CN113402595A - Antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide, and preparation and application thereof - Google Patents
Antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide, and preparation and application thereof Download PDFInfo
- Publication number
- CN113402595A CN113402595A CN202110474639.3A CN202110474639A CN113402595A CN 113402595 A CN113402595 A CN 113402595A CN 202110474639 A CN202110474639 A CN 202110474639A CN 113402595 A CN113402595 A CN 113402595A
- Authority
- CN
- China
- Prior art keywords
- antioxidant
- polypeptide
- antimicrobial peptide
- polypeptide derived
- antioxidant polypeptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 230000003078 antioxidant effect Effects 0.000 title claims abstract description 92
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 88
- 239000003963 antioxidant agent Substances 0.000 title claims abstract description 83
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 81
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 80
- 239000003910 polypeptide antibiotic agent Substances 0.000 title claims abstract description 36
- 241000239224 Tachypleus tridentatus Species 0.000 title claims abstract description 24
- 108700042778 Antimicrobial Peptides Proteins 0.000 title claims abstract description 22
- 102000044503 Antimicrobial Peptides Human genes 0.000 title claims abstract description 22
- 238000002360 preparation method Methods 0.000 title claims abstract description 15
- 238000000034 method Methods 0.000 claims abstract description 16
- 239000002537 cosmetic Substances 0.000 claims abstract description 9
- 239000003814 drug Substances 0.000 claims abstract description 8
- 239000002778 food additive Substances 0.000 claims abstract description 8
- 235000013373 food additive Nutrition 0.000 claims abstract description 8
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 claims abstract description 7
- 238000010532 solid phase synthesis reaction Methods 0.000 claims abstract description 6
- 238000003786 synthesis reaction Methods 0.000 claims abstract description 5
- 229940079593 drug Drugs 0.000 claims abstract description 4
- 235000019261 food antioxidant Nutrition 0.000 claims abstract description 4
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 3
- 241001529572 Chaceon affinis Species 0.000 claims description 10
- 238000004007 reversed phase HPLC Methods 0.000 claims description 3
- 230000002194 synthesizing effect Effects 0.000 claims description 3
- 239000000047 product Substances 0.000 claims description 2
- 235000006708 antioxidants Nutrition 0.000 claims 17
- 230000001687 destabilization Effects 0.000 claims 1
- 230000015572 biosynthetic process Effects 0.000 abstract description 3
- 241000239221 Tachypleus gigas Species 0.000 abstract 1
- 150000001413 amino acids Chemical class 0.000 description 11
- 101800000068 Antioxidant peptide Proteins 0.000 description 8
- 239000011347 resin Substances 0.000 description 8
- 229920005989 resin Polymers 0.000 description 8
- 238000002835 absorbance Methods 0.000 description 7
- HHEAADYXPMHMCT-UHFFFAOYSA-N dpph Chemical compound [O-][N+](=O)C1=CC([N+](=O)[O-])=CC([N+]([O-])=O)=C1[N]N(C=1C=CC=CC=1)C1=CC=CC=C1 HHEAADYXPMHMCT-UHFFFAOYSA-N 0.000 description 7
- 150000003254 radicals Chemical class 0.000 description 7
- 235000001014 amino acid Nutrition 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 5
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 4
- OUUQCZGPVNCOIJ-UHFFFAOYSA-M Superoxide Chemical compound [O-][O] OUUQCZGPVNCOIJ-UHFFFAOYSA-M 0.000 description 4
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 230000007760 free radical scavenging Effects 0.000 description 4
- WQGWDDDVZFFDIG-UHFFFAOYSA-N pyrogallol Chemical compound OC1=CC=CC(O)=C1O WQGWDDDVZFFDIG-UHFFFAOYSA-N 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 3
- 230000032683 aging Effects 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 230000000975 bioactive effect Effects 0.000 description 3
- 239000012153 distilled water Substances 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 229910052760 oxygen Inorganic materials 0.000 description 3
- 239000001301 oxygen Substances 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 210000003491 skin Anatomy 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- YBYIRNPNPLQARY-UHFFFAOYSA-N 1H-indene Chemical compound C1=CC=C2CC=CC2=C1 YBYIRNPNPLQARY-UHFFFAOYSA-N 0.000 description 2
- 208000017667 Chronic Disease Diseases 0.000 description 2
- 241000239218 Limulus Species 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 101710108362 Tachystatin-C Proteins 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000005520 cutting process Methods 0.000 description 2
