which result in amino acid substitutions with chemically similar amino acids. Conservative substitutions providing functionally similar amino acids are well known in the art. Such conservatively modified variants are polymorphic variants of the disclosure, variants outside of the interspecies homologs and alleles, but are not excluded. The following 8 groups contain amino acids that are conservatively substituted with each other: 1) Alanine (a), glycine (g); 2) Aspartic acid (D), glutamic acid (E); 3) Asparagine (N), glutamine (Q); 4) Arginine (R), lysine (K); 5) Isoleucine (I), leucine (L), methionine (M), valine (V); 6) Phenylalanine (F), tyrosine (Y), tryptophan (W); 7) Serine (S), threonine (T); and 8) cysteine (C), methionine (M). In some embodiments, the term "conservative sequence modification" is used to refer to an amino acid modification that does not significantly affect or alter the binding characteristics of an antibody comprising the amino acid sequence.

Further, the antibodies of the application comprise a light chain having at least 95% heavy chain, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to SEQ ID No. 1, and at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% sequence identity to SEQ ID No. 2.

Further, the antibodies of the application comprise a light chain having at least 90% heavy chain, at least 89%, at least 88%, at least 87%, at least 86%, or at least 85% sequence identity to SEQ ID No. 1, and at least 90%, at least 89%, at least 88%, at least 87%, at least 86%, or at least 85% sequence identity to SEQ ID No. 2.

Furthermore, the application provides application of the monoclonal antibody with the specificity of HSP70 in preparing medicines for treating cervical cancer.

Another object of the application is a composition, preferably a pharmaceutical composition, comprising a therapeutically effective amount of an antibody of the application.

The composition may be prepared according to techniques commonly used by those skilled in the art. They can be prepared, for example, by mixing a compound of the application having the desired purity with an optional physiologically acceptable pharmaceutically acceptable carrier, excipient or stabilizer in the form of a lyophilized formulation or aqueous solution. These pharmaceutical compositions are useful for treating patients in need thereof. For the treatment of patients in need thereof, a therapeutically effective dose of the compound may be administered. As used herein, a "therapeutically effective dose" refers to a dose that produces its administered effect. The exact dosage will depend on the purpose of the treatment and can be determined by one skilled in the art using known techniques. The dosage may be 0.001-100mg/kg body weight or more, for example 0.1,0, 10 or 50mg/kg body weight, preferably 0.1-10mg/kg body weight.

Administration of the compositions of the present application may be carried out in a variety of ways including, but not limited to, oral, subcutaneous, intravenous, parenteral, intranasal, intracutaneous, intraocular, rectal, vaginal, transdermal, topical (e.g., gel, ointment, lotion, cream, etc.), intraperitoneal, intramuscular, intrapulmonary.

Furthermore, the application provides application of the HSP70 specific monoclonal antibody and the drug-loaded bone marrow mesenchymal stem cells in preparing a pharmaceutical composition for treating cervical cancer; wherein, the bone marrow mesenchymal stem cells loaded with the medicine are prepared by incubating cisplatin and bone marrow mesenchymal stem cells together.

Further, the pharmaceutical composition of the present application further contains carriers, excipients and diluents suitable for pharmaceutical formulations, examples of which include, but are not limited to, lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methylcellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methyl hydroxybenzoate, propyl hydroxybenzoate, talc, magnesium stearate and mineral oil. In addition, the pharmaceutical formulation may include fillers, anticoagulants, lubricants, wetting agents, flavoring agents and preservatives.

