CN112225803A - Nanobodies and uses thereof - Google Patents

Nanobodies and uses thereof Download PDF

Info

Publication number
CN112225803A
CN112225803A CN202011123929.5A CN202011123929A CN112225803A CN 112225803 A CN112225803 A CN 112225803A CN 202011123929 A CN202011123929 A CN 202011123929A CN 112225803 A CN112225803 A CN 112225803A
Authority
CN
China
Prior art keywords
amino acid
acid sequence
nanobody
rsv
gly
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
CN202011123929.5A
Other languages
Chinese (zh)
Other versions
CN112225803B (en
Inventor
袁若森
宋月爽
陈晓旭
丁楠
原秀娟
汤鑫
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
CHANGCHUN BCHT BIOTECHNOLOGY Co
Original Assignee
CHANGCHUN BCHT BIOTECHNOLOGY Co
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by CHANGCHUN BCHT BIOTECHNOLOGY Co filed Critical CHANGCHUN BCHT BIOTECHNOLOGY Co
Priority to CN202011123929.5A priority Critical patent/CN112225803B/en
Publication of CN112225803A publication Critical patent/CN112225803A/en
Application granted granted Critical
Publication of CN112225803B publication Critical patent/CN112225803B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • C07K16/1027—Paramyxoviridae, e.g. respiratory syncytial virus
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56983—Viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/22—Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567—Framework region [FR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
    • G01N2333/08—RNA viruses
    • G01N2333/115—Paramyxoviridae, e.g. parainfluenza virus
    • G01N2333/135—Respiratory syncytial virus
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2469/00—Immunoassays for the detection of microorganisms
    • G01N2469/10—Detection of antigens from microorganism in sample from host

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Virology (AREA)
  • Chemical & Material Sciences (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Biotechnology (AREA)
  • Food Science & Technology (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Pulmonology (AREA)
  • Microbiology (AREA)
  • Genetics & Genomics (AREA)
  • Cell Biology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The invention relates to the field of biomedicine, in particular to a nano antibody aiming at RSV F protein and application of a coding sequence thereof in diagnosis and treatment. The RSV nano antibody provided by the invention has unique CDR1, 2 and 3 region sequences, so that the antibody has specific recognition and binding capacity to RSV antigen. Without cross-reacting with other non-specific proteins. The RSV derivative shows good neutralizing activity through neutralizing activity detection, and can be used alone or in combination with other medicaments or antibodies and the like for preparing RSV therapeutic medicaments.

