CN112074289A - Thioether cyclic peptide amylin receptor modulators - Google Patents
Thioether cyclic peptide amylin receptor modulators Download PDFInfo
- Publication number
- CN112074289A CN112074289A CN201980027903.XA CN201980027903A CN112074289A CN 112074289 A CN112074289 A CN 112074289A CN 201980027903 A CN201980027903 A CN 201980027903A CN 112074289 A CN112074289 A CN 112074289A
- Authority
- CN
- China
- Prior art keywords
- mab
- compound
- formula
- seq
- optionally substituted
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 108091005466 amylin receptors Proteins 0.000 title claims abstract description 21
- 150000003568 thioethers Chemical class 0.000 title claims description 6
- 102000001189 Cyclic Peptides Human genes 0.000 title description 2
- 108010069514 Cyclic Peptides Proteins 0.000 title description 2
- 238000000034 method Methods 0.000 claims abstract description 115
- 238000006467 substitution reaction Methods 0.000 claims abstract description 68
- 150000001875 compounds Chemical class 0.000 claims description 140
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 99
- 239000008194 pharmaceutical composition Substances 0.000 claims description 87
- 201000010099 disease Diseases 0.000 claims description 50
- 208000035475 disorder Diseases 0.000 claims description 49
- 229910052700 potassium Inorganic materials 0.000 claims description 45
- 150000003839 salts Chemical class 0.000 claims description 37
- 208000008338 non-alcoholic fatty liver disease Diseases 0.000 claims description 32
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 claims description 29
- RMRFFCXPLWYOOY-UHFFFAOYSA-N allyl radical Chemical compound [CH2]C=C RMRFFCXPLWYOOY-UHFFFAOYSA-N 0.000 claims description 28
- 208000001072 type 2 diabetes mellitus Diseases 0.000 claims description 23
- 229910052698 phosphorus Inorganic materials 0.000 claims description 22
- 208000008589 Obesity Diseases 0.000 claims description 16
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 claims description 16
- 206010053219 non-alcoholic steatohepatitis Diseases 0.000 claims description 16
- 235000020824 obesity Nutrition 0.000 claims description 16
- 239000003937 drug carrier Substances 0.000 claims description 15
- 230000000694 effects Effects 0.000 claims description 15
- 230000037406 food intake Effects 0.000 claims description 15
- 235000012631 food intake Nutrition 0.000 claims description 15
- 206010060378 Hyperinsulinaemia Diseases 0.000 claims description 14
- 230000002526 effect on cardiovascular system Effects 0.000 claims description 14
- 230000003451 hyperinsulinaemic effect Effects 0.000 claims description 14
- 201000008980 hyperinsulinism Diseases 0.000 claims description 14
- 229940000635 beta-alanine Drugs 0.000 claims description 13
- 208000002705 Glucose Intolerance Diseases 0.000 claims description 12
- 208000001145 Metabolic Syndrome Diseases 0.000 claims description 12
- 201000000690 abdominal obesity-metabolic syndrome Diseases 0.000 claims description 12
- 229910052717 sulfur Inorganic materials 0.000 claims description 12
- 206010022489 Insulin Resistance Diseases 0.000 claims description 11
- 208000032928 Dyslipidaemia Diseases 0.000 claims description 10
- 208000017170 Lipid metabolism disease Diseases 0.000 claims description 10
- 150000002632 lipids Chemical class 0.000 claims description 10
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 claims description 9
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 9
- YSDQQAXHVYUZIW-QCIJIYAXSA-N Liraglutide Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCNC(=O)CC[C@H](NC(=O)CCCCCCCCCCCCCCC)C(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 YSDQQAXHVYUZIW-QCIJIYAXSA-N 0.000 claims description 9
- 108010019598 Liraglutide Proteins 0.000 claims description 9
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 9
- 238000002347 injection Methods 0.000 claims description 9
- 239000007924 injection Substances 0.000 claims description 9
- 229960002701 liraglutide Drugs 0.000 claims description 9
- 206010020772 Hypertension Diseases 0.000 claims description 8
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 claims description 8
- 229940125708 antidiabetic agent Drugs 0.000 claims description 8
- 239000003472 antidiabetic agent Substances 0.000 claims description 8
- 201000001421 hyperglycemia Diseases 0.000 claims description 8
- 208000017169 kidney disease Diseases 0.000 claims description 8
- 201000001320 Atherosclerosis Diseases 0.000 claims description 7
- 206010010356 Congenital anomaly Diseases 0.000 claims description 7
- 201000004624 Dermatitis Diseases 0.000 claims description 7
- 208000007342 Diabetic Nephropathies Diseases 0.000 claims description 7
- 208000013016 Hypoglycemia Diseases 0.000 claims description 7