In one embodiment, the dosage of the composition may be administered daily, half-week, weekly, bi-week or monthly. The treatment period may be one week, two weeks, one month, two months, four months, six months, eight months, one year or more. The initial dose may be greater than the continuous dose. In one example, the dosage range is at least 0.01mg/kg, at least 0.25mg/kg, at least 0.3mg/kg, at least 0.5mg/kg, at least 0.75mg/kg, at least 1mg/kg, at least 2mg/kg, at least 3mg/kg, at least 4mg/kg, at least 5mg/kg, at least 6mg/kg, at least 7mg/kg, at least 8mg/kg, at least 9mg/kg, at least 10mg/kg, at least 15mg/kg, at least 20mg/kg, at least 25mg/kg, or at least 30mg/kg per week, in one embodiment, the weekly dosage may be at most 5mg/kg, at most 2mg/kg, at most 2.5mg/kg, at most 3mg/kg, at most 4mg/kg, at most 5mg/kg, at most 6mg/kg, at most 7mg/kg, at most 8mg/kg, at most 9mg/kg, at most 10mg/kg, at most 15mg/kg, at most 20mg/kg, at most 25mg/kg, or at most 30mg/kg. In a particular aspect, the weekly dose may be in the range of 5mg/kg to 20 mg/kg. In another aspect, the weekly dose may be in the range of 10-15 mg/kg.

The total effective dose of the compositions disclosed herein may be administered to a patient in a single dose, or may be administered to a patient in multiple doses over a long period of time according to a fractionated treatment regimen. The amount of active ingredient in the pharmaceutical compositions disclosed herein may vary depending on the severity of the disease. Preferably, the total daily dose of antibodies and stem cells disclosed herein may be about 0.0001pg-500mg per 1kg patient body weight. However, in addition to the route of administration and frequency of treatment of the pharmaceutical composition, the effective dosage of the peptide is determined in consideration of various factors including the age, weight, health condition, sex, severity of disease, diet and secretion rate of the patient. Accordingly, one skilled in the art can readily determine an effective dosage suitable for the particular use of the pharmaceutical compositions disclosed herein. The pharmaceutical composition disclosed herein is not particularly limited to formulation, route of administration and mode of administration as long as it exhibits a suitable effect.

Advantageous effects

The application specifically develops the monoclonal antibody aiming at the HSP70, and the antibody can effectively inhibit the activity of the HSP70 and inhibit the proliferation of cervical cancer cells. And simultaneously, after the antibody is combined with bone marrow mesenchymal stem cells loaded with chemical drugs, the tumor can be better targeted for treatment, the sensitivity and the treatment effect of the drugs can be improved, and the application prospect is excellent.

Drawings

FIG. 1 is a graph showing the effect of monoclonal antibody alone and in combination on cervical cancer cell survival

FIG. 2 is a graph showing the effect of monoclonal antibody alone and in combination on cervical cancer cell HSP70 protein expression level

Detailed Description

In order to more clearly illustrate the embodiments of the present application or the technical solutions in the prior art, the drawings that are needed in the description of the embodiments or the prior art will be briefly described, and it is obvious that the drawings in the description below are some embodiments of the present application, and other drawings can be obtained according to the drawings without inventive effort for a person skilled in the art.

EXAMPLE 1 preparation of human HSP70 monoclonal antibodies

5 BALB/c mice were immunized with 100. Mu.g/mouse with recombinant human HSP70 protein (ab 78427, abcam) as immunogen mixed with Freund's adjuvant in equal amounts, 2 weeks/times apart. ELISA method for detecting antibody serum titer reaching 10 ⁴ At this time, the mice with the highest titers were selected 3d after spleen booster immunization, spleens were taken under aseptic conditions, fused with mouse myeloma SP2/0 cells by using conventional hybridoma technology, and subjected to selective culture fusion with hypoxanthine, aminopterin and thymidine (HAT) on 13 th day, and subjected to 1 st ELISA double screening, 22 wells that were strongly positive for human Hsp70 and that did not react with murine Hsp70 were selected for subcloning screening, and thereafter ELISA screening and subcloning were repeated 3 times until each monoclonal well was strongly positive. 3 hybridoma cell lines with strongest positive reaction are obtained. Among them, 1 hybridoma cell line capable of stably secreting anti-HSP 70 monoclonal antibody is named HSP70-2F13.