Description

Nanobodies and uses thereof
Technical Field
The invention relates to the field of biomedicine, in particular to a nano antibody aiming at RSV F protein and application of a coding sequence thereof in diagnosis and treatment.
Background
Respiratory Syncytial Virus (RSV) is the leading cause of severe lower respiratory tract disease in infants, the elderly, and immunocompromised individuals. RSV infects respiratory tract mucous epithelial cells, and viral proteins can cause complex signal transduction in cells, so that various cytokines are abnormally expressed, which can be the reason of causing serious lower respiratory tract diseases. An important feature of the related inactivated vaccine to aggravate the disease is to induce a large secretion of the related cytokines, thereby causing unbalanced humoral and cellular immune responses.
RSV belongs to the genus pneumovirus of the family Paramyxoviridae, has a single-stranded RNA genome encoding 11 proteins, 3 of which are the transmembrane envelope glycoprotein F protein (fusion protein), G protein (occlusion protein) and SH protein (small hydrophobic protein), and is classified into A, B subtypes according to the antigenicity of the G protein. The F protein causes penetration of the RSV ribonucleoprotein into the cytoplasm by mediating fusion of RSV with the host cell membrane. After infection, the F protein expressed on the cell membrane promotes the fusion of the infected cell with the cell membrane of the adjacent cell to form a syncytium.
The F protein has high antigen homology among different subtypes of RSV, is a main cross-protective antigen and is a main target antigen of Cytotoxic T Lymphocyte (CTL), therefore, the F protein is an important target antigen of an immune system of an organism, can mediate generation of protective antibodies and cellular immune response, and can provide cross protection. F is one of the most important surface structural proteins of RSV, and as the most important neutralizing antigen, the F protein has a large number of neutralizing antibody recognition epitopes.
Monoclonal antibodies are still deficient in some applications: the large molecular mass (150kDa) limits the tissue penetration capacity; can cause immune reaction in vivo, and further neutralize the activity of the antibody; the longer half-life limits their use in molecular imaging; the production operation is complex and the production cost is high.
In 1993, scientists found Heavy chain antibodies (HcAbs) naturally lacking light chains in camels, and the antigen binding domain variable region of the Heavy chain antibodies (HcAbs) is also called VHH or nanobodies (Nb), which provides a new development direction for antibody miniaturization research. Subsequently, similar antigen receptors (NAR) have been found in camels in mollusks. Compared with other small molecule antibodies, the nano antibody has unique properties such as small molecular mass (12-15 kDa), high affinity, low immunogenicity, good solubility, good stability, high expression level and the like, so that the nano antibody has more advantages in the aspects of disease diagnosis and treatment. Therefore, the nano antibody aiming at the RSV F protein and the application of the coding sequence thereof in diagnosis and treatment are provided with important practical significance.
Disclosure of Invention
In view of the above, the present invention provides a nanobody against RSV virus F protein and the use of its coding sequence in diagnosis and therapy.
In order to achieve the above object, the present invention provides the following technical solutions:
the invention provides nanobodies comprising three complementarity determining regions CDR1, CDR2, CDR 3; wherein
(I) The complementarity determining region CDR1 of the nano antibody has an amino acid sequence shown in SEQ ID No. 1; and/or
The complementarity determining region CDR2 of the nano antibody has an amino acid sequence shown in SEQ ID No. 2; and/or
The complementarity determining region CDR3 of the nanobody has an amino acid sequence shown in SEQ ID No.3 or 4;
or (II) an amino acid sequence obtained by substituting, deleting or adding one or more amino acids in the amino acid sequence of (I) and has the same function with the amino acid sequence of (I);
or (III), an amino acid sequence having 80% or more identity to the amino acid sequence of (I) or (II).
In some embodiments of the invention, the nanobody further comprises four constant regions FR1, FR2, FR3, FR4, wherein,
(IV) the constant region FR1 of the nanobody has an amino acid sequence shown as SEQ ID No. 5; and/or
The constant region FR2 of the nano antibody has an amino acid sequence shown as SEQ ID No. 6; and/or
The constant region FR3 of the nano antibody has an amino acid sequence shown as SEQ ID No. 7; and/or
The constant region FR4 of the nano antibody has an amino acid sequence shown as SEQ ID No. 8;
or (V) an amino acid sequence obtained by substituting, deleting or adding one or more amino acids in the amino acid sequence described In (IV), and the amino acid sequence has the same function with the amino acid sequence described In (IV);
or (VI), an amino acid sequence having 80% or more identity to the amino acid sequence of (IV) or (V).
In some embodiments of the present invention,
(VII) the nano antibody has an amino acid sequence shown as SEQ ID No.9 or 10;
or
(VIII) an amino acid sequence obtained by substituting, deleting or adding one or more amino acids to the amino acid sequence described in (VII), and the amino acid sequence has the same function with the amino acid sequence described in (VII);
or
(IX) and an amino acid sequence having 80% or more identity to the amino acid sequence of (VII) or (VIII).
The invention also provides a dimer of the nano antibody,
(X), the dimer of the nano antibody has an amino acid sequence shown as SEQ ID No.11 or 12;
or
(XI) an amino acid sequence obtained by substituting, deleting or adding one or more amino acids in the amino acid sequence described in (X), and the amino acid sequence has the same function with the amino acid sequence described in (X);
or
(XII) or an amino acid sequence having an identity of 80% or more to the amino acid sequence of (X) or (XI).
The invention also provides a humanized RSV nanobody,
(XIII), wherein the humanized RSV nanobody has an amino acid sequence shown as SEQ ID No.13 or 14; or
(XIV) an amino acid sequence obtained by substituting, deleting or adding one or more amino acids to the amino acid sequence described in (XIII), and the amino acid sequence is functionally identical to the amino acid sequence described in (XIII);
or
(XV), an amino acid sequence having more than 80% identity with the amino acid sequence of (XIII) or (XIV).
In the present invention, the plurality is 2, 3, 4 or 5.
Based on the research, the invention also provides a nucleotide for encoding the nano-antibody, a dimer for encoding the nano-antibody or a nucleotide for encoding the humanized RSV nano-antibody.
The invention also provides an expression vector comprising the nucleotide.
In addition, the invention also provides a host cell for transforming or transfecting the expression vector.
The invention also provides a conjugate which comprises the nano-antibody chemically labeled or biomarker, the dimer of the nano-antibody or the humanized RSV nano-antibody.
In the present invention, the chemical label is an isotope, immunotoxin and/or chemical drug; the biomarker is a biotin, avidin, or enzyme label. The enzyme label is preferably horseradish peroxidase or alkaline phosphatase. The immunotoxin is preferably aflatoxin, diphtheria toxin, pseudomonas aeruginosa exotoxin, ricin, abrin, mistletoe agglutinin, modeccin, PAP, nystatin, gelonin or luffa toxin.
Based on the research, the invention also provides a conjugate prepared by coupling the nano-antibody, the dimer of the nano-antibody, the humanized RSV nano-antibody or the conjugate with a solid medium or a semisolid medium.
In the present invention, the solid medium or non-solid medium is selected from colloidal gold, polystyrene plate or bead.
The invention also provides application of the nano-antibody, the dimer of the nano-antibody, the humanized RSV nano-antibody, the conjugate and/or the conjugate in preparation of an RSV virus diagnostic reagent and/or a kit.
The invention also provides application of the nano-antibody, the dimer of the nano-antibody, the humanized RSV nano-antibody, the conjugate and/or the conjugate in preparation of a medicament for preventing and/or treating RSV virus related diseases.
Based on the research, the invention also provides an RSV virus diagnostic reagent, which comprises the nano-antibody, the dimer of the nano-antibody, the humanized RSV nano-antibody, the conjugate and/or the conjugate and acceptable auxiliary agents.
The invention also provides an RSV virus diagnosis kit, which comprises the nano-antibody, the dimer of the nano-antibody, the humanized RSV nano-antibody, the conjugate and/or the conjugate, and acceptable auxiliary agents and/or carriers.
The invention also provides a disease diagnosis method, wherein the RSV virus diagnostic reagent or the RSV virus diagnostic kit is used for detecting RSV expression, and whether the disease is caused or not is judged according to the expression quantity.
Based on the research, the invention also provides a medicament for preventing and/or treating RSV virus-related diseases, which comprises the nano-antibody, the dimer of the nano-antibody, the humanized RSV nano-antibody, the conjugate and/or the conjugate and acceptable auxiliary materials.
In addition, the invention also provides a method for preventing and/or treating diseases, and the medicament is administered.