- 238000010511 deprotection reaction Methods 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 238000004108 freeze drying Methods 0.000 description 2
- 238000011031 large-scale manufacturing process Methods 0.000 description 2
- 230000003859 lipid peroxidation Effects 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 239000011259 mixed solution Substances 0.000 description 2
- FEMOMIGRRWSMCU-UHFFFAOYSA-N ninhydrin Chemical compound C1=CC=C2C(=O)C(O)(O)C(=O)C2=C1 FEMOMIGRRWSMCU-UHFFFAOYSA-N 0.000 description 2
- -1 oxygen radicals Chemical class 0.000 description 2
- 125000006239 protecting group Chemical group 0.000 description 2
- 229940079877 pyrogallol Drugs 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000012795 verification Methods 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- LZOLWEQBVPVDPR-VLIAUNLRSA-N (2s,3r)-2-(9h-fluoren-9-ylmethoxycarbonylamino)-3-[(2-methylpropan-2-yl)oxy]butanoic acid Chemical compound C1=CC=C2C(COC(=O)N[C@@H]([C@H](OC(C)(C)C)C)C(O)=O)C3=CC=CC=C3C2=C1 LZOLWEQBVPVDPR-VLIAUNLRSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- YEDUAINPPJYDJZ-UHFFFAOYSA-N 2-hydroxybenzothiazole Chemical compound C1=CC=C2SC(O)=NC2=C1 YEDUAINPPJYDJZ-UHFFFAOYSA-N 0.000 description 1
- CREYEAPXISDKSB-FQPOAREZSA-N Ala-Thr-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O CREYEAPXISDKSB-FQPOAREZSA-N 0.000 description 1
- ZATRYQNPUHGXCU-DTWKUNHWSA-N Arg-Gly-Pro Chemical compound C1C[C@@H](N(C1)C(=O)CNC(=O)[C@H](CCCN=C(N)N)N)C(=O)O ZATRYQNPUHGXCU-DTWKUNHWSA-N 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- 241000238421 Arthropoda Species 0.000 description 1
- BYALSSDCQYHKMY-XGEHTFHBSA-N Cys-Arg-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CS)N)O BYALSSDCQYHKMY-XGEHTFHBSA-N 0.000 description 1
- 206010014970 Ephelides Diseases 0.000 description 1
- AQLHORCVPGXDJW-IUCAKERBSA-N Gly-Gln-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)CN AQLHORCVPGXDJW-IUCAKERBSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 208000003351 Melanosis Diseases 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 206010051246 Photodermatosis Diseases 0.000 description 1
- YAZNFQUKPUASKB-DCAQKATOSA-N Pro-Lys-Cys Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)O YAZNFQUKPUASKB-DCAQKATOSA-N 0.000 description 1
- 230000002292 Radical scavenging effect Effects 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 239000003875 Wang resin Substances 0.000 description 1
- NERFNHBZJXXFGY-UHFFFAOYSA-N [4-[(4-methylphenyl)methoxy]phenyl]methanol Chemical compound C1=CC(C)=CC=C1COC1=CC=C(CO)C=C1 NERFNHBZJXXFGY-UHFFFAOYSA-N 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 108010091092 arginyl-glycyl-proline Proteins 0.000 description 1
- 208000011775 arteriosclerosis disease Diseases 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 238000006482 condensation reaction Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- MGJZITXUQXWAKY-UHFFFAOYSA-N diphenyl-(2,4,6-trinitrophenyl)iminoazanium Chemical compound [O-][N+](=O)C1=CC([N+](=O)[O-])=CC([N+]([O-])=O)=C1N=[N+](C=1C=CC=CC=1)C1=CC=CC=C1 MGJZITXUQXWAKY-UHFFFAOYSA-N 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 235000019441 ethanol Nutrition 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 210000004211 gastric acid Anatomy 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 230000031700 light absorption Effects 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000001819 mass spectrum Methods 0.000 description 1
- 230000006676 mitochondrial damage Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000004792 oxidative damage Effects 0.000 description 1
- 230000036542 oxidative stress Effects 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 230000008845 photoaging Effects 0.000 description 1
- 230000007180 physiological regulation Effects 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000009145 protein modification Effects 0.000 description 1
- 235000018102 proteins Nutrition 0.000 description 1
- 108090000623 proteins and genes Proteins 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 239000012488 sample solution Substances 0.000 description 1
- 230000002000 scavenging effect Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 210000004927 skin cell Anatomy 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000004575 stone Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
- A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
- A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
- A23L33/17—Amino acids, peptides or proteins
- A23L33/18—Peptides; Protein hydrolysates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P39/00—General protective or antinoxious agents
- A61P39/06—Free radical scavengers or antioxidants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
- A61Q19/08—Anti-ageing preparations
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Toxicology (AREA)
- Biochemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biophysics (AREA)
- Gerontology & Geriatric Medicine (AREA)
- Dermatology (AREA)
- Birds (AREA)
- Epidemiology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Pharmacology & Pharmacy (AREA)
- Genetics & Genomics (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Mycology (AREA)
- Nutrition Science (AREA)
- Engineering & Computer Science (AREA)
- Food Science & Technology (AREA)
- Polymers & Plastics (AREA)
- Peptides Or Proteins (AREA)
- Coloring Foods And Improving Nutritive Qualities (AREA)
Abstract
The invention discloses an antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide, and a preparation method and application thereof, wherein the antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide comprises an amino acid sequence shown as SEQ ID NO. 1, the molecular weight of the antioxidant polypeptide is 1852.14Da, the isoelectric point of the antioxidant polypeptide is 9.85, the net charge of the antioxidant polypeptide is 4, and the instability coefficient of the antioxidant polypeptide is 1.41. The invention adopts Fmoc polypeptide solid phase synthesis method to chemically synthesize the antioxidant polypeptide from the Chinese horseshoe crab antibacterial peptide, has strong antioxidant activity, strong capacity of removing free radicals, small molecular weight, simple structure and easy synthesis, can be used as antioxidant drugs, food additives and antioxidant cosmetics, and has wide application prospect.
Description
Technical Field
The invention belongs to the technical field of biomedicine, and relates to an antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide, and preparation and application thereof.
Background
The bioactive peptide is a molecular polymer between amino acid and protein, and has physiological regulation effect on the life activity of living organisms. Bioactive peptides have great development prospects in the industries of medicines, foods and cosmetics, wherein polypeptides with antioxidant activity are also called antioxidant peptides.
The occurrence of various diseases in human, such as cancer, aging, rheumatoid arthritis, arteriosclerosis and other chronic diseases, is related to the oxidative damage of the body. Under normal physiological environment, the body can generate a small amount of active oxygen free radicals, and when the body is stressed by the environment, a large amount of oxygen free radicals can be generated, so that the body is oxidized and damaged, and chronic diseases and organ aging are further caused. By properly ingesting substances with antioxidant activity, the human body can reduce the level of free radicals in the body, prevent oxidative stress, prevent lipid peroxidation and help the body to resist diseases. In addition, because the photoaging effect of skin is caused by the accumulation of a large amount of oxygen radicals generated by skin cells induced by ultraviolet rays, the antioxidant added into a plurality of skin care products can not only remove excessive free radicals in vivo, but also has obvious protective effect on mitochondrial damage caused by ultraviolet rays and lipid peroxidation induced by the free radicals, and also has the effects of reducing freckles, delaying aging, regulating immunity and protecting skin.
At present, research on antioxidant peptides is increasing at home and abroad, and research on preparation, separation and purification of the antioxidant peptides to obtain detection methods and properties of the antioxidant peptides is increasing day by day, and patent document CN 107226841B provides an antioxidant ultrashort peptide and application thereof, wherein the antioxidant ultrashort peptide contains 5-6 amino acids; patent document CN110256530A provides an antioxidant peptide and application thereof, wherein the molecular weight is 700-800 Da; patent document CN 108373496a discloses an antioxidant polypeptide GTMGAVGPRG and a preparation method thereof. The technology for synthesizing the polypeptide by using the chemical solid-phase synthesis method is more and more mature, and the method is a quick and effective method for synthesizing the antioxidant short peptide in the future. Although the method can successfully obtain the antioxidant peptide, the antioxidant performance of the product has further improved space.
Therefore, the development of an antioxidant peptide with excellent antioxidant performance is of great practical significance.
Disclosure of Invention
The invention aims to provide an antioxidant peptide with excellent antioxidant performance, in particular to an antioxidant polypeptide derived from tachypleus tridentatus antibacterial peptide, and preparation and application thereof.