High pressure (121deg.C, 20 min) sterilized paraffin oil was injected into the peritoneal cavity of the same type of Balb/c mice, 0.5 ml/mouse, and 2×10 per mouse after 1 week ⁶ After injecting HSP70-2F13 hybridoma cells into the cells for 10d, extracting ascites when the abdomen of the mouse swells and acts slowly, incubating for 1h at 37 ℃, centrifuging for 10min at 3000r/min, discarding fat, and collecting intermediate clarified ascitesAnd (5) split charging and freezing for standby. The titer of mAb was determined to be 10% by indirect ELISA method for ascites ⁶ Purifying the ascites by a column for later use. The specific purification step was equilibration of the column with BufferA (0.05 mol/L Boric acid,4.0mol/LNaCl, pH 9.0); adding a small amount of ascites, and flushing the column with BufferA; then eluting with BufferB (0.05 mol/L Sodium phosphate,0.05mol/L Sodium citrate,0.3mol/L NaCl, pH 3.0); the collected protein was added with 5% by volume of 1.0mol/L Tris-HCl (pH 8.0) to adjust pH, and the protein was concentrated to obtain purified antibody, and the concentration was adjusted to 1mg/mL for use. The antibody was detected as an IgG1 subclass using the Sigama mouse monoclonal antibody subtype detection kit.

Specificity identification: the specific reaction of the monoclonal antibodies was detected by ELISA using 100. Mu.g/mL of human recombinant HSP70 protein, mouse HSP70 protein, GST protein and E.coli lysate as solid phase, respectively. The results are shown in Table 1.

Table 1 results of specific identification of HSP70-2F13 monoclonal antibodies

Each solid phase component	OD490nm
		Human recombinant HSP70 proteins	2.483±0.042
Mouse HSP70 protein	0.028±0.005
		GST protein	0.020±0.004
Escherichia coli lysate	0.018±0.005

From the results in table 1, it can be seen that the monoclonal antibody only has strong specific reaction with recombinant human HSP70 protein, but has no cross reaction with other proteins and host bacteria lysate, and shows better specificity.

Affinity was determined by indirect ELISA: recombinant HSP70 was coated after initial gradient dilution at 5. Mu.g/ml, respectively, with addition of a double diluted monoclonal antibody, addition of HRP-labeled goat anti-mouse IgG, and TMB chromogenic measurement of D (lambda) value. The monoclonal antibody can obtain multiple reaction curves by taking the logarithm of the concentration of the antibody as the abscissa and the D (lambda) value as the ordinate, taking the D (lambda) value of the upper flat section of each curve as 100%, looking up the curve, and the concentration of the antibody corresponding to the 50% D (lambda) value according to the formula Kaff= (n-1)/2 ([ Ab ') commonly used in the field']t-[Ab]t) calculation of affinity constant, affinity constant for HSP70-2F13 monoclonal antibody was 1.42×10- ¹⁰ M has better affinity.

The light chain variable region sequence of the antibody is identified to be shown as SEQ ID NO:1, the heavy chain variable region sequence is shown as SEQ ID NO: 2.

EXAMPLE 2HSP70-2F13 monoclonal antibody and/or cisplatin in vitro anti-cervical cancer cell assay

Human cervical cancer cells HT-3 (Medium Qiao Xinzhou, cat# ZQ 0070) were resuscitated and cultured in DMEM medium (containing 10% fetal bovine serum, 3.7g/L sodium bicarbonate, 1×10) ⁵ U/L penicillin, 100mg/L streptomycin), and placing at 37deg.C, saturated humidity, 5% CO ₂ Culturing in an incubator, and subculturing after 0.25% pancreatin digestion.