The invention firstly immunizes camel with RSV gene engineering recombinant F protein, separates peripheral blood lymphocyte of the immune camel after 4 times of immunization, and constructs a specific RSV gene engineering recombinant F protein heavy chain antibody gene library. And coating the recombinant F protein on an enzyme label plate, and screening the immunized nano antibody library by using a phage display technology to obtain the nano antibody for resisting the recombinant F protein. The constructed nano antibody prokaryotic expression vector is introduced into escherichia coli, and is purified after expression, and the purified RSV nano antibody can be specifically combined with recombinant F protein and can effectively neutralize RSV virus.
The RSV nano antibody provided by the invention has unique CDR1, 2 and 3 region sequences, so that the antibody has specific recognition and binding capacity to RSV antigen. But not with other non-specific cross-reactive proteins. The RSV derivative shows good neutralizing activity through neutralizing activity detection, and can be used alone or in combination with other medicaments or antibodies and the like for preparing RSV therapeutic medicaments.
Drawings
In order to more clearly illustrate the embodiments of the present invention or the technical solutions in the prior art, the drawings used in the description of the embodiments or the prior art will be briefly described below.
FIG. 1 shows the results of 1.5% gel identification of single domain antibody PCR products;
FIG. 2 shows the results of the identification of 1% gel by double digestion of the vector;
FIG. 3 shows the results of positive rate of bacteria PCR of single colonies;
FIG. 4 shows an electropherogram after affinity purification of an antibody;
FIG. 5 shows the binding activity of an antibody to the F protein;
FIG. 6 shows single domain antibody neutralizing activity;
FIG. 7 shows single domain antibody humanization and dimer neutralization activity measurements;
FIG. 8 shows photographs of RSV virus negative and positive fluorescent identification; wherein, a shows RSV virus negative (-) photographs; b shows RSV virus positive (+) photographs.
Detailed Description
The invention discloses a nano antibody aiming at RSV F protein and the application of the coding sequence thereof in diagnosis and treatment, and the technical personnel can use the content to reference the text and appropriately improve the process parameters to realize the purpose. It is expressly intended that all such similar substitutes and modifications which would be obvious to one skilled in the art are deemed to be included in the invention. While the methods and applications of this invention have been described in terms of preferred embodiments, it will be apparent to those of ordinary skill in the art that variations and modifications in the methods and applications described herein, as well as other suitable variations and combinations, may be made to implement and use the techniques of this invention without departing from the spirit and scope of the invention.
The invention firstly immunizes camel with RSV gene engineering recombinant F protein, separates peripheral blood lymphocyte of the immune camel after 4 times of immunization, and constructs a specific RSV gene engineering recombinant F protein heavy chain antibody gene library. And coating the recombinant F protein on an enzyme label plate, and screening the immunized nano antibody library by using a phage display technology to obtain the nano antibody for resisting the recombinant F protein. The constructed nano antibody prokaryotic expression vector is introduced into escherichia coli, and is purified after expression, and the purified RSV nano antibody can be specifically combined with recombinant F protein and can effectively neutralize RSV virus.
The invention provides a nano antibody coding sequence capable of specifically binding RSV (respiratory syncytial virus) F protein, and a preparation method and application thereof.
Specifically, the method comprises the following steps:
the nanobody variable region has 3 complementarity determining regions CDR1, CDR2, CDR3, wherein,
the CDR1 sequence consists of the amino acid sequence shown in SEQ ID No. 1;
the CDR2 sequence consists of the amino acid sequence shown in SEQ ID No. 2;
the CDR3 sequence consists of the amino acid sequence depicted in SEQ ID No.3 or 4.
The nanobody also has constant regions FR1, FR2, FR3, FR4, wherein,
the FR1 sequence consists of the amino acid sequence shown in SEQ ID No. 5;
the FR2 sequence consists of the amino acid sequence shown in SEQ ID No. 6;
the FR3 sequence consists of the amino acid sequence shown in SEQ ID No. 7;
the FR4 sequence consists of the amino acid sequence shown in SEQ ID No. 8.
The invention also provides an amino acid coding sequence for coding the nano antibody, wherein the coding sequence contains SEQ ID NO. 9-10, and can be correspondingly optimized according to different expression systems.
The invention also provides an amino acid sequence for coding the nano antibody dimer, wherein the coding sequence contains SEQ ID NO. 11-12.
The invention also provides an amino acid sequence for coding the humanized RSV nano antibody, wherein the coding sequence contains SEQ ID NO. 13-14.
The invention also provides application of the nano antibody in preparation of a diagnostic reagent for diagnosing RSV.
The invention also provides application of the nano antibody in preparation of RSV (respiratory syncytial virus) therapeutic drugs.
Sequence:
FR1:EVQLQASGGGLVQPGGSLRLS CTASG SEQ No.5
FR2:WYRQAPGKQRELVAT SEQ No.6
FR3:AD SVKGRFTISR DNAKNTVNLQ MNNLNPEDTG VYYC SEQ No.7
FR4:WGQ GTQVTVGS EQKLISEEDL N SEQ No.8
>1-BF-42
CDR1:SIFPLNNMG SEQ No.1
CDR2:ATTRGVINI SEQ No.2
CDR3:YGKFPVGGYMT DY SEQ No.3
>10-Fh-65
CDR1:SIFPLNNMG SEQ No.1
CDR2:ATTRGVINI SEQ No.2
CDR3:YGKFPMGGYMT DY SEQ No.4
SEQ No.9～SEQ No.10：
SEQ No.9 EVQLQASGGGLVQPGGSLRLSCTASG SIFPLNNMGWYRQAPGKQRELVAT ATTRGVINIADSVKGRFTISRDNAKNTVNLQMNNLNPEDTGVYYCYGKFPVGGYMTDYWGQGTQVTVGSEQKLISEEDLN
SEQ No.10 EVQLQASGGGLVQPGGSLRLSCTASG SIFPLNNMG WYRQAPGKQRELVAT ATTRGVINI ADSVKGRFTISRDNAKNTVNLQMNNLNPEDTGVYYC YGKFPMGGYMTDY YGKFPMGGYMTDY WGQGTQVTVGSEQKLISEEDLN
SEQ No.11 EVQLQASGGGLVQPGGSLRLSCTASG SIFPLNNMG WYRQAPGKQRELVAT ATTRGVINI ADSVKGRFTISRDNAKNTVNLQMNNLNPEDTGVYYC YGKFPVGGYMTDYWGQGTQVTVGSEQKLISEEDLN AAA EVQLQASGGGLVQPGGSLRLSCTASG SIFPLNNMG WYRQAPGKQRELVAT ATTRGVINI ADSVKGRFTISRDNAKNTVNLQMNNLNPEDTGVYYC YGKFPVGGYMTDYWGQGTQVTVGSEQKLISEEDLN
SEQ No.12 EVQLQASGGGLVQPGGSLRLSCTASG SIFPLNNMG WYRQAPGKQRELVAT ATTRGVINI ADSVKGRFTISRDNAKNTVNLQMNNLNPEDTGVYYC YGKFPMGGYMTDY YGKFPMGGYMTDY WGQGTQVTVGSEQKLISEEDLN AAA EVQLQASGGGLVQPGGSLRLSCTASG SIFPLNNMG WYRQAPGKQRELVAT ATTRGVINI ADSVKGRFTISRDNAKNTVNLQMNNLNPEDTGVYYC YGKFPMGGYMTDY YGKFPMGGYMTDY WGQGTQVTVGSEQKLISEEDLN
SEQ No.13EVQLQASGGGLVQPGGSLRLSCTASG SIFPLNNMG WYRQAPGKQRELVAT ATTRGVINI ADSVKGRFTISRDNAKNTVNLQMNNLNPEDTGVYYC YGKFPVGGYMTDYWGQGTQVTVGSEQKLISEEDLN DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
SEQ No.14EVQLQASGGGLVQPGGSLRLSCTASG SIFPLNNMG WYRQAPGKQRELVAT ATTRGVINI ADSVKGRFTISRDNAKNTVNLQMNNLNPEDTGVYYC YGKFPMGGYMTDY YGKFPMGGYMTDY WGQGTQVTVGSEQKLISEEDLN DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
The RSV nano antibody provided by the invention has unique CDR1, 2 and 3 region sequences, so that the antibody has specific recognition and binding capacity to RSV antigen. But not with other non-specific cross-reactive proteins. The RSV derivative shows good neutralizing activity through neutralizing activity detection, and can be used alone or in combination with other medicaments or antibodies and the like for preparing RSV therapeutic medicaments.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. With regard to the definitions and terminology in this field, the expert can refer in particular to Current Protocols in Molecular Biology (Ausubel). The abbreviations for amino acid residues are standard 3-letter and/or 1-letter codes used in the art to refer to one of the 20 commonly used L-amino acids.
An "antibody" refers to a protein composed of one or more polypeptides that specifically bind to an antigen. One form of antibody constitutes the basic building block of an antibody. This form is a tetramer, which is composed of two identical pairs of antibody chains, each pair having a light chain and a heavy chain. In each pair of antibody chains, the variable regions of the light and heavy chains are joined together and are responsible for binding to antigen, while the constant regions are responsible for the effector functions of the antibody.
The "variable region" is the N-terminal mature region of the chain. The types of antibodies currently known include kappa and lambda light chains, as well as alpha, gamma (IgG1, IgG2, IgG3, IgG4), delta, epsilon and mu heavy chains or other type equivalents thereof. Full-length immunoglobulin "light chains" (about 25kDa or about 214 amino acids) contain a variable region of about 110 amino acids at the NH 2-terminus and a kappa or lambda constant region at the COOH-terminus. The full-length immunoglobulin "heavy chain" (about 50kDa or about 446 amino acids) likewise comprises a variable region (about 116 amino acids), and one of the heavy chain constant regions, e.g., gamma (about 330 amino acids).
"antibody" includes any isotype of antibody or immunoglobulin, or antibody fragments that retain specific binding to an antigen, including but not limited to Fab, Fv, scFv, and Fd fragments, chimeric antibodies, humanized antibodies, single chain antibodies, and fusion proteins comprising an antigen-binding portion of an antibody and a non-antibody protein. The antibody may be labeled and detected, for example, by a radioisotope, an enzyme capable of producing a detectable substance, a fluorescent protein, biotin, or the like. The antibodies can also be bound to a solid support, including but not limited to polystyrene plates or beads, and the like.