Limulus is an ancient marine organism belonging to the families of arthropoda, acropoda, caudate and limulus, has been alive for 4 billion years on the earth, called marine "activating stone" and has more than 50 bioactive substances in blood. According to the invention, the 7 th-22 th amino acid residue at the N tail end of the antibacterial peptide Tachystatin C found in the blood of the horseshoe crab is intercepted according to the amino acid sequence DYDWSLRGPPKCATYGQKCRTWSPPNCCWNLRCKAFRCRPR, and the intercepted small molecule short peptide RW-16 with the amino acid sequence RGPPKCATYGQKCRTW is found, so that the antibacterial peptide Tachystatin C has extremely strong antioxidant activity and extremely high stability. The full length of the primary sequence has 16 amino acid residues, the molecular weight is small, the structure is simple, no protein modification is caused, the preparation method is a chemical synthesis method, the process is simple and convenient, the yield is high, and the purity is high.
In order to achieve the purpose, the invention provides the following technical scheme:
an antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide, the antioxidant polypeptide comprising an amino acid sequence (i.e., SEQ ID NO:1) as shown below:
Arg-Gly-Pro-Pro-Lys-Cys-Ala-Thr-Tyr-Gly-Gln-Lys-Cys-Arg-Thr-Trp is RGPPKCATYGQKCRTW.
The antioxidant polypeptide has strong antioxidant activity, strong free radical scavenging capacity, small molecular weight, simple structure and easy synthesis, can be used as antioxidant medicaments, food additives and antioxidant cosmetics, and has high popularization value.
As a preferred technical scheme:
the antioxidant polypeptide derived from tachypleus tridentatus antibacterial peptide is named as RW-16 because the antioxidant polypeptide contains 16 amino acid residues, and the primary structure of the whole sequence of the antioxidant polypeptide is as follows:
Arg-Gly-Pro-Pro-Lys-Cys-Ala-Thr-Tyr-Gly-Gln-Lys-Cys-Arg-Thr-Trp。
RW-16 is rich in three essential amino acids such as lysine (Lys), threonine (Thr) and tryptophan (Trp), and contains cysteine (Cys), and has strong antioxidant activity and high stability, with a concentration of 0.2mg/mL, a clearance rate for DPPH free radicals of 95.58% and a clearance rate for superoxide free radicals of 52.97%; the clearance rate of DPPH free radical is 95.85% when the concentration is 2mg/mL, and the clearance rate of superoxide radical is 95.07%.
The antioxidant polypeptide derived from tachypleus tridentatus antibacterial peptide has the molecular weight of 1852.14Da, the isoelectric point of 9.85, the net charge of 4 and the instability coefficient of 1.41 (extremely stable). The antioxidant polypeptide has the advantages of small molecular weight, easy absorption and utilization by organisms, alkalescence in aqueous solution, positive charge, capability of neutralizing gastric acid by theoretically eating (needing clinical verification subsequently), contribution to gastrointestinal absorption, higher stability when the instability coefficient is less than 40 and lower stability when the instability coefficient is more than 40, and the instability coefficient of the antioxidant polypeptide is 1.41, which indicates that the antioxidant polypeptide is extremely stable in the environment and is not easy to inactivate.
The invention also provides a method for preparing the antioxidant polypeptide from the tachypleus tridentatus antibacterial peptide, and the antioxidant polypeptide from the tachypleus tridentatus antibacterial peptide is obtained by adopting Fmoc polypeptide solid phase synthesis method to chemically synthesize according to the amino acid sequence of the antioxidant polypeptide. The protection scope of the present invention is not limited thereto, and those skilled in the art can adopt an appropriate preparation method according to actual needs as long as the amino acid sequence of the antioxidant polypeptide is ensured to be correct.
As a preferred technical scheme:
according to the method, after the polypeptide is chemically synthesized by adopting an Fmoc polypeptide solid-phase synthesis method, the polypeptide is purified by using reverse-phase high performance liquid chromatography to obtain the antioxidant polypeptide derived from the tachypleus tridentatus antibacterial peptide.
In addition, the invention also provides application of the antioxidant polypeptide derived from the tachypleus tridentatus antimicrobial peptide in preparation of antioxidant drugs, health-care products, food additives and antioxidant cosmetics.
In addition, the invention also provides an antioxidant medicine containing the antioxidant polypeptide derived from the tachypleus tridentatus antimicrobial peptide.
A health product contains the above antioxidant polypeptide derived from Tachypleus tridentatus antibacterial peptide.