Taking logarithmic growth phase cells, digesting with 0.25% trypsin to obtain single cell suspension, and adjusting cell density to 1×10 ⁶ Per liter, 100. Mu.L per well, inoculated in a 96-well plate with 5% CO ₂ Culturing in an incubator at 37 ℃ under saturated humidity for 24 hours. The grouping is as follows: (1) Different concentrations (6.25, 12.5, 25, 50, 100 μg/mL) of HSP70-2F13 monoclonal antibody; (2) Different concentrations (6.25, 12.5, 25, 50, 100. Mu.g/mL) of HSP70-2F13 monoclonal antibody in combination with 100. Mu.g/mL of cisplatin; (3) PFT- μ as a positive control (100 μg/mL); (4) cisplatin alone dosing group (100 μg/mL);(5) 3 compound holes are arranged in each group without adding any medicine as negative control, MTT (5 g/L) is added into each hole for 15 mu L after continuous culture for 72 hours, the culture solution is discarded, DMSO is added into each hole for 150 mu L, incubation is carried out in an incubator for 30 minutes, a micro-oscillator oscillates for 10 minutes to enable crystals to be fully dissolved, an enzyme-labeled instrument detects absorbance (A) value of each hole at 490nm wavelength, and cell survival rate is calculated: cell viability/% = experimental group a value/control group a value x 100%. The above experiment was repeated 3 times. The results are shown in FIG. 1.

From the results of fig. 1, it can be seen that, either HSP70-2F13 mab alone or in combination with cisplatin, there was a significant effect of reducing cell survival (P < 0.05) relative to the negative control. It is known in the art that Pifithrin-m (PFT- μ) is a potent HSP70 inhibitor with good inhibition at both cellular and animal levels. Compared with the HSP70-2F13 antibody of the present application, the HSP70-2F13 antibody of the present application has a better effect of inhibiting cells by using PFT-mu at a concentration of 100. Mu.g/mL as a positive control. The combination of the HSP70-2F13 antibody and cisplatin is compared with cisplatin alone, and the result shows that the combination of the antibody and cisplatin can increase the inhibition effect of cisplatin on cervical cancer cells. Mainly because cisplatin can significantly apoptosis by inducing cells after HSP70 expression is inhibited, thereby inhibiting cancer cell proliferation, i.e., inhibiting HSP70 expression increases cancer cell sensitivity to cisplatin. Under the combined action of 100 mug/mL HSP70-2F13 monoclonal antibody and 100 mug/mL cisplatin, the survival rate of cancer cells is only (8.12+/-1.23)%, and the inhibition effect is good.

Western blot detection protein: each group of cells was washed with pre-chilled PBS, protein lysates were added, total protein was extracted, and protein concentration was determined by the Bradford method. Respectively taking 50 mug of protein, carrying out electrophoresis on the denatured protein by 5% SDS-PAGE concentrated gel and 10% SDS-PAGE separating gel, taking out gel transfer membrane after electrophoresis, placing the gel in a transfer buffer solution for balancing for 20min, then carrying out 15V30min semi-dry transfer protein on a PVDF membrane, oscillating and sealing the defatted milk powder at room temperature for 90min, incubating the primary antibody, and standing at 4 ℃ for night. Horseradish peroxidase (HRP) labeled secondary antibody was added and incubated at 37℃for 1h at room temperature. And taking an equal amount of ECL chromogenic reagent A, B, uniformly mixing, incubating a PVDF membrane, and performing color development and photographing. Beta-actin is used as an internal reference. The results are shown in FIG. 2.

The Western blot experiment results from fig. 2 show that the difference in protein expression of HSP70 mab treated group compared to negative control group is statistically significant (P < 0.01). Western blot experiment results show that HSP70 monoclonal antibody treated cancer cells have obviously reduced expression of HSP70 protein and certain concentration dependence, and after monoclonal antibody and cisplatin are combined, the inhibition effect on HSP70 is not great, which also shows that the gain effect of combining cisplatin and HSP70 monoclonal antibody is not realized by further inhibiting the expression of HSP70 protein.