- 206010061218 Inflammation Diseases 0.000 claims description 7
- 208000001132 Osteoporosis Diseases 0.000 claims description 7
- 208000010668 atopic eczema Diseases 0.000 claims description 7
- 235000012000 cholesterol Nutrition 0.000 claims description 7
- 208000033679 diabetic kidney disease Diseases 0.000 claims description 7
- 208000006575 hypertriglyceridemia Diseases 0.000 claims description 7
- 230000002218 hypoglycaemic effect Effects 0.000 claims description 7
- 230000004054 inflammatory process Effects 0.000 claims description 7
- 238000004519 manufacturing process Methods 0.000 claims description 7
- 201000009104 prediabetes syndrome Diseases 0.000 claims description 7
- 229940075993 receptor modulator Drugs 0.000 claims description 4
- 108010086246 Glucagon-Like Peptide-1 Receptor Proteins 0.000 claims description 3
- 102000007446 Glucagon-Like Peptide-1 Receptor Human genes 0.000 claims 1
- 108090000765 processed proteins & peptides Proteins 0.000 abstract description 171
- 108010041872 Islet Amyloid Polypeptide Proteins 0.000 abstract description 119
- 102000036770 Islet Amyloid Polypeptide Human genes 0.000 abstract description 119
- 230000027455 binding Effects 0.000 abstract description 64
- 239000000203 mixture Substances 0.000 abstract description 53
- 125000003275 alpha amino acid group Chemical group 0.000 abstract description 18
- 230000004048 modification Effects 0.000 abstract description 9
- 238000012986 modification Methods 0.000 abstract description 9
- 125000003396 thiol group Chemical group [H]S* 0.000 abstract description 6
- 125000000217 alkyl group Chemical group 0.000 abstract description 3
- 125000004432 carbon atom Chemical group C* 0.000 abstract description 3
- 238000007363 ring formation reaction Methods 0.000 abstract description 2
- 102000007562 Serum Albumin Human genes 0.000 abstract 1
- 108010071390 Serum Albumin Proteins 0.000 abstract 1
- 230000004075 alteration Effects 0.000 abstract 1
- 150000007942 carboxylates Chemical group 0.000 abstract 1
- 238000012217 deletion Methods 0.000 abstract 1
- 230000037430 deletion Effects 0.000 abstract 1
- 238000003780 insertion Methods 0.000 abstract 1
- 230000037431 insertion Effects 0.000 abstract 1
- 230000008685 targeting Effects 0.000 abstract 1
- 239000000562 conjugate Substances 0.000 description 118
- 229960003611 pramlintide Drugs 0.000 description 61
- 239000000427 antigen Substances 0.000 description 60
- 108091007433 antigens Proteins 0.000 description 60
- 102000036639 antigens Human genes 0.000 description 60
- -1 form Substances 0.000 description 54
- 102000004196 processed proteins & peptides Human genes 0.000 description 53
- 235000001014 amino acid Nutrition 0.000 description 38
- 239000012634 fragment Substances 0.000 description 38
- 210000004027 cell Anatomy 0.000 description 36
- 239000003814 drug Substances 0.000 description 36
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 36
- 229940024606 amino acid Drugs 0.000 description 35
- 150000001413 amino acids Chemical class 0.000 description 33
- 125000005647 linker group Chemical group 0.000 description 33
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 32
- 108060003951 Immunoglobulin Proteins 0.000 description 31
- 102000018358 immunoglobulin Human genes 0.000 description 31
- 239000011347 resin Substances 0.000 description 30
- 229920005989 resin Polymers 0.000 description 30
- 108090000623 proteins and genes Proteins 0.000 description 29
- NRKVKVQDUCJPIZ-MKAGXXMWSA-N pramlintide acetate Chemical compound C([C@@H](C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CS)NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 NRKVKVQDUCJPIZ-MKAGXXMWSA-N 0.000 description 28
- 102000004169 proteins and genes Human genes 0.000 description 28
- 235000018102 proteins Nutrition 0.000 description 27
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 23
- 229920001184 polypeptide Polymers 0.000 description 23
- 108010029667 pramlintide Proteins 0.000 description 23
- 230000015572 biosynthetic process Effects 0.000 description 20
- 238000011282 treatment Methods 0.000 description 20
- 238000006243 chemical reaction Methods 0.000 description 19
- 230000001225 therapeutic effect Effects 0.000 description 19
- 208000024891 symptom Diseases 0.000 description 18
- 230000021615 conjugation Effects 0.000 description 17
- 229920001223 polyethylene glycol Polymers 0.000 description 17
- 229940124597 therapeutic agent Drugs 0.000 description 17
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 16
- 239000002202 Polyethylene glycol Substances 0.000 description 16
- 208000011580 syndromic disease Diseases 0.000 description 16
- 238000002560 therapeutic procedure Methods 0.000 description 16