"humanized antibody" refers to an antibody that comprises CDR regions derived from a non-human antibody, and the remainder of the antibody molecule is derived from one (or more) human antibody. Furthermore, to preserve binding affinity, some residues of the backbone (referred to as FR) segment may be modified.
The nano-antibody refers to an antibody which has a natural deletion of a light chain in the peripheral blood of alpaca, only comprises a heavy chain variable region (VHH) and two conventional CH2 and CH3 regions, but is not easy to stick to each other or even aggregate into a block like an artificially modified single chain antibody fragment (scFv). More importantly, the structure of the VHH which is cloned and expressed independently has the structural stability which is equivalent to that of the original heavy chain antibody and the binding activity with the antigen, and is the minimum unit which is known to be combined with the target antigen. The VHH crystal is 2.5nm, 4nm long and has a molecular weight of only 15KD, so the VHH crystal is also called a Nanobody (Nb). VHH has extremely high solubility, is not easy to aggregate, can resist denaturation conditions such as high temperature, strong acid, strong alkali and the like, is suitable for prokaryotic expression and various eukaryotic expression systems, and is widely used in the fields of development of therapeutic antibody medicines, diagnostic reagents, affinity purification matrixes, scientific research and the like. The nano antibody is superior to the traditional antibody in many aspects. The special structure of the VHH single domain antibody based on the alpaca heavy chain antibody has the advantages of the traditional antibody and the micromolecule drug, almost perfectly overcomes the defects of long development period, low stability, harsh storage conditions and the like of the traditional antibody, and gradually becomes a new force in a new generation of therapeutic biological medicine and clinical diagnosis reagents. Compared with the conventional antibody, the nano antibody has the following advantages: 1. the molecular weight is small, and the blood brain barrier can be penetrated; 2. high expression in prokaryotic or eukaryotic systems; 3. the specificity is strong, and the affinity is high; 4. it is poorly immunogenic in humans.
The medicament contains at least one functional component and also comprises a medicinal carrier. Preferably, the pharmaceutically acceptable carrier is water, aqueous buffered solutions, isotonic saline solutions such as PBS (phosphate buffered saline), glucose, mannitol, dextrose, lactose, starch, magnesium stearate, cellulose, magnesium carbonate, 0.3% glycerol, hyaluronic acid, ethanol, or polyalkylene glycols such as polypropylene glycol, triglycerides, and the like. The type of pharmaceutically acceptable carrier used depends inter alia on whether the composition according to the invention is formulated for oral, nasal, intradermal, subcutaneous, intramuscular or intravenous administration. The compositions according to the invention may comprise wetting agents, emulsifiers or buffer substances as additives.
As used herein, "CDR region" or "CDR" refers to the hypervariable regions of the heavy and light chains of an immunoglobulin, as defined by Kabat et al (Kabat et al, Sequences of proteins of immunological interest, 5th Ed., U.S. department of Health and Human Services, NIH, 1991, and later). There are three heavy chain CDRs and three light chain CDRs. As used herein, the term CDR or CDRs is intended to indicate one of these regions, or several or even all of these regions, which comprise the majority of the amino acid residues responsible for binding by the affinity of the antibody for the antigen or its recognition epitope, as the case may be.
As used herein, "FR region" or "FR" refers to a framework region which has a large variation of about 110 amino acid sequences in the N-terminal region of H and L chains of immunoglobulins, and the amino acid sequences of the other portions are relatively constant, whereby the light and heavy chains can be distinguished into a variable region (V) and a constant region (C). VH and VL. The amino acid composition and the order of arrangement of each of the 3 regions are highly variable and are called hypervariable regions (HVRs) or Complementarity Determining Regions (CDRs), CDRl, CDR2 and CDR3, respectively. The amino acid composition and the arrangement order of the regions other than the CDRs are relatively invariant, and are called Framework Regions (FRs). VH and VL, 113 and 107 amino acid residues each, constitute 4 FRs (FRl, FR2, FR3 and FR4 respectively) and 3 CDRs (CDR1, CDR2, CDR 3).
The nano antibody and the raw materials and reagents used in the application thereof provided by the invention can be purchased from the market.
The invention is further illustrated by the following examples:
example 1 animal immunization
Mixing the gene engineering recombinant F protein and Freund's adjuvant in equal volume, emulsifying, immunizing alpaca once every two weeks for 4 times, using Freund's complete adjuvant for the first time, and using incomplete adjuvant for the rest times.
Example 2 serum titer assay in immunized animals
Diluting the recombinant protein F of the genetic engineering to 2 mu g/ml by using 0.05M carbonate coating solution, 100 mu l of the recombinant protein F per hole and staying overnight at 4 ℃; discarding the coating solution the next day, washing for 3 times, each time for 5 min; adding 3% BSA blocking solution, placing 200 μ l of the BSA blocking solution in each hole at 37 ℃ for 2h, washing and drying in vacuum for later use. Adding 100 μ l of serum to be detected diluted with sample diluent into each well, incubating at 37 deg.C for 1h, washing the plate for 5 times, each time for 5 min; adding secondary antibody labeled by HRP, washing the plate for 5 times at 37 ℃ for 5min each time; TMB substrate was added in an amount of 100. mu.l per well at 37 ℃ for 15 min. The reaction was terminated by adding 50. mu.l of 2M sulfuric acid to each reaction well. The results are shown in Table 1
TABLE 1 serum titer ELISA test results for immune animals
Figure BDA0002732954330000081
Example 3 construction of RSV Nanobody library
Taking a proper amount of lymphocytes for RNA extraction. And carrying out reverse transcription by taking the extracted RNA as a template. Two rounds of PCR amplification were performed with single domain specific primers using cDNA as template and identified in 1.2% agarose gel. The first round recovers about 600bp antibody gene fragments, and recovers less than 400bp single domain antibody gene fragments (figure 1). The fragments and the vector were digested with restriction enzymes overnight, and the vector recovered fragments of about 4000bp (FIG. 2). The recovered fragment was ligated with the vector with T4 ligase overnight at 16 ℃. TG1 electrotransformation, take 30 ul of total bacterial liquid after electrotransformation to dilute 1000 times and spread 150 ul on a 15cm plate, culture overnight, count. Library capacity-monoclonal × dilution multiple × total volume ÷ smear volume.
The number of single colonies was 85, the total volume was 75ml, and the library volume calculated from the dilution factor was 4.1X 107cfu。
Scraping off bacteria on a plate with a storage capacity, adding 70% glycerol to ensure that the final concentration of the bacteria liquid is in 15% glycerol, and freezing and storing at-80 ℃. Single colonies were randomly picked for positive rate determination (FIG. 3). Randomly selecting a single colony for sequencing, and checking the sequence repetition rate.
Example 4 phage antibody library panning
The respiratory syncytial virus F protein is coated, and the phage library is subjected to three rounds of affinity screening of adsorption-elution-amplification. Because the antigen contains a section of irrelevant area, irrelevant protein is adopted to firstly carry out phage library adsorption and then is combined with F protein, and the adsorption of non-specific antibodies is reduced.
TABLE 2 phage antibody library panning recovery
Figure BDA0002732954330000091
Amplification of phage antibody library after second round of screening for irrelevant protein adsorption (hectogram PA90)
TABLE 3 result of irrelevant protein adsorption by phage antibody library
Figure BDA0002732954330000092
And the respiratory syncytial virus F protein is taken as a target antigen for affinity screening, the recovery rate of the second round of screening is improved by 93 times compared with that of the first round, the recovery rate of the third round is improved by 0.451 time compared with that of the second round, and the library reaches the enrichment purpose. Because the antigen has a section of irrelevant protein area, the phage antibody library after the second round of amplification is firstly adsorbed by irrelevant protein, then combined with F protein, eluted and amplified (two rounds of screening are carried out). All with different degrees of enrichment.
Example 5 construction of prokaryotic expression library
High-fidelity enzyme is used for PCR reaction, the target gene is about 400bp, and the target gene is purified and recovered. And (3) carrying out double-enzyme digestion on the PCR product and the vector pSJF2, and purifying and recovering. The molecular weight ratio vector to PCR was 1:3 according to the ligase specification. TG1 were electrotransformed, 100 ul/plate was plated on LB/Amp plates and incubated overnight at 32 ℃. Colony PCR identifies transformation efficiency. 96 single clones were randomly picked and cultured in 96-well plates and screened for ELISA positive clones. And culturing and preserving positive clones, and carrying out sample sequencing. Based on the sequencing results, the different types of CDR1, CDR2 and CDR3 are classified. After typing, the monoclonal antibody to be expressed and purified is selected.