A food additive contains the above antioxidant polypeptide derived from horseshoe crab antibacterial peptide.
An antioxidant cosmetic contains the above antioxidant polypeptide derived from horseshoe crab antibacterial peptide.
Has the advantages that:
(1) the antioxidant polypeptide derived from the tachypleus tridentatus antibacterial peptide has strong antioxidant activity, strong free radical scavenging capacity, small molecular weight, simple structure and high popularization value, is easy to synthesize, and can be used as an antioxidant medicine, a food additive and an antioxidant cosmetic;
(2) the preparation method of the antioxidant polypeptide derived from the tachypleus tridentatus antimicrobial peptide has the advantages of simple process, low cost, large-scale production and wide application prospect.
Drawings
FIG. 1 is a high performance liquid chromatogram of the crude polypeptide obtained in step (5) of example 1 when purified;
FIG. 2 is a mass spectrum of the antioxidant polypeptide prepared in example 1.
Detailed Description
The present invention will be described in more detail with reference to the accompanying drawings, in which embodiments of the invention are shown and described, and it is to be understood that the embodiments described are merely illustrative of some, but not all embodiments of the invention.
Example 1
A preparation method of antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide comprises the following steps:
(1) Fmoc-Trp (Boc) -Wang Resin (wang Resin) was put into a polypeptide synthesizer.
(2) Deprotection: the Fmoc protecting group on the resin was removed with 20% piperidine (DMF: hexahydropyridine ═ 4:1), reacted for 20 minutes, the resin was washed with DMF and subjected to ninhydrin test (Kaiser test) and the resin appeared blue to confirm that the Fmoc protecting group had been removed.
(3) Amino acid condensation: DIC, HOBT and FMOC-Thr (tBu) -OH are added into a synthesizer, condensation reaction is carried out for 40 minutes, DMF is used for washing the resin, ninhydrin test (Kaiser test) shows that the resin is colorless, and the amino acid is successfully grafted, so that the next amino acid can be jointed. Repeating the steps (2) and (3), and sequentially joining according to the polypeptide sequences shown as follows:
Arg-Gly-Pro-Pro-Lys-Cys-Ala-Thr-Tyr-Gly-Gln-Lys-Cys-Arg-Thr-Trp。
(4) after the last amino acid deprotection and indene detection are finished, residual liquid is pumped out, washed by DCM, pumped out after washing, and pumped out until the resin is loose and has no caking.
(5) Adding a cutting agent trifluoroacetic acid into the resin, cutting the polypeptide from the resin, extracting with diethyl ether, and freeze-drying to obtain a crude polypeptide product.
(6) The crude peptide obtained was purified by reverse phase high performance liquid chromatography (FIG. 1), passed through a reverse phase column Kromasil C18(4.6 x 250mm,5um) and treated with CH containing 0.1% trifluoroacetic acid3CN/H2And performing gradient elution on the O at the flow rate of 1mL/min for 80min, monitoring light absorption at 214nm, collecting a main peak, and performing freeze-drying to obtain the purified antioxidant polypeptide. Finally, the molecular weight of the peptide was determined by mass spectrometry (fig. 2).
As can be seen from FIG. 1, the purity of the purified antioxidant polypeptide was greater than 95%, and the antioxidant polypeptide RW-16 obtained from FIG. 2 had a relative molecular weight of 1852.14 Da.
Then, the antioxidant activity of the antioxidant polypeptide RW-16 prepared in the step (6) is measured, and the content of the measurement comprises the measurement of DPPH free radical scavenging capacity and superoxide radical (O)2 -) The specific contents of the measurement of the clearing capacity are as follows:
1) determination of DPPH radical scavenging Capacity
The polypeptide was diluted with distilled water to give solutions of concentrations of 0.02, 0.2 and 2mg/mL, respectively. Preparing a DPPH solution with the concentration of 0.2mmol/L by using 95% ethanol, uniformly mixing 2mL of a polypeptide sample and 2mL of the DPPH solution, carrying out constant-temperature water bath at 28 ℃ for 30min in a dark condition, and measuring the absorbance at 517nm after the reaction is finished. The control group is the absorbance of the mixed solution of 2mL of absolute ethyl alcohol solution and 2mL of sample solution, the blank group is the absorbance of the mixed solution of 2mL of DPPH solution and 2mL of distilled water, and absolute ethyl alcohol is used for zero setting.
Wherein, As is the absorbance of the experimental group; ac is the absorbance of the control group; ab is absorbance of blank.