Example 3 preparation of bone marrow mesenchymal Stem cells and drug-loading experiments

Human bone marrow mesenchymal stem cells HBMSCs (CQ 80235, autumn-transferred organisms) were inoculated into the medium: DMEM90% + FBS10% + recombinant human basic fibroblast growth factor 5ng/mL+rhIGF-1

15ng/mL+L-Alanyl-L-glutamine2.4mM, after the cells grow to 80% of the bottle bottom area, placing 0.25% pancreatin-0.53 mM EDTA digestion solution in room temperature for preheating, pouring out the culture medium in the culture flask, adding 3-5mL PBS into the culture flask, and discarding after light shaking washing. 1-2ml of preheated pancreatin is added into the bottle, the bottle is placed at room temperature for incubation and digestion, and after the digestion is completed, 3ml of trypsin is added for neutralization solution to stop the digestion. Gently blowing the cells on the bottle wall by a pipetting gun to completely fall off, collecting cell suspension, centrifuging at 1000rpm for 3min, discarding supernatant, adding culture medium to resuspend the cells, and carrying out passage with the passage ratio of 1:3. The cultured cells were collected for later use.

The cultured human bone marrow mesenchymal stem cells HBMSC are cultured according to the cell concentration of 1 multiplied by 10 ⁵ After incubation of cisplatin at a concentration of 5mg/mL for 24h in the medium, cisplatin-loaded human bone marrow mesenchymal stem cells were collected by low temperature centrifugation at 400g for 10 min.

Human bone marrow mesenchymal stem cells were washed with cisplatin-free medium until there was no cisplatin bound to the surface. A certain amount of the loaded human bone marrow mesenchymal stem cells were taken for cell lysis, and the average cisplatin adsorption amount per single cell was determined to be about 0.18ng by mass spectrometry.

EXAMPLE 4 inhibition of drug-loaded Stem cells and/or HSP70-2F13 monoclonal antibodies on human cervical cancer nude mouse tumor model

Taking the human cervical cancer cells HT-3 in the logarithmic growth phase with vigorous proliferation, preparing a cell suspension, and suspending the cells by PBS. Inoculating the cell suspension under armpit of nude mice with 1×10 per nude mice ⁸ Cells (100 μl), cells were placed on ice throughout the inoculation process. Female nude mice are selected for the experiment, and the age is 4-5 weeks. The volume of the tumor to be transplanted reaches about 200mm ³ At the time, tumor-bearing nude mice are randomly grouped, 5 nude mice in each group are grouped as follows:

A. blank dosing control (PBS);

B. cisplatin group (2.5 mg/kg);

C. positive control PFT- μ group (5 mg/kg);

D. HSP70-2F13 mab group (1 mg/kg);

E. drug-loaded stem cell group (1×10) ⁶ Individual/kg);

F. HSP70-2F13 monoclonal antibody combined drug-loaded stem cell group (monoclonal antibody 1 mg/kg+drug-loaded stem cell 1×10) ⁶ Individual/kg);

G. HSP70-2F13 monoclonal antibody is combined with cisplatin group (monoclonal antibody 1mg/kg+2.5 mg/kg);

the intraperitoneal administration was started, and 1 dose was given every 5d for 3 doses. The tumor volumes before and after administration were measured with a vernier caliper and denoted as a (longest diameter), b (shortest diameter), respectively, and the tumor volume formula was v=ab ² /2. Mice were euthanized for photography at 20d after the first dose, tumors were exfoliated, tumor volumes were measured, and tumor inhibition rates were calculated. The results are shown in Table 2.

TABLE 2 tumor volume (mm) ³ ，mean±SD)

As can be seen from the results in Table 2, the results indicate that the tumor of the drug groupVolume growth rate was significantly slower than control group (×p)<0.01). The average tumor volume of the blank administration control group is (856.8 +/-29.5) mm ³ HSP70-2F13 mab group average tumor volume (528.4.+ -. 15.9) mm ³ The average tumor volume of the positive control group is (583.4 +/-21.2) mm ³ The average tumor volume of the drug-loaded stem cell group is (396.4 +/-15.3) mm ³ HSP70-2F13 monoclonal antibody combined drug-loaded stem cell group average tumor volume is (272.1+ -11.4) mm ³ The average tumor volume of the monoclonal antibody combined cisplatin group is (332.7 +/-12.5) mm ³ . From the result, the medicine-carrying stem cells have certain tumor targeting, can better release medicine to tumor parts, and further have better effect of inhibiting tumor growth. After the drug-loaded stem cell group is combined with the HSP70-2F13 monoclonal antibody, the drug sensitivity of cisplatin can be obviously improved, and the treatment effect is obviously improved after the activity of the HSP70 is inhibited by the monoclonal antibody.