- 108010001789 Calcitonin Receptors Proteins 0.000 description 15
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 15
- 239000004472 Lysine Substances 0.000 description 15
- 239000000872 buffer Substances 0.000 description 15
- 235000018977 lysine Nutrition 0.000 description 15
- 102100038520 Calcitonin receptor Human genes 0.000 description 14
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 14
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 14
- 238000001727 in vivo Methods 0.000 description 14
- 238000003786 synthesis reaction Methods 0.000 description 14
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 14
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 13
- 230000014509 gene expression Effects 0.000 description 13
- 239000002953 phosphate buffered saline Substances 0.000 description 13
- 241000699670 Mus sp. Species 0.000 description 12
- 238000010168 coupling process Methods 0.000 description 12
- 238000005859 coupling reaction Methods 0.000 description 12
- 210000004602 germ cell Anatomy 0.000 description 12
- 238000004128 high performance liquid chromatography Methods 0.000 description 12
- 125000006239 protecting group Chemical group 0.000 description 12
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 11
- 241001465754 Metazoa Species 0.000 description 11
- 238000003556 assay Methods 0.000 description 11
- 102000005962 receptors Human genes 0.000 description 11
- 108020003175 receptors Proteins 0.000 description 11
- RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 10
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-dimethylformamide Substances CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 10
- 230000037396 body weight Effects 0.000 description 10
- 230000008878 coupling Effects 0.000 description 10
- IPCSVZSSVZVIGE-UHFFFAOYSA-N hexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 10
- 150000002500 ions Chemical class 0.000 description 10
- 230000002829 reductive effect Effects 0.000 description 10
- 239000004094 surface-active agent Substances 0.000 description 10
- 108020004414 DNA Proteins 0.000 description 9
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 9
- 239000002585 base Substances 0.000 description 9
- 210000004369 blood Anatomy 0.000 description 9
- 239000008280 blood Substances 0.000 description 9
- 238000009472 formulation Methods 0.000 description 9
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 9
- 230000003993 interaction Effects 0.000 description 9
- 239000000047 product Substances 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- 239000002904 solvent Substances 0.000 description 9
- 239000003381 stabilizer Substances 0.000 description 9
- 238000001890 transfection Methods 0.000 description 9
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 8
- 239000002253 acid Substances 0.000 description 8
- 125000000539 amino acid group Chemical group 0.000 description 8
- SLYFITHISHUGLZ-LWZDQURMSA-N chembl2105635 Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](CCC(N)=O)C(=O)N[C@@H]([C@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@H](C)O)C(=O)N1 SLYFITHISHUGLZ-LWZDQURMSA-N 0.000 description 8
- 108010007487 davalintide Proteins 0.000 description 8
- 229950002572 davalintide Drugs 0.000 description 8
- 230000006870 function Effects 0.000 description 8
- 238000000746 purification Methods 0.000 description 8
- 235000004400 serine Nutrition 0.000 description 8
- 239000012453 solvate Substances 0.000 description 8
- BDNKZNFMNDZQMI-UHFFFAOYSA-N 1,3-diisopropylcarbodiimide Chemical compound CC(C)N=C=NC(C)C BDNKZNFMNDZQMI-UHFFFAOYSA-N 0.000 description 7
- 102000055006 Calcitonin Human genes 0.000 description 7
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 7
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 7
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 7
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 7
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 7
- 241000700159 Rattus Species 0.000 description 7
- 238000004458 analytical method Methods 0.000 description 7
- 210000004899 c-terminal region Anatomy 0.000 description 7
- BGRWYRAHAFMIBJ-UHFFFAOYSA-N diisopropylcarbodiimide Natural products CC(C)NC(=O)NC(C)C BGRWYRAHAFMIBJ-UHFFFAOYSA-N 0.000 description 7
- 239000012039 electrophile Substances 0.000 description 7
- 238000000338 in vitro Methods 0.000 description 7
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 7
- 239000013612 plasmid Substances 0.000 description 7
- 238000012360 testing method Methods 0.000 description 7
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- 239000004475 Arginine Substances 0.000 description 6
- 108060001064 Calcitonin Proteins 0.000 description 6
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 6