2) Superoxide radical (O)2 -) Determination of the scavenging Capacity
200uL of polypeptide solutions with concentrations of 0.02, 0.2 and 2mg/mL, respectively, were mixed with 1.3mL of 50mM Tris-HCl (pH 8.8), 100. mu.L of 1.5mM pyrogallol (prepared with 10mM HCl) was added to react at room temperature for 10min, and then 50. mu.L of 8M HCl was added to terminate the reaction, absorbance A1 was measured at 420nm, 200. mu.L of distilled water was used as a blank A0 instead of the sample, and 100. mu.L of HCl was used as a control A2 instead of the pyrogallol.
The test results are shown in table 1;
TABLE 1
Polypeptide concentration (mg/mL) | DPPH clearance (%) | O2 -Clearance (%) |
0.02 | 24.84 | 50.01 |
0.2 | 95.58 | 52.97 |
2 | 95.85 | 95.07 |
As can be seen from Table 1, the antioxidant polypeptide RW-16 has strong antioxidant activity, and when the sample concentration is 2mg/mL, the clearance rate of the antioxidant polypeptide RW-16 to DPPH is as high as 95.85%, and to O2 -The clearance rate of the product is as high as 95.07 percent.
The following results were obtained after testing the molecular weight, isoelectric point, net charge and instability coefficient of the antioxidant polypeptide RW-16: the molecular weight is 1852.14Da, the isoelectric point is 9.85, the net charge is 4, and the instability coefficient is 1.41.
Proved by verification, the antioxidant polypeptide derived from the tachypleus tridentatus antibacterial peptide has strong antioxidant activity, strong free radical scavenging capacity, small molecular weight, simple structure and easy synthesis, can be used as an antioxidant medicine, a food additive and an antioxidant cosmetic, and has extremely high popularization value; the preparation method has simple process and low cost, can be used for large-scale production, and has wide application prospect.
Although specific embodiments of the present invention have been described above, it will be appreciated by those skilled in the art that these embodiments are merely illustrative and various changes or modifications may be made without departing from the principles and spirit of the invention.
Sequence listing
<110> Shanghai ocean university
<120> an antioxidant polypeptide derived from Tachypleus tridentatus antimicrobial peptide, its preparation and application
<141> 2021-04-29
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 16
<212> PRT
<213> Artificial Sequence
<400> 1
Arg Gly Pro Pro Lys Cys Ala Thr Tyr Gly Gln Lys Cys Arg Thr Trp
1 5 10 15
Claims (10)
1. An antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide, wherein the antioxidant polypeptide comprises an amino acid sequence as shown in the following:
Arg-Gly-Pro-Pro-Lys-Cys-Ala-Thr-Tyr-Gly-Gln-Lys-Cys-Arg-Thr-Trp。
2. the antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide of claim 1, wherein the primary structure of the complete sequence of the antioxidant polypeptide is as follows:
Arg-Gly-Pro-Pro-Lys-Cys-Ala-Thr-Tyr-Gly-Gln-Lys-Cys-Arg-Thr-Trp。
3. the antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide of claim 2, wherein the antioxidant polypeptide has a molecular weight of 1852.14Da, an isoelectric point of 9.85, a net charge of 4, and a destabilization factor of 1.41.
4. The method for preparing the antioxidant polypeptide derived from horseshoe crab antimicrobial peptide as claimed in any one of claims 1 to 3, wherein the antioxidant polypeptide derived from horseshoe crab antimicrobial peptide is obtained by chemical synthesis by Fmoc polypeptide solid phase synthesis method according to the amino acid sequence of the antioxidant polypeptide.
5. The method of claim 4, wherein the antioxidant polypeptide derived from horseshoe crab antimicrobial peptide is obtained by purifying the polypeptide by reverse phase high performance liquid chromatography after chemically synthesizing the polypeptide by Fmoc polypeptide solid phase synthesis.
6. Use of the anti-oxidant polypeptide derived from horseshoe crab antimicrobial peptide according to any one of claims 1 to 3 in the preparation of anti-oxidant drugs, health products, food additives and anti-oxidant cosmetics.
7. An antioxidant agent comprising the antioxidant polypeptide derived from horseshoe crab antimicrobial peptide according to any one of claims 1 to 3.
8. A health product comprising the antioxidant polypeptide derived from horseshoe crab antimicrobial peptide according to any one of claims 1 to 3.