Example 6 expression and isolation and purification of RSV antibodies
Expression of RSV Nanobodies
Inserting the gene sequence of the nano antibody into an expression vector pET23a, and transferring the gene sequence into a colon bacillus BL21 cell; LB medium was used. The culture was carried out at 37 ℃. When the concentration of the thallus reaches OD6001-1.5, IPTG with the concentration of 1M is added for induction; continuously culturing for 3-4h, removing the upward line and collecting the thallus. Resuspend the cells with lysis buffer, and lyse the cells with ultrasound. The supernatant and the pellet were collected. The nanobodies were detected by 15% SDS-PAGE electrophoresis.
Purification of RSV Nanobodies
And (3) purifying the protein by adopting a Ni-NTA affinity chromatography column:
(1) loading buffer for column chromatography (20mM PBS, 50mM imidazole, 500mM NaCl)
After the buffer solution is balanced, adding the supernatant collected by centrifugation;
(2) first, the mixture was washed with a washing buffer (20mM PBS, 100mM imidazole, 500mM NaCl)
Washing to remove impurity proteins, eluting with an elution buffer (20mM PBS, 500mM imidazole, 500mM NaCl) and collecting the eluate;
(3) the purified antibody was subjected to 15% SDS-PAGE to examine the purification of the protein. As shown in FIG. 4, the molecular weight of the antibody is between 15 and 20 KD.
Example 7 binding Activity of RSV Nanobodies
Diluting RSV gene engineering recombinant F protein by 100 times, coating a 96-hole ELISA plate, standing overnight at 4 ℃ and 100 ul/hole; blocking for 2h at 37 ℃. Diluting the nano antibody by 3 times, incubating for 1h at 37 ℃, and washing for 3 times; using an anti-His tag antibody marked by HRP as a secondary antibody, incubating at 37 ℃ for 1h, and washing for 5 times; adding 100 mul/hole of substrate color development liquid; developing at 37 deg.C in dark for 15 min; the reaction was stopped with 2M sulfuric acid; and carrying out colorimetric detection by using the wavelength of 450nm, and analyzing the result. As shown in FIG. 5 or tables 4-5, the OD values and antibody concentrations of the detection results showed significant dose-dependent effects.
TABLE 4.1BF42 binding Activity of antibody to F protein
Figure BDA0002732954330000101
TABLE 5.10Fh65 binding Activity of antibodies to F protein
Figure BDA0002732954330000102
Example 8 determination of neutralizing Activity of RSV antibodies
(1) Antibody was added, one 96-well plate was used in the lateral direction, and the antibody to be examined was serially diluted 3-fold, and 50. mu.l of sample diluent was added to each well. Adding 25 mul of corresponding sample into each hole, uniformly mixing the samples from the first row by a gun, sucking 25 mul to the second row, uniformly mixing the samples, sequentially uniformly mixing the samples, diluting the samples until the samples in the last row are discarded by 25 mul.
(2) Dilution of RSV A2 strain (confirmation of 2X 10 Virus)4PFU/ml): after dilution, 50. mu.l/well was added to a 96-well plate, and cells were negative without virus.
(3) Patting the cell culture plate, mixing well, placing at 37 deg.C and 5% CO2And (5) incubating for 2 h.
(4) Digesting the cells with the digestive juice to prepare a cell suspension having a concentration of 1-2X 105Adding 0.1mL of cell suspension into each well, mixing, placing at 37 deg.C and 5% CO2And (5) incubating and culturing in an incubator.
(5) CPE was observed daily using an inverted microscope with the end titer being the reciprocal of the highest dilution of serum that inhibited 50% cytopathic effects, and the results were determined after 6 days of culture.
(6) And (3) dyeing method: after cell observation, the cell can be judged by a staining method, supernatant is discarded, 100 mu l/hole of crystal violet staining fixing solution is added, and staining is carried out for 24 h.
(7) The staining solution was removed, and the plates were washed with running water, left to dry.
(8) Neutralizing antibody titers were determined, defined as the last antibody dilution with more than 50% of intact HEP2 cells, i.e. one viable unit (U) with no pathology occurring in the neutralized 50% HEP2 cells.
Neutralization activity As shown in FIG. 6 or Table 6, the neutralization activities of BF-42 and 10Fh65 were 3.7U/mg and 2.8U/mg, respectively.
TABLE 6 neutralizing Activity of Single Domain antibodies
Classes of antibodies Positive 1BF42 10FH65 Negative
Neutralizing Activity 850 3.7 2.8 0.03
EXAMPLE 9 use of the RSV Virus detection formulations (ELISA)
(1) Emulsifying 50-100 ug/dose of RSV gene engineering recombinant F protein with Freund's adjuvant to uniformly immunize New Zealand white rabbit, using Freund's complete adjuvant for the first time, and using incomplete adjuvant for the other three times;
(2) coating a 96-well ELISA plate after 300-fold dilution of the obtained F protein antiserum, and keeping the temperature at 4 ℃ overnight at 100 ul/well;
(3) blocking for 2h at 37 ℃. Diluting the protein F by 2 times, incubating for 1h at 37 ℃, and washing for 3 times;
(4) adding 1ug/ml nanometer antibody, incubating at 37 deg.C for 1h, and washing for 5 times;
(5) adding an anti-His tag antibody marked by HRP, incubating for 1h at 37 ℃, and washing for 5 times; adding 100 mul/hole of substrate color development liquid;
(6) developing at 37 deg.C in dark for 15 min; the reaction was stopped with 2M sulfuric acid; and carrying out colorimetric detection by using the wavelength of 450nm, and analyzing the result. As shown in Table 7, the OD value of the detection result and the result concentration of the F protein antigen present obvious dose-dependent effects, and are very suitable for detecting the concentration of the F protein antigen.
TABLE 7 results of F protein detection by Sandwich ELISA
Dilution factor 4 8 16 32 64 128 256
1BF42OD1 1.758 1.308 0.896 0.552 0.317 0.178 0.085
1BF42OD2 1.737 1.274 0.835 0.552 0.308 0.169 0.078
10Fh65OD1 2.216 1.659 1.200 0.683 0.417 0.216 0.106
10Fh65OD2 2.197 1.590 1.032 0.611 0.336 0.180 0.089
EXAMPLE 10 use of antibody derivatives
Molecular weight of Single Domain antibody VHH was ligated by AAA as Linker to form homodimer, and Monomer (Monomer) and Dimer (Dimer) of 1-BF-42 were prepared and Monomer (Monomer) and Dimer (Dimer) of 10-Fh-65 were prepared simultaneously with the expression and isolation purification of RSV antibody according to example 6.
The humanized single-domain antibody is prepared by expression in a transient transfection mode
1. Preparation of plasmids 1-BF-42-hFC and 10-Fh-65-hFC
1) Designing, optimizing and synthesizing DNA sequences of 1-BF-42-hFC and 10-Fh-65-hFC;
2) subcloning the complete sequence into pcDNA3.4 vector;
3) transfection grade plasmids were prepared for expression of Expi293F cells.
2. Cell culture and transient transfection:
1) expi293F cells expression medium (Thermo Fisher Scientific) was grown in serum-free Expi 293.
2) Cells were stored in Erlenmeyer flasks at 37 ℃ with 8% CO2Put on a shaking incubator.
3) The day before transfection, cells were seeded at the appropriate density in a petri dish.
4) On the day of transfection, the DNA and Expifeacylamine (TM) 293 reagent were mixed in optimal proportions and then added to the flasks in which the cells were to be transfected.
5) Culturing Expi293F cells in the transient cotransfection suspension of the target antibody recombinant plasmid.
6) Cell culture supernatants collected on day 6 were used for purification.
3. Purification of 1-BF-42-hFC and 10-Fh-65-hFC
1) The cell culture fluid is filtered after centrifugation.
2) The filtered cell culture supernatant was loaded onto an affinity purification (monoaffinity a Resin) column at an appropriate flow rate.
3) After washing with the appropriate buffer and elution, the eluted fractions are mixed and exchanged for the buffer final formulation buffer.
The obtained single domain antibody dimer and the humanized antibody are subjected to the neutralization activity determination of the RSV antibody in example 8, and the detection result is shown in figure 7 or table 8, which shows that the neutralization activity of the antibody after dimerization or humanization of the single domain antibody is remarkably improved, and the single domain antibody dimer and the humanized antibody have good neutralization effect on RSV viruses.
TABLE 8 detection of Single Domain antibody humanization and dimer neutralization Activity
Figure BDA0002732954330000121
Example 11 measurement of animal level neutralization Activity of antibodies and derivatives thereof
(1) Preparing virus suspension, inoculating RSV A2 strain on Hep-2 cell, culturing conventionally, shaking the cell bottle when cell fusion lesion is most obvious, making the cell fall off from the bottle wall, repeatedly freezing and thawing for 3 times, centrifuging at 4 deg.C (800 Xg, 10min), and removing cell loose piece. The virus suspension was collected and subjected to virus titration for animal vaccination.
(2) The animal inoculation process adopts a nasal cavity inoculation method. After the guinea pig (3 per group) was completely anesthetized, 50TCID was slowly instilled into the nasal cavity50Virus and 50 active units of RSV antibody suspension 0.3 ml; adding 0.3ml PBS into negative control group animal; the positive control group was slowly dropped with 0.3ml of 50TCID50 virus suspension. 1 time per day, and 3 days.
(3) Lung tissue specimen treatment Guinea pigs were sacrificed by acute blood loss. Under sterile conditions, a portion of lung tissue was removed and placed in sterile Hank's solution for virus isolation.