- OAKJQQAXSVQMHS-UHFFFAOYSA-N Hydrazine Chemical compound NN OAKJQQAXSVQMHS-UHFFFAOYSA-N 0.000 description 6
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 6
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 6
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 6
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 6
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 6
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 6
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 6
- 239000000556 agonist Substances 0.000 description 6
- 150000001408 amides Chemical class 0.000 description 6
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 6
- 235000009697 arginine Nutrition 0.000 description 6
- 235000003704 aspartic acid Nutrition 0.000 description 6
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 6
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 6
- 229960004015 calcitonin Drugs 0.000 description 6
- 239000002738 chelating agent Substances 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 238000002648 combination therapy Methods 0.000 description 6
- 230000000295 complement effect Effects 0.000 description 6
- 238000010511 deprotection reaction Methods 0.000 description 6
- 235000013922 glutamic acid Nutrition 0.000 description 6
- 239000004220 glutamic acid Substances 0.000 description 6
- 239000000710 homodimer Substances 0.000 description 6
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 6
- 150000007523 nucleic acids Chemical group 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 6
- JUIKUQOUMZUFQT-UHFFFAOYSA-N 2-bromoacetamide Chemical compound NC(=O)CBr JUIKUQOUMZUFQT-UHFFFAOYSA-N 0.000 description 5
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 5
- 206010018429 Glucose tolerance impaired Diseases 0.000 description 5
- 101000584583 Homo sapiens Receptor activity-modifying protein 1 Proteins 0.000 description 5
- SECXISVLQFMRJM-UHFFFAOYSA-N N-Methylpyrrolidone Chemical compound CN1CCCC1=O SECXISVLQFMRJM-UHFFFAOYSA-N 0.000 description 5
- 235000021314 Palmitic acid Nutrition 0.000 description 5
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 5
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 5
- 235000018417 cysteine Nutrition 0.000 description 5
- 235000005911 diet Nutrition 0.000 description 5
- 230000037213 diet Effects 0.000 description 5
- 239000012636 effector Substances 0.000 description 5
- 239000012091 fetal bovine serum Substances 0.000 description 5
- 230000002496 gastric effect Effects 0.000 description 5
- 239000008103 glucose Substances 0.000 description 5
- 230000036541 health Effects 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 239000007951 isotonicity adjuster Substances 0.000 description 5
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 5
- 239000002609 medium Substances 0.000 description 5
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 description 5
- 229960005489 paracetamol Drugs 0.000 description 5
- 238000010647 peptide synthesis reaction Methods 0.000 description 5
- 239000012071 phase Substances 0.000 description 5
- 239000003755 preservative agent Substances 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 230000002441 reversible effect Effects 0.000 description 5
- 238000010561 standard procedure Methods 0.000 description 5
- 239000000725 suspension Substances 0.000 description 5
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 5
- QCHPKSFMDHPSNR-UHFFFAOYSA-N 3-aminoisobutyric acid Chemical group NCC(C)C(O)=O QCHPKSFMDHPSNR-UHFFFAOYSA-N 0.000 description 4
- 108010088751 Albumins Proteins 0.000 description 4
- 102000009027 Albumins Human genes 0.000 description 4
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical class CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 4
- 229940089838 Glucagon-like peptide 1 receptor agonist Drugs 0.000 description 4
- 239000012981 Hank's balanced salt solution Substances 0.000 description 4
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 4
- 241000124008 Mammalia Species 0.000 description 4
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 4
- 241000699666 Mus <mouse, genus> Species 0.000 description 4
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 4
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 4
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 4
- YASAKCUCGLMORW-UHFFFAOYSA-N Rosiglitazone Chemical compound C=1C=CC=NC=1N(C)CCOC(C=C1)=CC=C1CC1SC(=O)NC1=O YASAKCUCGLMORW-UHFFFAOYSA-N 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- 239000007983 Tris buffer Substances 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- KPFBUSLHFFWMAI-HYRPPVSQSA-N [(8r,9s,10r,13s,14s,17r)-17-acetyl-6-formyl-3-methoxy-10,13-dimethyl-1,2,7,8,9,11,12,14,15,16-decahydrocyclopenta[a]phenanthren-17-yl] acetate Chemical compound C1C[C@@H]2[C@](CCC(OC)=C3)(C)C3=C(C=O)C[C@H]2[C@@H]2CC[C@](OC(C)=O)(C(C)=O)[C@]21C KPFBUSLHFFWMAI-HYRPPVSQSA-N 0.000 description 4
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 4
- 239000012131 assay buffer Substances 0.000 description 4
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 4
- PFKFTWBEEFSNDU-UHFFFAOYSA-N carbonyldiimidazole Chemical compound C1=CN=CN1C(=O)N1C=CN=C1 PFKFTWBEEFSNDU-UHFFFAOYSA-N 0.000 description 4
- 238000004113 cell culture Methods 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 238000003776 cleavage reaction Methods 0.000 description 4
- 238000007796 conventional method Methods 0.000 description 4
- 239000012228 culture supernatant Substances 0.000 description 4
- UFULAYFCSOUIOV-UHFFFAOYSA-N cysteamine Chemical compound NCCS UFULAYFCSOUIOV-UHFFFAOYSA-N 0.000 description 4
- 239000003085 diluting agent Substances 0.000 description 4
- XBDQKXXYIPTUBI-UHFFFAOYSA-N dimethylselenoniopropionate Natural products CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 4
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 4
- 230000008030 elimination Effects 0.000 description 4
- 238000003379 elimination reaction Methods 0.000 description 4
- 238000010828 elution Methods 0.000 description 4
- 239000013604 expression vector Substances 0.000 description 4
- 125000000524 functional group Chemical group 0.000 description 4
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 4
- 239000000833 heterodimer Substances 0.000 description 4
- 238000005734 heterodimerization reaction Methods 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 235000014304 histidine Nutrition 0.000 description 4
- 239000004615 ingredient Substances 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 229960003151 mercaptamine Drugs 0.000 description 4
- DNIAPMSPPWPWGF-UHFFFAOYSA-N monopropylene glycol Natural products CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 4
- 102000039446 nucleic acids Human genes 0.000 description 4
- 108020004707 nucleic acids Proteins 0.000 description 4
- 239000008363 phosphate buffer Substances 0.000 description 4
- 229920001451 polypropylene glycol Polymers 0.000 description 4
- 229920001282 polysaccharide Chemical group 0.000 description 4
- 239000005017 polysaccharide Chemical group 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 230000007017 scission Effects 0.000 description 4
- 239000007790 solid phase Substances 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 150000005846 sugar alcohols Chemical class 0.000 description 4
- 235000008521 threonine Nutrition 0.000 description 4
- ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 4
- 239000003981 vehicle Substances 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- 239000003643 water by type Substances 0.000 description 4
- YQZVQKYXWPIKIX-UHFFFAOYSA-N 2-[2-[2-[[2-[2-(2-aminoethoxy)ethoxy]acetyl]amino]ethoxy]ethoxy]acetic acid Chemical compound NCCOCCOCC(=O)NCCOCCOCC(O)=O YQZVQKYXWPIKIX-UHFFFAOYSA-N 0.000 description 3
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 3
- OQEBBZSWEGYTPG-UHFFFAOYSA-N 3-aminobutanoic acid Chemical compound CC(N)CC(O)=O OQEBBZSWEGYTPG-UHFFFAOYSA-N 0.000 description 3
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 3
- 102000004379 Adrenomedullin Human genes 0.000 description 3
- 101800004616 Adrenomedullin Proteins 0.000 description 3
- 238000011814 C57BL/6N mouse Methods 0.000 description 3
- 239000004215 Carbon black (E152) Chemical group 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 3
- 229920000858 Cyclodextrin Polymers 0.000 description 3
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical class OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 239000007995 HEPES buffer Substances 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101000741445 Homo sapiens Calcitonin Proteins 0.000 description 3
- 101000968287 Homo sapiens Denticleless protein homolog Proteins 0.000 description 3
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical class C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 3
- 102000004877 Insulin Human genes 0.000 description 3
- 108090001061 Insulin Proteins 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- FFFHZYDWPBMWHY-VKHMYHEASA-N L-homocysteine Chemical compound OC(=O)[C@@H](N)CCS FFFHZYDWPBMWHY-VKHMYHEASA-N 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 3
- ULCUCJFASIJEOE-NPECTJMMSA-N adrenomedullin Chemical compound C([C@@H](C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)NCC(=O)N[C@@H]1C(N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CSSC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)[C@@H](C)O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 ULCUCJFASIJEOE-NPECTJMMSA-N 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 230000009435 amidation Effects 0.000 description 3
- 238000007112 amidation reaction Methods 0.000 description 3
- 150000003863 ammonium salts Chemical class 0.000 description 3
- 239000013011 aqueous formulation Substances 0.000 description 3
- 238000013262 cAMP assay Methods 0.000 description 3
- 230000003491 cAMP production Effects 0.000 description 3
- 239000003638 chemical reducing agent Substances 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical class OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 238000001212 derivatisation Methods 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- YMWUJEATGCHHMB-UHFFFAOYSA-N dichloromethane Natural products ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 3
- 235000014113 dietary fatty acids Nutrition 0.000 description 3
- 239000000539 dimer Substances 0.000 description 3
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 3
- 231100000673 dose–response relationship Toxicity 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 229930195729 fatty acid Natural products 0.000 description 3
- 239000000194 fatty acid Substances 0.000 description 3
- 235000013305 food Nutrition 0.000 description 3
- 238000002868 homogeneous time resolved fluorescence Methods 0.000 description 3
- 102000050292 human RAMP1 Human genes 0.000 description 3
- 229940045644 human calcitonin Drugs 0.000 description 3
- 210000004408 hybridoma Anatomy 0.000 description 3
- 229930195733 hydrocarbon Chemical group 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 230000002998 immunogenetic effect Effects 0.000 description 3
- 229940072221 immunoglobulins Drugs 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 229940125396 insulin Drugs 0.000 description 3
- 229960000310 isoleucine Drugs 0.000 description 3
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 3
- 235000014705 isoleucine Nutrition 0.000 description 3
- 238000006317 isomerization reaction Methods 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 230000029226 lipidation Effects 0.000 description 3
- 239000012669 liquid formulation Substances 0.000 description 3
- 230000014759 maintenance of location Effects 0.000 description 3
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 3
- 238000004949 mass spectrometry Methods 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 230000006320 pegylation Effects 0.000 description 3
- 229940002612 prodrug Drugs 0.000 description 3
- 239000000651 prodrug Substances 0.000 description 3
- 230000002797 proteolythic effect Effects 0.000 description 3
- HFHDHCJBZVLPGP-UHFFFAOYSA-N schardinger α-dextrin Chemical compound O1C(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(O)C2O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC2C(O)C(O)C1OC2CO HFHDHCJBZVLPGP-UHFFFAOYSA-N 0.000 description 3
- 229910052708 sodium Inorganic materials 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 229940083542 sodium Drugs 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 238000001179 sorption measurement Methods 0.000 description 3
- 230000000087 stabilizing effect Effects 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical class [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical class CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 3
- 239000012096 transfection reagent Substances 0.000 description 3
- 230000009261 transgenic effect Effects 0.000 description 3
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 2
- OZFAFGSSMRRTDW-UHFFFAOYSA-N (2,4-dichlorophenyl) benzenesulfonate Chemical compound ClC1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=CC=C1 OZFAFGSSMRRTDW-UHFFFAOYSA-N 0.000 description 2
- LQQXBYSAGYOQJW-ZAQUEYBZSA-N (2s)-2-(9h-fluoren-9-ylmethoxycarbonylamino)-6-[[(4s)-4-(hexadecanoylamino)-5-[(2-methylpropan-2-yl)oxy]-5-oxopentanoyl]amino]hexanoic acid Chemical group C1=CC=C2C(COC(=O)N[C@@H](CCCCNC(=O)CC[C@H](NC(=O)CCCCCCCCCCCCCCC)C(=O)OC(C)(C)C)C(O)=O)C3=CC=CC=C3C2=C1 LQQXBYSAGYOQJW-ZAQUEYBZSA-N 0.000 description 2
- ASOKPJOREAFHNY-UHFFFAOYSA-N 1-Hydroxybenzotriazole Chemical compound C1=CC=C2N(O)N=NC2=C1 ASOKPJOREAFHNY-UHFFFAOYSA-N 0.000 description 2
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide Chemical compound CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 2
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 2
- LXCJDJORVXDTBW-UHFFFAOYSA-N 2-(3,4-dihydroxyphenyl)-4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2h-chromen-6-yl]-8-[6-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2h-chromen-4-yl]-3,5,7-trihydroxy-2-(4-hydroxyphenyl)-3,4-dihydro-2h-chromen-4-yl]-3,4-dihydro-2h-c Chemical compound OC=1C=C2OC(C=3C=C(O)C(O)=CC=3)C(O)CC2=C(O)C=1C1C(O)C(C=2C=C(O)C(O)=CC=2)OC2=C1C(O)=CC(O)=C2C(C1=C2O)C(O)C(C=3C=CC(O)=CC=3)OC1=CC(O)=C2C(C1=C(O)C=C(O)C=C1O1)C(O)C1C1=CC=C(O)C(O)=C1 LXCJDJORVXDTBW-UHFFFAOYSA-N 0.000 description 2
- JWYOAMOZLZXDER-UHFFFAOYSA-N 2-azaniumylcyclopentane-1-carboxylate Chemical compound NC1CCCC1C(O)=O JWYOAMOZLZXDER-UHFFFAOYSA-N 0.000 description 2
- WRMNZCZEMHIOCP-UHFFFAOYSA-N 2-phenylethanol Chemical compound OCCC1=CC=CC=C1 WRMNZCZEMHIOCP-UHFFFAOYSA-N 0.000 description 2
- APIXJSLKIYYUKG-UHFFFAOYSA-N 3 Isobutyl 1 methylxanthine Chemical compound O=C1N(C)C(=O)N(CC(C)C)C2=C1N=CN2 APIXJSLKIYYUKG-UHFFFAOYSA-N 0.000 description 2
- FZTIWOBQQYPTCJ-UHFFFAOYSA-N 4-[4-(4-carboxyphenyl)phenyl]benzoic acid Chemical compound C1=CC(C(=O)O)=CC=C1C1=CC=C(C=2C=CC(=CC=2)C(O)=O)C=C1 FZTIWOBQQYPTCJ-UHFFFAOYSA-N 0.000 description 2
- CFKMVGJGLGKFKI-UHFFFAOYSA-N 4-chloro-m-cresol Chemical compound CC1=CC(O)=CC=C1Cl CFKMVGJGLGKFKI-UHFFFAOYSA-N 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- QFOHBWFCKVYLES-UHFFFAOYSA-N Butylparaben Chemical compound CCCCOC(=O)C1=CC=C(O)C=C1 QFOHBWFCKVYLES-UHFFFAOYSA-N 0.000 description 2
- 238000011740 C57BL/6 mouse Methods 0.000 description 2
- 101100512078 Caenorhabditis elegans lys-1 gene Proteins 0.000 description 2
- 101100533230 Caenorhabditis elegans ser-2 gene Proteins 0.000 description 2
- 102000004414 Calcitonin Gene-Related Peptide Human genes 0.000 description 2
- 108090000932 Calcitonin Gene-Related Peptide Proteins 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- QNAYBMKLOCPYGJ-UHFFFAOYSA-N D-alpha-Ala Natural products CC([NH3+])C([O-])=O QNAYBMKLOCPYGJ-UHFFFAOYSA-N 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- JVHXJTBJCFBINQ-ADAARDCZSA-N Dapagliflozin Chemical compound C1=CC(OCC)=CC=C1CC1=CC([C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)=CC=C1Cl JVHXJTBJCFBINQ-ADAARDCZSA-N 0.000 description 2
- 229920002307 Dextran Polymers 0.000 description 2
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 2
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 2
- HTQBXNHDCUEHJF-XWLPCZSASA-N Exenatide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 HTQBXNHDCUEHJF-XWLPCZSASA-N 0.000 description 2
- 108010011459 Exenatide Proteins 0.000 description 2
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 2
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 2
- 102100032882 Glucagon-like peptide 1 receptor Human genes 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Chemical compound OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 2
- 239000007821 HATU Substances 0.000 description 2
- 101001081479 Homo sapiens Islet amyloid polypeptide Proteins 0.000 description 2
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 239000012515 MabSelect SuRe Substances 0.000 description 2
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 2
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 2
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 2
- 229910002651 NO3 Inorganic materials 0.000 description 2
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- NFHFRUOZVGFOOS-UHFFFAOYSA-N Pd(PPh3)4 Substances [Pd].C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 NFHFRUOZVGFOOS-UHFFFAOYSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 229920000361 Poly(styrene)-block-poly(ethylene glycol) Polymers 0.000 description 2
- 239000004372 Polyvinyl alcohol Substances 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- LOUPRKONTZGTKE-WZBLMQSHSA-N Quinine Chemical compound C([C@H]([C@H](C1)C=C)C2)C[N@@]1[C@@H]2[C@H](O)C1=CC=NC2=CC=C(OC)C=C21 LOUPRKONTZGTKE-WZBLMQSHSA-N 0.000 description 2
- 102100030697 Receptor activity-modifying protein 1 Human genes 0.000 description 2
- 102100030711 Receptor activity-modifying protein 3 Human genes 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical class [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 2
- 229940100389 Sulfonylurea Drugs 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 108090000631 Trypsin Proteins 0.000 description 2
- 102000004142 Trypsin Human genes 0.000 description 2
- 101150117115 V gene Proteins 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 238000009098 adjuvant therapy Methods 0.000 description 2
- 230000002776 aggregation Effects 0.000 description 2
- 238000004220 aggregation Methods 0.000 description 2
- RDOXTESZEPMUJZ-UHFFFAOYSA-N anisole Chemical compound COC1=CC=CC=C1 RDOXTESZEPMUJZ-UHFFFAOYSA-N 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- YZXBAPSDXZZRGB-DOFZRALJSA-N arachidonic acid Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O YZXBAPSDXZZRGB-DOFZRALJSA-N 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 229940077388 benzenesulfonate Drugs 0.000 description 2
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- GZUXJHMPEANEGY-UHFFFAOYSA-N bromomethane Chemical compound BrC GZUXJHMPEANEGY-UHFFFAOYSA-N 0.000 description 2