The liver and kidney tissues of mice in each group are shown by HE staining results, and compared with PBS groups, the liver and kidney tissues of the monoclonal antibody group and the monoclonal antibody combination drug group do not have obvious necrosis, which shows that the drug of the application has no obvious toxic or side effect.

It is to be understood that the application is not necessarily limited in its application to the details of construction and the arrangement of components set forth in the following description or illustrated in the drawings. The application is capable of embodiments in addition to those described and of being practiced or of being carried out in various ways. Also, it is to be understood that the phraseology and terminology employed herein, as well as the abstract, are for the purpose of description and should not be regarded as limiting.

Sequence listing

<110> Nanjing Haoyu biotechnology Co., ltd

Application of <120> monoclonal antibody and drug-loaded stem cells in preparation of drug for treating cervical cancer

<160> 2

<170> SIPOSequenceListing 1.0

<210> 1

<211> 121

<212> PRT

<213> Artificial sequence (Artificial Sequence)

<400> 1

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Ser Leu Ser Asp Val

20 25 30

Val Arg Asp Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45

Gly Arg Gln Phe Ala Asp Asn Trp Ile Arg Gln Ala Gly Arg Cys Thr

50 55 60

Leu Arg Phe Thr Ile Ser Lys Asp Asn Ser Lys Asn Thr Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Tyr Thr Phe His Glu Lys Gly Arg Asn Leu Ser Asp Arg Trp Gly

100 105 110

Gln Gly Thr Leu Val Thr Val Ser Ser

115 120

<210> 2

<211> 111

<212> PRT

<213> Artificial sequence (Artificial Sequence)

<400> 2

Ala Tyr Gln Met Thr Gln Ser Pro Ser Ser Val Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys His Thr Leu Met Phe Trp Trp Asp Thr

20 25 30

Tyr Met Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Asn Pro Glu Arg Asn Gly Val Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Ala Gln Gly Pro Met Lys Gly Thr

85 90 95

Leu Ala Trp Gly Tyr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys

100 105 110

Claims

1. A monoclonal antibody specific for HSP70, HSP70-2F13, the variable region of which has the following specific sequence:

the amino acid sequence of the heavy chain variable region is shown in SEQ ID NO:1 is shown in the specification;

the amino acid sequence of the light chain variable region is shown in SEQ ID NO: 2.

Use of a monoclonal antibody specific for HSPs 70 in the preparation of a pharmaceutical composition for the treatment of cervical cancer, wherein the monoclonal antibody of HSP70 is HSP70-2F13, the variable region of which has the specific sequence:

the amino acid sequence of the heavy chain variable region is shown in SEQ ID NO:1, wherein the amino acid sequence of the light chain variable region is shown in SEQ ID NO: 2.

Use of a monoclonal antibody specific for HSPs 70 and cisplatin-loaded bone marrow mesenchymal stem cells in the preparation of a pharmaceutical composition for treating cervical cancer, wherein the monoclonal antibody of HSP70 is HSP70-2F13, the variable region of which has the specific sequence:

the amino acid sequence of the heavy chain variable region is shown in SEQ ID NO:1, wherein the amino acid sequence of the light chain variable region is shown in SEQ ID NO:2 is shown in the figure;

the bone marrow mesenchymal stem cells loaded with cisplatin are prepared by culturing human bone marrow mesenchymal stem cells according to the cell concentration of 1×10 ⁵ After incubation of cisplatin at a concentration of 5mg/mL for 24h in the medium, the obtained cisplatin-loaded human bone marrow mesenchymal stem cells were collected by centrifugation for 400g for 10 minutes.

4. The use according to any one of claims 2 or 3, wherein the pharmaceutical composition further comprises a pharmaceutically acceptable carrier.

5. Use according to any one of claims 2 or 3, characterized in that the pharmaceutical composition is in the form of an injection.