(4) And (3) lung tissue virus separation, namely shearing a fresh lung tissue specimen under an aseptic condition, grinding the lung tissue specimen, inoculating the ground lung tissue specimen into a Hep-2 cell bottle, observing cytopathic effect, collecting the specimen when the cells fuse the pathological effects, and identifying the RSV by an immunofluorescence method.
The immunofluorescence method comprises preparing antigen sheet from Hep-2 cells containing virus antigen, fixing with cold acetone for 20 min, taking out, and air drying. Adding 1 drop of RSV/FITC antibody reagent into each hole, incubating for 30 minutes at 37 ℃, sealing by using matrix solution after air drying, and moving to a fluorescence microscope for observation.
As shown in table 9 and fig. 8, the results of the in vivo neutralization activity assay in guinea pigs indicate that the single domain antibodies and derivatives thereof exhibit good neutralization activity at the animal level.
TABLE 9 results of in vivo neutralization activity assay of single domain antibodies and their derivatives in guinea pigs
Figure BDA0002732954330000131
The foregoing is only a preferred embodiment of the present invention, and it should be noted that, for those skilled in the art, various modifications and decorations can be made without departing from the principle of the present invention, and these modifications and decorations should also be regarded as the protection scope of the present invention.
Sequence listing
<110> Changchun Baike Biotechnology Ltd
<120> nanobody and use thereof
<130> MP2018747
<160> 14
<170> SIPOSequenceListing 1.0
<210> 1
<211> 9
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 1
Ser Ile Phe Pro Leu Asn Asn Met Gly
1 5
<210> 2
<211> 9
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 2
Ala Thr Thr Arg Gly Val Ile Asn Ile
1 5
<210> 3
<211> 13
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 3
Tyr Gly Lys Phe Pro Val Gly Gly Tyr Met Thr Asp Tyr
1 5 10
<210> 4
<211> 13
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 4
Tyr Gly Lys Phe Pro Met Gly Gly Tyr Met Thr Asp Tyr
1 5 10
<210> 5
<211> 26
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 5
Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly
20 25
<210> 6
<211> 15
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 6
Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val Ala Thr
1 5 10 15
<210> 7
<211> 36
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 7
Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
1 5 10 15
Asn Thr Val Asn Leu Gln Met Asn Asn Leu Asn Pro Glu Asp Thr Gly
20 25 30
Val Tyr Tyr Cys
35
<210> 8
<211> 22
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 8
Trp Gly Gln Gly Thr Gln Val Thr Val Gly Ser Glu Gln Lys Leu Ile
1 5 10 15
Ser Glu Glu Asp Leu Asn
20
<210> 9
<211> 130
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 9
Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Ser Ile Phe Pro Leu Asn
20 25 30
Asn Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
35 40 45
Ala Thr Ala Thr Thr Arg Gly Val Ile Asn Ile Ala Asp Ser Val Lys
50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asn Leu
65 70 75 80
Gln Met Asn Asn Leu Asn Pro Glu Asp Thr Gly Val Tyr Tyr Cys Tyr
85 90 95
Gly Lys Phe Pro Val Gly Gly Tyr Met Thr Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Gln Val Thr Val Gly Ser Glu Gln Lys Leu Ile Ser Glu Glu Asp
115 120 125
Leu Asn
130
<210> 10
<211> 143
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 10
Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Ser Ile Phe Pro Leu Asn
20 25 30
Asn Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
35 40 45
Ala Thr Ala Thr Thr Arg Gly Val Ile Asn Ile Ala Asp Ser Val Lys
50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asn Leu
65 70 75 80
Gln Met Asn Asn Leu Asn Pro Glu Asp Thr Gly Val Tyr Tyr Cys Tyr
85 90 95
Gly Lys Phe Pro Met Gly Gly Tyr Met Thr Asp Tyr Tyr Gly Lys Phe
100 105 110
Pro Met Gly Gly Tyr Met Thr Asp Tyr Trp Gly Gln Gly Thr Gln Val
115 120 125
Thr Val Gly Ser Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu Asn
130 135 140
<210> 11
<211> 263
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 11
Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Ser Ile Phe Pro Leu Asn
20 25 30
Asn Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
35 40 45
Ala Thr Ala Thr Thr Arg Gly Val Ile Asn Ile Ala Asp Ser Val Lys
50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asn Leu
65 70 75 80
Gln Met Asn Asn Leu Asn Pro Glu Asp Thr Gly Val Tyr Tyr Cys Tyr
85 90 95
Gly Lys Phe Pro Val Gly Gly Tyr Met Thr Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Gln Val Thr Val Gly Ser Glu Gln Lys Leu Ile Ser Glu Glu Asp
115 120 125
Leu Asn Ala Ala Ala Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Leu
130 135 140
Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Ser
145 150 155 160
Ile Phe Pro Leu Asn Asn Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys
165 170 175
Gln Arg Glu Leu Val Ala Thr Ala Thr Thr Arg Gly Val Ile Asn Ile
180 185 190
Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
195 200 205
Asn Thr Val Asn Leu Gln Met Asn Asn Leu Asn Pro Glu Asp Thr Gly
210 215 220
Val Tyr Tyr Cys Tyr Gly Lys Phe Pro Val Gly Gly Tyr Met Thr Asp
225 230 235 240
Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Gly Ser Glu Gln Lys Leu
245 250 255
Ile Ser Glu Glu Asp Leu Asn
260
<210> 12
<211> 289
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 12
Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Ser Ile Phe Pro Leu Asn
20 25 30
Asn Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
35 40 45
Ala Thr Ala Thr Thr Arg Gly Val Ile Asn Ile Ala Asp Ser Val Lys
50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asn Leu
65 70 75 80
Gln Met Asn Asn Leu Asn Pro Glu Asp Thr Gly Val Tyr Tyr Cys Tyr
85 90 95
Gly Lys Phe Pro Met Gly Gly Tyr Met Thr Asp Tyr Tyr Gly Lys Phe
100 105 110
Pro Met Gly Gly Tyr Met Thr Asp Tyr Trp Gly Gln Gly Thr Gln Val
115 120 125
Thr Val Gly Ser Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu Asn Ala
130 135 140
Ala Ala Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Leu Val Gln Pro
145 150 155 160
Gly Gly Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Ser Ile Phe Pro
165 170 175
Leu Asn Asn Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu
180 185 190
Leu Val Ala Thr Ala Thr Thr Arg Gly Val Ile Asn Ile Ala Asp Ser
195 200 205
Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val
210 215 220
Asn Leu Gln Met Asn Asn Leu Asn Pro Glu Asp Thr Gly Val Tyr Tyr
225 230 235 240
Cys Tyr Gly Lys Phe Pro Met Gly Gly Tyr Met Thr Asp Tyr Tyr Gly
245 250 255
Lys Phe Pro Met Gly Gly Tyr Met Thr Asp Tyr Trp Gly Gln Gly Thr
260 265 270
Gln Val Thr Val Gly Ser Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu
275 280 285
Asn
<210> 13
<211> 357
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 13
Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Ser Ile Phe Pro Leu Asn
20 25 30
Asn Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
35 40 45
Ala Thr Ala Thr Thr Arg Gly Val Ile Asn Ile Ala Asp Ser Val Lys
50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asn Leu
65 70 75 80
Gln Met Asn Asn Leu Asn Pro Glu Asp Thr Gly Val Tyr Tyr Cys Tyr
85 90 95
Gly Lys Phe Pro Val Gly Gly Tyr Met Thr Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Gln Val Thr Val Gly Ser Glu Gln Lys Leu Ile Ser Glu Glu Asp
115 120 125
Leu Asn Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu
130 135 140
Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
145 150 155 160
Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val
165 170 175
Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
180 185 190
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser
195 200 205
Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
210 215 220
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
225 230 235 240
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
245 250 255
Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
260 265 270
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
275 280 285
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
290 295 300
Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
305 310 315 320
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
325 330 335
Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
340 345 350
Leu Ser Pro Gly Lys
355
<210> 14
<211> 370
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 14
Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Ser Ile Phe Pro Leu Asn
20 25 30
Asn Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
35 40 45
Ala Thr Ala Thr Thr Arg Gly Val Ile Asn Ile Ala Asp Ser Val Lys
50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asn Leu
65 70 75 80
Gln Met Asn Asn Leu Asn Pro Glu Asp Thr Gly Val Tyr Tyr Cys Tyr
85 90 95
Gly Lys Phe Pro Met Gly Gly Tyr Met Thr Asp Tyr Tyr Gly Lys Phe
100 105 110
Pro Met Gly Gly Tyr Met Thr Asp Tyr Trp Gly Gln Gly Thr Gln Val
115 120 125
Thr Val Gly Ser Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu Asn Asp
130 135 140
Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly
145 150 155 160
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
165 170 175
Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu
180 185 190
Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His
195 200 205
Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg
210 215 220
Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys
225 230 235 240
Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu
245 250 255
Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr
260 265 270
Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu
275 280 285
Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
290 295 300
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
305 310 315 320
Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp
325 330 335
Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His
340 345 350
Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
355 360 365
Gly Lys
370

Claims (17)

1. Nanobody, characterized in that it comprises three complementarity determining regions CDR1, CDR2, CDR 3; wherein
(I) The complementarity determining region CDR1 of the nano antibody has an amino acid sequence shown in SEQ ID No. 1; and/or
The complementarity determining region CDR2 of the nano antibody has an amino acid sequence shown in SEQ ID No. 2; and/or
The complementarity determining region CDR3 of the nanobody has an amino acid sequence shown in SEQ ID No.3 or 4;
or (II) an amino acid sequence obtained by substituting, deleting or adding one or more amino acids in the amino acid sequence of (I) and has the same function with the amino acid sequence of (I);
or (III), an amino acid sequence having 80% or more identity to the amino acid sequence of (I) or (II).
2. The nanobody of claim 1, further comprising four constant regions FR1, FR2, FR3, FR4, wherein,
(IV) the constant region FR1 of the nanobody has an amino acid sequence shown as SEQ ID No. 5; and/or
The constant region FR2 of the nano antibody has an amino acid sequence shown as SEQ ID No. 6; and/or
The constant region FR3 of the nano antibody has an amino acid sequence shown as SEQ ID No. 7; and/or
The constant region FR4 of the nano antibody has an amino acid sequence shown as SEQ ID No. 8;
or (V) an amino acid sequence obtained by substituting, deleting or adding one or more amino acids in the amino acid sequence described In (IV), and the amino acid sequence has the same function with the amino acid sequence described In (IV);
or (VI), an amino acid sequence having 80% or more identity to the amino acid sequence of (IV) or (V).
3. The nanobody of claim 1,
(VII) the nano antibody has an amino acid sequence shown as SEQ ID No.9 or 10;
or
(VIII) an amino acid sequence obtained by substituting, deleting or adding one or more amino acids to the amino acid sequence described in (VII), and the amino acid sequence has the same function with the amino acid sequence described in (VII);
or
(IX) and an amino acid sequence having 80% or more identity to the amino acid sequence of (VII) or (VIII).
4. The dimer of nanobodies according to any one of claims 1 to 3,
(X), the dimer of the nano antibody has an amino acid sequence shown as SEQ ID No.11 or 12;
or
(XI) an amino acid sequence obtained by substituting, deleting or adding one or more amino acids in the amino acid sequence described in (X), and the amino acid sequence has the same function with the amino acid sequence described in (X);
or
(XII) or an amino acid sequence having an identity of 80% or more to the amino acid sequence of (X) or (XI).
5. A humanized RSV nanobody, which is characterized in that,
(XIII), wherein the humanized RSV nanobody has an amino acid sequence shown as SEQ ID No.13 or 14;
or
(XIV) an amino acid sequence obtained by substituting, deleting or adding one or more amino acids to the amino acid sequence described in (XIII), and the amino acid sequence is functionally identical to the amino acid sequence described in (XIII);
or
(XV), an amino acid sequence having more than 80% identity with the amino acid sequence of (XIII) or (XIV).
6. A nucleotide encoding the nanobody of any one of claims 1 to 3, a dimer encoding the nanobody of claim 5, or a nucleotide encoding the humanized RSV nanobody of claim 5.
7. An expression vector comprising the nucleotide of claim 6.
8. A host cell transformed or transfected with the expression vector of claim 7.
9. Conjugate comprising a chemically or biologically labeled nanobody according to any one of claims 1 to 3, a dimer thereof according to claim 4 or a humanized RSV nanobody according to claim 5.
10. A nanobody according to any one of claims 1 to 3, a dimer of a nanobody according to claim 4 or a humanized RSV nanobody according to claim 5 or a conjugate prepared by coupling a conjugate according to claim 9 to a solid or semi-solid medium.
11. Use of the nanobody of any one of claims 1 to 3, the dimer thereof of claim 4, the humanized RSV nanobody of claim 5, the conjugate thereof of claim 9 and/or the conjugate thereof of claim 10 for the preparation of an RSV viral diagnostic reagent and/or kit.
12. Use of the nanobody of any one of claims 1 to 3, the dimer thereof of claim 4, the humanized RSV nanobody of claim 5, the conjugate thereof of claim 9 and/or the conjugate thereof of claim 10 for the preparation of a medicament for the prevention and/or treatment of RSV virus-related diseases.
An RSV virus diagnostic reagent comprising the nanobody of any one of claims 1 to 3, the dimer of the nanobody of claim 4, the humanized RSV nanobody of claim 5, the conjugate of claim 9 and/or the conjugate of claim 10 and acceptable auxiliary agents.
An RSV virus diagnostic kit comprising the nanobody of any one of claims 1 to 3, the dimer of the nanobody of claim 4, the humanized RSV nanobody of claim 5, the conjugate of claim 9 and/or the conjugate of claim 10 and acceptable auxiliaries and/or carriers.
15. A method for diagnosing a disease, comprising detecting RSV expression using the RSV viral diagnostic reagent according to claim 13 or the RSV viral diagnostic kit according to claim 14, and determining whether or not a disease is present based on the expression level.
16. Medicament for the prevention and/or treatment of RSV virus-related diseases, comprising nanobodies according to any of claims 1 to 3, dimers of nanobodies according to claim 4, humanized RSV nanobodies according to claim 5, conjugates according to claim 9 and/or conjugates according to claim 10 and acceptable excipients.
17. Method for the prophylaxis and/or treatment of diseases, characterized in that a medicament according to claim 16 is administered.
CN202011123929.5A 2020-10-20 2020-10-20 Nanobodies and uses thereof Active CN112225803B (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN202011123929.5A CN112225803B (en) 2020-10-20 2020-10-20 Nanobodies and uses thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN202011123929.5A CN112225803B (en) 2020-10-20 2020-10-20 Nanobodies and uses thereof

Publications (2)

Publication Number Publication Date
CN112225803A true CN112225803A (en) 2021-01-15
CN112225803B CN112225803B (en) 2022-08-05

Family

ID=74118063

Family Applications (1)

Application Number Title Priority Date Filing Date
CN202011123929.5A Active CN112225803B (en) 2020-10-20 2020-10-20 Nanobodies and uses thereof

Country Status (1)

Country Link
CN (1) CN112225803B (en)

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101679513A (en) * 2007-03-06 2010-03-24 西福根有限公司 Recombinant antibodies for treatment of respiratory syncytial virus infections
CN106496324A (en) * 2015-11-30 2017-03-15 天津昊免生物技术有限公司 A kind of human antibody of anti respiratory syncytial virus
CN110016079A (en) * 2018-12-18 2019-07-16 珠海泰诺麦博生物技术有限公司 The neutralizing antibody of anti respiratory syncytial virus and its application
CN111606992A (en) * 2019-02-25 2020-09-01 天津昊免生物技术有限公司 Fully human antibody for resisting respiratory syncytial virus

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101679513A (en) * 2007-03-06 2010-03-24 西福根有限公司 Recombinant antibodies for treatment of respiratory syncytial virus infections
CN106496324A (en) * 2015-11-30 2017-03-15 天津昊免生物技术有限公司 A kind of human antibody of anti respiratory syncytial virus
CN110016079A (en) * 2018-12-18 2019-07-16 珠海泰诺麦博生物技术有限公司 The neutralizing antibody of anti respiratory syncytial virus and its application
CN111606992A (en) * 2019-02-25 2020-09-01 天津昊免生物技术有限公司 Fully human antibody for resisting respiratory syncytial virus

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
芦起等: "呼吸道合胞病毒F蛋白基因片段原核表达和初步应用", 《第四军医大学学报》 *
魏薇等: "抗呼吸道合胞病毒融合蛋白单链抗体的筛选及初步鉴定", 《中国生物工程杂志》 *

Also Published As

Publication number Publication date
CN112225803B (en) 2022-08-05

Similar Documents

Publication Publication Date Title
WO2016173559A1 (en) Preparation and use of murine monoclonal antibody against gi.1 norovirus
CN114702576B (en) Single domain antibody for resisting novel coronavirus S protein receptor binding region, and coding gene and application thereof
EP1178829A1 (en) Human monoclonal antibody
CN112225804A (en) Nanobodies and uses thereof
CN114685664B (en) Single-domain antibody for resisting human B lymphocyte surface antigen CD20 and application thereof
CN112225803B (en) Nanobodies and uses thereof
CN112225805B (en) Nanobodies and uses thereof
WO2022179535A1 (en) Anti-sars-cov-2 nucleocapsid protein monoclonal antibody, and preparation method therefor and use thereof
US20050175986A1 (en) Human monoclonal antibody
CN109942702A (en) A kind of full molecule IgG of people mouse inosculating antibody HEV and its application
WO2021238854A1 (en) Monoclonal antibody against sars-cov-2 spike protein, preparation method therefor, and application thereof
CN111205364B (en) Monoclonal neutralizing antibody against HPV31L1 and application thereof
CN112250761A (en) Nanobodies and uses thereof
CN112225800A (en) Nanobodies and uses thereof
CN112225802A (en) Nanobodies and uses thereof
CN112225801A (en) Nanobodies and uses thereof
CN111205366B (en) Monoclonal neutralizing antibody against HPV45L1 and application thereof
CN117480179A (en) Antibodies to respiratory syncytial virus and uses thereof
CN101198374B (en) Antibody or fragment thereof having anti-HIV neutralizing activity
CN116425868A (en) Anti-coxsackievirus A10 monoclonal antibody, and preparation method and application thereof
WO2022068895A1 (en) Monoclonal antibody of anti-sars-cov-2 spike protein extracellular domain and application thereof
CN111116740B (en) Monoclonal neutralizing antibody of HPV33L1 and application thereof
CN111560067B (en) Monoclonal neutralizing antibody of HPV58L1 and application thereof
CN111662378B (en) Monoclonal neutralizing antibody of HPV18L1 and application thereof
CN111732653B (en) Monoclonal neutralizing antibody of HPV52L1 and application thereof

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
GR01 Patent grant
GR01 Patent grant