9. A food additive comprising the antioxidant polypeptide derived from horseshoe crab antimicrobial peptide according to any one of claims 1 to 3.
10. An antioxidant cosmetic comprising the antioxidant polypeptide derived from the antimicrobial peptide of Tachypleus tridentatus according to any one of claims 1 to 3.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202110474639.3A CN113402595B (en) | 2021-04-29 | 2021-04-29 | Antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide, and preparation and application thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202110474639.3A CN113402595B (en) | 2021-04-29 | 2021-04-29 | Antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide, and preparation and application thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN113402595A true CN113402595A (en) | 2021-09-17 |
CN113402595B CN113402595B (en) | 2022-04-12 |
Family
ID=77677725
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202110474639.3A Active CN113402595B (en) | 2021-04-29 | 2021-04-29 | Antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide, and preparation and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN113402595B (en) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN103613645A (en) * | 2013-11-26 | 2014-03-05 | 大连理工大学 | Antioxidant peptide sourced from limnonectes fragilis as well as gene and application thereof |
CN107266530A (en) * | 2017-07-03 | 2017-10-20 | 大连理工大学 | Anti-oxidant ultrashort peptide, preparation method and applications |
CN112694525A (en) * | 2020-12-29 | 2021-04-23 | 中国科学院海洋研究所 | Small molecular polypeptide and antibacterial and antiviral application thereof |
-
2021
- 2021-04-29 CN CN202110474639.3A patent/CN113402595B/en active Active
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN103613645A (en) * | 2013-11-26 | 2014-03-05 | 大连理工大学 | Antioxidant peptide sourced from limnonectes fragilis as well as gene and application thereof |
CN107266530A (en) * | 2017-07-03 | 2017-10-20 | 大连理工大学 | Anti-oxidant ultrashort peptide, preparation method and applications |
CN112694525A (en) * | 2020-12-29 | 2021-04-23 | 中国科学院海洋研究所 | Small molecular polypeptide and antibacterial and antiviral application thereof |
Also Published As
Publication number | Publication date |
---|---|
CN113402595B (en) | 2022-04-12 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN103694320A (en) | Preparation method of plecanatide | |
CN105017387A (en) | Method for preparing linaclotide | |
CN108676073B (en) | Anti-obesity decapeptide LLVVYPWTQR and application thereof | |
CN101357938B (en) | Method for synthesizing Exenatide from solid phase polypeptide | |
SK166997A3 (en) | Peptide and method of obtaining it | |
FI92708C (en) | Process for the preparation of a polypeptide useful as a drug | |
CN111533800A (en) | Novel somatotropin-releasing hormone analogous peptide modification and dimerization preparation and application thereof | |
CN113402595B (en) | Antioxidant polypeptide derived from tachypleus tridentatus antimicrobial peptide, and preparation and application thereof | |
CN117050146A (en) | Hyaluronic acid modified cosmetic peptide, preparation method and application thereof | |
CN116836255A (en) | Chemical synthesis preparation method of mu-conotoxin peptide | |
CN106860854A (en) | Octreotide acetate injection pharmaceutical composition and octreotide acetate | |
WO2022141615A1 (en) | Synthesis method for atosiban | |
CN111808169B (en) | Solid-phase synthesis method of melanotan I | |
CN1199986C (en) | Trivalent iron porphrin and its derivative-short peptide compound and its synthesis | |
CN113214376A (en) | Novel method for synthesizing centipede toxin RhTX and spider toxin GsMTx4 | |
CN107022000B (en) | Acetyl amidated pentadecapeptide, and purification method and application thereof | |
CN113880916B (en) | Yak skin antioxidant polypeptide and preparation method and application thereof | |
CN117045534B (en) | Novel use of hexapeptide | |
CN110981939A (en) | Preparation method of polycaprolactam | |
CN117720619A (en) | Polypeptide, anti-photoaging polypeptide and application of polypeptide | |
CN103012555A (en) | Preparation method for new polypeptide having tissue protection activity, and application of new polypeptide in treatment | |
CN118126127A (en) | Repair cyclic peptide and preparation method and application thereof | |
CN112500454A (en) | Preparation method of Iseganan | |
CN106916204B (en) | Acetamidoated heptapeptide, and purification method and application thereof | |
CN116640821A (en) | Ba Sha Yubiao collagen oligopeptide based on terminal peptide removal and preparation method and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |