CN112386687B

CN112386687B - Stem cell exosome and application thereof in medicines and cosmetics

Info

Publication number: CN112386687B
Application number: CN202011425970.8A
Authority: CN
Inventors: 张海涛; 王青
Original assignee: Ailing Yimei International Health Consulting Service Beijing Co ltd
Current assignee: Ailing Yimei international health consulting service (Beijing) Co.,Ltd.
Priority date: 2020-12-09
Filing date: 2020-12-09
Publication date: 2021-05-04
Anticipated expiration: 2040-12-09
Also published as: CN112386687A

Abstract

The invention relates to a method for efficiently culturing a stem cell exosome and application of the stem cell exosome in cosmetics. The invention provides an exosome prepared from umbilical cord blood stem cells and a TRP-2 fragment with a high antigen immunogenicity epitope, and a plurality of specific TRP-2 monoclonal antibodies are prepared, and the antibodies and the exosome are used together to have a synergistic effect of enhancing the effect of inhibiting the proliferation of melanoma cells, so that the antibodies can be used for preparing whitening cosmetics or medicines and pharmaceutical compositions for inhibiting the proliferation of the melanoma cells. Has better application value and prospect.

Description

Stem cell exosome and application thereof in medicines and cosmetics

Technical Field

The invention relates to the field of medicines and cosmetics, in particular to a stem cell exosome and application thereof in medicines and cosmetics.

Background

Exosomes (exosomes) are a class of vesicles that are secreted extracellularly by cells. The exosome has unique physicochemical properties, has the diameter of 30-200 nm and the density of 1.13-1.19 g/mL, comprises substances such as lipid, protein, RNA, DNA and the like related to cell sources, and is connected with a large number of sugar chains such as mannose, poly lactosamine, alpha 2, 6-sialic acid and the like on the surface. Common phospholipids in exosomes include sphingomyelin, cholesterol, phosphatidylcholine, ceramide, phosphatidylcholine, and the like. The intact vesicle structure of exosomes can protect its internal biomolecules from various enzymes in the body fluid, thus maintaining its integrity and biological activity. For example, mRNAs and miRNAs contained in exosomes have functions of translating proteins, promoting viral infection, and the like after entering recipient cells. It is estimated that a single exosome contains approximately 100 copies of protein and 10000 copies of nucleotides.

Since exosomes can reflect the characteristics of cells from which they are derived, exosomes from different stem cells exhibit different biological functions, and the most concerned type of stem cell exosomes are derived from mesenchymal stem cells. Mesenchymal stem cells are present in bone marrow, fat, cord blood, dental pulp, synovial fluid, and the like, and are multifunctional stem cells capable of self-renewal. Mesenchymal stem cells have unique advantages in the field of cell therapy due to their functions of multidirectional differentiation, promotion of tissue repair, anti-inflammation, immunosuppression, protection of nerves and the like. A large number of research works show that the mesenchymal stem cells play their physiological functions in a paracrine mode, and exosomes play an important role in the functional performance of the mesenchymal stem cells as a medium for transmitting information among cells. Researches show that the exosome derived from the mesenchymal stem cells can repair tissue damage, whiten skin, inhibit tumor growth and the like.

The skin is the largest organ of the human body, located on the outermost surface of the human body structure. The main functions of the medicine are to play a role of immune barrier, protect human body from invasion of external harmful substances, pathogens and the like, and also have the functions of regulating the metabolism of the organism, feeling touch and the like. However, the skin is often damaged by various intrinsic pathologies and external mechanical factors, these acute and chronic skin defects place a heavy burden on the patient and society, and moreover, skin whitening is also an important option for the skin. The exosome is taken as a subcellular component secreted by the mesenchymal stem cell, the special bilayer structure protects the content of the exosome from being relatively stable and damaged, the exosome realizes multi-path regulation on receptor cells by transporting various bioactive components (protein, lipid, nucleic acid and the like), plays an important role in the aspects of tissue repair and regeneration, skin whitening, pathogenesis disclosure, immune regulation participation and the like, and makes cell-free treatment possible. At present, research finds that exosome serving as a vector paracrine by stem cells can deliver signals such as protein, lipid and nucleic acid to receptor cells, so that multiple links and multiple cells in the exosome are influenced to promote skin whitening, repair and regeneration.

In the prior art, licoflavone (glabridin) is an oil-soluble licorice extract and is a good whitening component. The whitening effect mainly comes from the inhibition of tyrosinase, the inhibition of dopamine tautomerase (TRP-2) activity and the inhibition of the polymerization of 5, 6-Dihydroxyindole (DHI). Glycyrrhiza extract also interferes with the cell proliferation cycle, and inhibits cell growth. With the increase of the dosage, the number of the melanocytes is obviously reduced, and the whitening effect is further realized. At present, there are not many substances aiming at the inhibition of TRP-2 activity.

In addition, there may be effects of different effects due to exosomes secreted from different stem cells, and cosmetics for synergistic whitening are not enough at present. Therefore, it is an object of the art to provide a novel cosmetic composition for whitening exosomes.

Disclosure of Invention

The invention firstly provides an umbilical cord blood stem cell exosome. The exosome can be used for inhibiting proliferation of melanoma cells, and is used for preparing cosmetics for whitening or medicines for inhibiting proliferation of melanoma cells.

The invention also provides a TRP-2 epitope peptide protein sequence with high antigenic activity, and the sequence is shown as SEQ ID NO: 1 is shown.

In another aspect of the invention, a monoclonal antibody specific for TRP-2 is provided. The heavy chain variable region sequence of the monoclonal antibody is shown as SEQ ID NO: 2, the light chain variable region sequence is shown as SEQ ID NO: 3, respectively.

In certain embodiments, the monoclonal antibody comprises an antibody or antigen-binding fragment thereof.

In certain embodiments, the antibody comprises a Fab, Fab ', F (ab)2, Fv fragment, F (ab') 2, scFv, di-scFv and/or dAb.

In certain embodiments, the antibody is selected from the group consisting of: monoclonal antibodies, chimeric antibodies, humanized antibodies, and fully human antibodies.

The invention provides a cosmetic for whitening or a medicine for inhibiting proliferation of melanoma cells, wherein the cosmetic or the medicine contains the exosome and a monoclonal antibody specific to TRP-2.

The present invention relates to cosmetic compositions. In particular, compositions and methods are disclosed that can be used to improve the visual appearance of skin. In some aspects, the compositions disclosed herein can include a combination of ingredients, for example, for depigmenting cells, increasing skin lightening. This combination of ingredients can be included in a wide range of product formulations (e.g., serum, eye cream, toner, gel, mask, face mask, etc.).

The composition can have a pH of about 6 to about 9 in non-limiting aspects. In other aspects, the pH can be 1, 2, 3, 4, 5,6, 7, 8, 9, 10, 11, 12, 13, or 14. The composition may comprise triglycerides. Non-limiting examples include small, medium and large chain triglycerides. In some aspects, the triglyceride is a medium chain triglyceride (e.g., tricaprylin decanoate). The composition may also comprise a preservative. Non-limiting examples of preservatives include methyl paraben, propyl paraben or a mixture of methyl paraben and propyl paraben.

The compositions disclosed herein may further comprise any one, any combination, or all of the following additional ingredients: water, chelating agents, humectants, preservatives, thickeners, silicone-containing compounds, essential oils, structuring agents, vitamins, pharmaceutical ingredients, non-naturally occurring compounds, or antioxidants, or any combination of such ingredients or mixtures of such ingredients. In certain aspects, the composition can comprise at least two, three, four, five, six, seven, eight, nine, ten, or all of the additional ingredients noted in the preceding sentence. Non-limiting examples of these additional ingredients are indicated throughout this specification and are incorporated in this section by reference. Amounts of such ingredients may range from 0.0001% to 99.9% by weight or volume of the composition, or in any integer or range as disclosed in the remainder of this specification, which is incorporated by reference in this paragraph.

The present invention also provides kits comprising the compositions disclosed herein. In certain embodiments, the composition is contained in a container. The container may be a bottle, a dispenser or a package. The container may dispense a predetermined amount of the composition. In certain aspects, the composition is dispensed as a spray, bolus, or fluid. The container may contain indicia on its surface. The indicia may be words, abbreviations, pictures or symbols.

The present invention also provides that the compositions disclosed throughout this specification can be used as leave-on or rinse-off compositions. For example, a leave-on composition can be a composition that is topically applied to the skin and left on the skin for a period of time (e.g., at least 5,6, 7, 8, 9, 10, 20, or 30 minutes, or at least 1, 2, 3, 4, 5,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 hours, or overnight or entire day). Alternatively, the rinse-off composition may be a product intended to be applied to the skin and then removed or washed off (such as with water) from the skin within a period of time, such as less than 5, 4, 3, 2, or 1 minute. Examples of rinse-off compositions may be skin cleansers, shampoos, conditioners or soaps. Examples of leave-on compositions may be skin moisturizers, sunscreens, masks, night creams or day creams.

Advantageous effects

The invention provides an exosome prepared from umbilical cord blood stem cells and a TRP-2 fragment with a high antigen immunogenicity epitope, and a specific TRP-2 monoclonal antibody is prepared, and the antibody and the exosome are used together to have a synergistic effect of enhancing the effect of inhibiting the proliferation of melanoma cells, so that the antibody can be used for preparing whitening cosmetics or medicines and pharmaceutical compositions thereof for inhibiting the proliferation of the melanoma cells. Has better application value and prospect.

Drawings

FIG. 1 exosome diameter distribution map

FIG. 2 immunogenic epitope analysis map of TRP-2 protein

FIG. 3TRP-2western blot results

FIG. 4TRP-2 protein inhibitory Effect map

Detailed Description

The terms or dictionary meanings or conventions used herein and in the appended claims should not be construed as limited thereto, and the inventors have found that the best method of the present invention will be described below per se for properly defining the concept of the terms, which can be construed in technical meaning and concept according to the principle of the present invention.

Therefore, the present invention includes the disclosed embodiments, the disclosure of which is described only in the most preferred embodiments of the present invention and the technical spirit of the present invention with reference to the embodiments and the accompanying drawings, and it is understood that these features can be replaced with various equivalent changes when the application thereof is made.

Example 1 preparation of cord blood Stem cell exosomes

Culturing P3 generation cord blood stem cell (product number: ZQ0266, Johan new boat biotechnology limited in Shanghai) in 10cm culture dish, and carrying out passage according to 1:4 when cell proliferation and fusion reach 80%; when the P4 cells are fused to the logarithmic growth phase, the culture medium is discarded, PBS is rinsed twice, DMEM/F12 culture medium without FBS is added into a 6 mL/dish, the culture medium is collected after 24h and is separated from a new tube, and the separation of exosome is carried out: precooling low-temperature centrifuge, ultracentrifuge to 4 deg.C, 300g, 4 deg.C centrifuging for 10min, removing cell debris, transferring supernatant after centrifugation into ultracentrifuge tube, supplementing with PBS, 29500g, centrifuging at 4 deg.C for 20min, further removing cell and debris

Filtering the supernatant by a 0.22 mu m filter, centrifuging to remove particles larger than 200nm, filtering the supernatant, centrifuging for 90min at 4 ℃ in another ultracentrifuge tube, 120000g, removing the supernatant, completely sucking liquid on the tube wall by sterile filter paper, taking the exosome at the tube bottom, adding corresponding liquid, and preserving at-80 ℃ for later use. NTA detection: 1ml of filtered PBS was used to homogenize the exosomes; wiping the sample cell to ensure that no particles are attached to the outer tube wall on the light path; the exosome solution is slowly injected into the sample cell by properly inclining the sample cell; and (4) placing the sample cell into an instrument, and performing computer detection according to the operation rules of the instrument. The results are shown in FIG. 1.

As can be seen from the results of FIG. 1, the statistical analysis of the most important parameters of the particle size distribution characteristics resulted in the exosome particle size of 30-110nm, the major peak of the particle size of 80nm, and the average particle size of 78.6 nm.

Example 2 screening of highly active epitope peptide of TRP-2 protein

From the amino acid sequence of human TRP-2, dominant epitopes as shown in FIG. 2 were obtained from scoring results by epitope screening according to the quantitative motif scheme. According to the optimized antigen screening rule, the inventor screens and obtains the high antigen immunogenicity epitope of the TRP-2 protein:

LWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPP (SEQ ID NO: 1). Low epitope fragment: FFPWLKVYYYRFVIGLRVWQWEVISCKLIKRATTRQP are provided.

EXAMPLE 3 preparation of TRP-2 monoclonal antibody

Taking TRP-2 protein high antigen epitope protein as immunogen, emulsifying with Freund's complete adjuvant until uniform, and primarily immunizing 6 SPF BALB/c female mice subcutaneously with the immunizing dose of 50 μ g/mouse. The booster immunization was carried out after emulsification of the recombinant protein with Freund's incomplete adjuvant every two weeks at an immunization dose of 40. mu.g for a total of three immunizations. After the third boosting immunization, the mice with the highest serum titer in the third boosting immunization are subjected to intraperitoneal impact immunization by using 50 mu g of recombinant protein, and 2 times of cell fusion are carried out according to a conventional method, wherein the fusion rate is 60%. Positive screening is carried out on culture supernatant of the hybridoma cells by an indirect ELISA method, low-antigen epitope fragments are used as a reverse screen, a limiting dilution method is adopted to clone positive cells, and cloning is carried out for 3-5 times until the growth holes of the cells are 100% positive. Obtaining 3 high-positive hybridoma cells which stably secrete anti-TRP-2 monoclonal antibodies, namely 3D2, 4F4 and 5F 1; after continuous culture for 1 month in vitro and repeated freezing and recovery, the three hybridoma cells can still maintain stable antibody secretion capacity.

Preparing a ascites type monoclonal antibody, measuring the potency and identifying subclasses: after the positive hybridoma cell strain is subjected to amplification culture, inoculating the positive hybridoma cell strain to the abdominal cavity of a Balb/c mouse which is treated by liquid paraffin in advance according to a conventional method, collecting ascites after 10-14 days, purifying a monoclonal antibody by using ProteinA, and identifying that the ascites titer is more than 1: placing at-20 deg.C for use; and Ig subclass determination, namely taking 100 ng/hole of TRP-2 high antigen epitope protein as antigen coating, taking the obtained ascites monoclonal antibody as a primary antibody, respectively adding goat anti-mouse IgG-HRP and goat anti-mouse IgG, G1, G2a, G2b and G3-HRP as secondary antibodies, adding TMB substrate for color development, and determining the OD value at 450nm by using an enzyme-labeling instrument. The results are shown in table 1 below.

TABLE 1 subtype identification of monoclonal antibodies

Cell line numbering	Subtype of cell	Light chain
			3D2	G1	κ
4F4	G1	κ
			5F1	G2a	κ

As can be seen from the results in table 1, 3D2 and 4F4 belong to IgG1, and 5F1 belongs to IgG2a subclasses.

EXAMPLE 43 cloning of variable region Gene of monoclonal antibody sequence D2

The 3D2 antibody has a binding constant of 10.1nM against TRP-2 protein and good binding property, which is detected by a common Kd detection method (ELASA method).

Based on the 5' RACE technical principle of TAKARA, the cDNA sequence of the mouse antibody variable region expressed by the hybridoma cell strain is cloned. Briefly, variable region gene-specific cDNAs for heavy and light chains were synthesized using SMARTer 5' RACE synthesis kit as specified. Modifying the 5 'end and the 3' end of the cDNA sequence by using PCR primers, wherein the primers are designed to add proper leader sequences on heavy chain and light chain variable region cDNA respectively, so that the obtained PCR product can be cloned to a heavy chain vector pHB-Fc and a light chain vector pHB-Ck expressed by the existing recombinant antibody by a seamless cloning method. The pHB-Fc expression vector contains a human IgG1 heavy chain constant region gene sequence; the pHB-C kappa vector contains human kappa light chain constant region gene sequences. The heavy chain and light chain variable region PCR amplification products are cloned to an expression vector through an In-fusion cloning reagent and transformed into E.coli DH5 alpha competent cells. The antibody variable region sequences were obtained by selecting monoclonal colonies for Sanger sequencing and analysis. Wherein the sequences of the light chain variable region sequence and the heavy chain variable region of the 3D2 antibody are respectively as follows:

light chain variable region (SEQ ID NO: 3)

DIVLTQSPSLMQASAGEKRTITCCVSQSICSGMLGWYQQKSGISPKPWIYDTENQAYGVPARFSGAGSGTSYSLTITSMEAEDAATYYCAQGSTSPLAFGAGTKLELK

Heavy chain variable region (SEQ ID NO: 2)

EVQLEESRTELARAGASVKLALKASGYIFSSYSGWWIKQRPGAGLELIGYPEPGWIDTRYTQKDTGKATLTADKSSSTLYMQLSSLASEDSAVAYCAGSYFRSDAWGLGTTLAVSS。

Example 53 WesternBlot assay of the D2 monoclonal antibody

WesternBlot detection of monoclonal antibody A WesternBlot test was carried out after treatment of TRP-2 protein, TRP-2 protein high antigen immunogenic peptide LWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPP and low antigen epitope peptide FFPWLKVYYYRFVIGLRVWQWEVISCKLIKRATTRQP with Loading buffer, respectively, the primary antibody was the prepared 3D2 monoclonal antibody, and the secondary antibody was DyLight800 goat anti-mouse IgG. The results are shown in FIG. 3. The results showed that

lanes

2 and 3 exhibited specific 3D2 monoclonal antibody binding specifically to the TRP-2 protein and the TRP-2 protein high antigen immunogenic peptide, and lane 1 showed that the monoclonal antibody did not react with the low epitope peptide.

Example 63 inhibition of melanocytes by D2 monoclonal antibodies and exosomes

Taking B16 cells in logarithmic growth phase at 5X 10³Inoculating the cells/well in 96-well cell culture plate, at 37 deg.C and 5% CO₂The incubator is incubated for 24h, 0, 50, 100 and 200mg/L of purified 3D2 are added respectively, the culture is continued, and at 24, 48 and 72h respectively, the OD value at 570nm is read by adding MTT color development. The results are shown in table 2 below.

TABLE 2 results of cytostatic rates

Concentration of monoclonal antibody	Inhibition rate for 24 hours%	Inhibition rate of 48 h%	Inhibition rate for 72 h%
				0mg/L	0	0	0
50mg/L	17±1.6	23±2.0	27±2.1
				100mg/L	25±2.3	30±1.9	39±2.4
200mg/L	35±3.1	42±2.8	52±3.0

From the results in table 2, it can be seen that 3D2 has a growth inhibitory effect on B16 cells. When the mass concentration of the 3D2 monoclonal antibody is more than 50mg/L, the B16 cell proliferation can be inhibited; after 50mg/L acts for 24 hours, 48 hours and 72 hours, the cell inhibition rate is respectively (17 +/-1.6)%, (23 +/-2.0)% and (27 +/-2.1)%; after 100mg/L of the mixture is acted for 24 hours, 48 hours and 72 hours, the cell inhibition rate is respectively (25 +/-2.3)%, (30 +/-1.9)% and (39 +/-2.4)%. After 200mg/L is acted for 24, 48 and 72 hours, the cell inhibition rate is respectively (35 +/-3.1)%, (42 +/-2.8)% and (52 +/-3.0)%. The 3D2 monoclonal antibody can inhibit B16 cell proliferation in a time-dependent and concentration-dependent relationship. The polyclonal antibody was selected at a concentration of 100mg/L for subsequent experiments.

The collected exosomes were combined with monoclonal antibodies at different concentrations of 10mg/L, 50mg/L and 100mg/L, respectively, and the results are shown in Table 3 below after 24, 48 and 72 hours of action according to the above inhibition method.

TABLE 3 results of cytostatic rates

As can be seen from the results in Table 3, the exosomes were able to synergistically enhance the cell proliferation-inhibitory effect of the mabs, and were concentration-dependent.

Example 73 Effect of D2 monoclonal and exosomes on cellular TRP-2 protein expression levels

The cells treated with 0mg/L of the monoclonal antibody, 100mg/L of the monoclonal antibody, and 100mg/L of the monoclonal antibody +100mg/L of the exosome in example 6 for 72 hours were diluted with the lysate, the supernatant liquid and the experimental tube were taken, the diluted cells were placed in a high-temperature water tank (100 ℃) for about 5 minutes, the diluted cells were placed on ice cubes for rapid cooling and sample loading, the 3D2 monoclonal antibody was used as a detection tool, western felt was used for identification and protein relative expression amount identification, and β -actin was used as a control, and the results are shown in FIG. 4.

As can be seen from the results of FIG. 4, the protein expression of TRP-2 was effectively inhibited.

Example 83 Effect of monoclonal antibody + exosomes of D2 on mouse transplantable tumors

B16 cells growing in logarithmic phase are digested by trypsin, centrifuged to prepare cell suspension, and inoculated in the right groin of mouse by about 2X 10 injection⁵Cell/cell. After 3 weeks, successful model mice with transplanted tumors (the length diameter is more than or equal to 5mm) are screened, and the mice with transplanted tumors are divided into 5 groups by adopting a random number table method, namely a physiological saline group (0.9% sodium chloride injection and NS control group), a 100mg/(kg & 7d) monoclonal antibody group, a 100mg/(kg & 7d) monoclonal antibody +100mg/(kg & 7d) exosome group, and 10 mice in each group. The duration was 28d, the mice were subsequently sacrificed, the tumor mass was dissected and weighed, and the tumor inhibition rate was calculated. The results are shown in Table 4 below.

TABLE 4 mouse tumor inhibition Rate results

The results in table 4 show that the treatment group using the mab + exosomes can achieve a tumor inhibition rate of 81.68% at most, and has a better inhibition effect.

While the present invention has been described in detail with reference to the preferred embodiments, it should be understood that the above description should not be taken as limiting the invention. Various modifications and alterations to this invention will become apparent to those skilled in the art upon reading the foregoing description. Accordingly, the scope of the invention should be determined from the following claims.

Sequence listing

<110> Beijing Song Biotechnology Ltd

<120> a stem cell exosome and application thereof in medicines and cosmetics

<160> 3

<170> SIPOSequenceListing 1.0

<210> 1

<211> 40

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 1

Leu Trp Pro Arg Lys Phe Phe His Arg Thr Cys Lys Cys Thr Gly Asn

1 5 10 15

Phe Ala Gly Tyr Asn Cys Gly Asp Cys Lys Phe Gly Trp Thr Gly Pro

20 25 30

Asn Cys Glu Arg Lys Lys Pro Pro

35 40

<210> 2

<211> 116

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 2

Glu Val Gln Leu Glu Glu Ser Arg Thr Glu Leu Ala Arg Ala Gly Ala

1 5 10 15

Ser Val Lys Leu Ala Leu Lys Ala Ser Gly Tyr Ile Phe Ser Ser Tyr

20 25 30

Ser Gly Trp Trp Ile Lys Gln Arg Pro Gly Ala Gly Leu Glu Leu Ile

35 40 45

Gly Tyr Pro Glu Pro Gly Trp Ile Asp Thr Arg Tyr Thr Gln Lys Asp

50 55 60

Thr Gly Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr Leu Tyr

65 70 75 80

Met Gln Leu Ser Ser Leu Ala Ser Glu Asp Ser Ala Val Ala Tyr Cys

85 90 95

Ala Gly Ser Tyr Phe Arg Ser Asp Ala Trp Gly Leu Gly Thr Thr Leu

100 105 110

Ala Val Ser Ser

115

<210> 3

<211> 108

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 3

Asp Ile Val Leu Thr Gln Ser Pro Ser Leu Met Gln Ala Ser Ala Gly

1 5 10 15

Glu Lys Arg Thr Ile Thr Cys Cys Val Ser Gln Ser Ile Cys Ser Gly

20 25 30

Met Leu Gly Trp Tyr Gln Gln Lys Ser Gly Ile Ser Pro Lys Pro Trp

35 40 45

Ile Tyr Asp Thr Glu Asn Gln Ala Tyr Gly Val Pro Ala Arg Phe Ser

50 55 60

Gly Ala Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Thr Ser Met Glu

65 70 75 80

Ala Glu Asp Ala Ala Thr Tyr Tyr Cys Ala Gln Gly Ser Thr Ser Pro

85 90 95

Leu Ala Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys

100 105

Claims

1. A pharmaceutical composition comprising a 3D2 monoclonal antibody, wherein the heavy chain variable region sequence of said monoclonal antibody is as set forth in SEQ ID NO: 2, the light chain variable region sequence is shown as SEQ ID NO: 3, respectively.

2. A cosmetic characterized by: the monoclonal antibody containing 3D2 has the heavy chain variable region sequence as shown in SEQ ID NO: 2, the light chain variable region sequence is shown as SEQ ID NO: 3 is shown in the specification; meanwhile, the umbilical cord blood mesenchymal stem cell exosome is also contained.

3. The pharmaceutical composition according to claim 1 or the cosmetic according to claim 2, characterized in that the monoclonal antibody is an antibody or an antigen-binding fragment thereof.

4. Pharmaceutical composition or cosmetic product according to claim 3, characterized in that said antibody comprises a Fab, Fab ', F (ab)2, Fv fragment, F (ab') 2, scFv, di-scFv and/or dAb.

5. The cosmetic according to claim 2, wherein the cosmetic is in the form of a serum, an eye cream, a toner, a gel, a mask or a hand cream.

6. The cosmetic of claim 5, wherein: a combination of ingredients for increasing skin lightening is also added.