- 239000007853 buffer solution Substances 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 238000000423 cell based assay Methods 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 230000004186 co-expression Effects 0.000 description 2
- 238000009833 condensation Methods 0.000 description 2
- 230000005494 condensation Effects 0.000 description 2
- PAFZNILMFXTMIY-UHFFFAOYSA-N cyclohexylamine Chemical compound NC1CCCCC1 PAFZNILMFXTMIY-UHFFFAOYSA-N 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 229960003834 dapagliflozin Drugs 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 125000002228 disulfide group Chemical group 0.000 description 2
- VHJLVAABSRFDPM-ZXZARUISSA-N dithioerythritol Chemical compound SC[C@H](O)[C@H](O)CS VHJLVAABSRFDPM-ZXZARUISSA-N 0.000 description 2
- UKMSUNONTOPOIO-UHFFFAOYSA-N docosanoic acid Chemical compound CCCCCCCCCCCCCCCCCCCCCC(O)=O UKMSUNONTOPOIO-UHFFFAOYSA-N 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 229960001484 edetic acid Drugs 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- NUVBSKCKDOMJSU-UHFFFAOYSA-N ethylparaben Chemical compound CCOC(=O)C1=CC=C(O)C=C1 NUVBSKCKDOMJSU-UHFFFAOYSA-N 0.000 description 2
- 229960001519 exenatide Drugs 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 239000000706 filtrate Substances 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 239000012458 free base Substances 0.000 description 2
- 230000030136 gastric emptying Effects 0.000 description 2
- 210000001035 gastrointestinal tract Anatomy 0.000 description 2
- 239000007903 gelatin capsule Substances 0.000 description 2
- 229960001381 glipizide Drugs 0.000 description 2
- ZJJXGWJIGJFDTL-UHFFFAOYSA-N glipizide Chemical compound C1=NC(C)=CN=C1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)NC2CCCCC2)C=C1 ZJJXGWJIGJFDTL-UHFFFAOYSA-N 0.000 description 2
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 2
- 229960003180 glutathione Drugs 0.000 description 2
- 150000004676 glycans Chemical class 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- YMAWOPBAYDPSLA-UHFFFAOYSA-N glycylglycine Chemical compound [NH3+]CC(=O)NCC([O-])=O YMAWOPBAYDPSLA-UHFFFAOYSA-N 0.000 description 2
- 125000000623 heterocyclic group Chemical group 0.000 description 2
- 125000001183 hydrocarbyl group Chemical group 0.000 description 2
- 239000001257 hydrogen Substances 0.000 description 2
- 229910052739 hydrogen Inorganic materials 0.000 description 2
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 2
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 2
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 2
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 2
- 239000012729 immediate-release (IR) formulation Substances 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- SUMDYPCJJOFFON-UHFFFAOYSA-N isethionic acid Chemical compound OCCS(O)(=O)=O SUMDYPCJJOFFON-UHFFFAOYSA-N 0.000 description 2
- 238000001294 liquid chromatography-tandem mass spectrometry Methods 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 2
- 229910052749 magnesium Inorganic materials 0.000 description 2
- 239000011777 magnesium Substances 0.000 description 2
- BJEPYKJPYRNKOW-UHFFFAOYSA-N malic acid Chemical compound OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 2
- 208000030159 metabolic disease Diseases 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- XZWYZXLIPXDOLR-UHFFFAOYSA-N metformin Chemical compound CN(C)C(=N)NC(N)=N XZWYZXLIPXDOLR-UHFFFAOYSA-N 0.000 description 2
- 229960003105 metformin Drugs 0.000 description 2
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 2
- 150000007522 mineralic acids Chemical class 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 238000002552 multiple reaction monitoring Methods 0.000 description 2
- 210000004897 n-terminal region Anatomy 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 235000021590 normal diet Nutrition 0.000 description 2
- QWVGKYWNOKOFNN-UHFFFAOYSA-N o-cresol Chemical compound CC1=CC=CC=C1O QWVGKYWNOKOFNN-UHFFFAOYSA-N 0.000 description 2
- BNJOQKFENDDGSC-UHFFFAOYSA-N octadecanedioic acid Chemical compound OC(=O)CCCCCCCCCCCCCCCCC(O)=O BNJOQKFENDDGSC-UHFFFAOYSA-N 0.000 description 2
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- IWDCLRJOBJJRNH-UHFFFAOYSA-N p-cresol Chemical compound CC1=CC=C(O)C=C1 IWDCLRJOBJJRNH-UHFFFAOYSA-N 0.000 description 2
- VLTRZXGMWDSKGL-UHFFFAOYSA-N perchloric acid Chemical compound OCl(=O)(=O)=O VLTRZXGMWDSKGL-UHFFFAOYSA-N 0.000 description 2
- 238000002823 phage display Methods 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- HYAFETHFCAUJAY-UHFFFAOYSA-N pioglitazone Chemical compound N1=CC(CC)=CC=C1CCOC(C=C1)=CC=C1CC1C(=O)NC(=O)S1 HYAFETHFCAUJAY-UHFFFAOYSA-N 0.000 description 2
- 229920000728 polyester Polymers 0.000 description 2
- 229920002451 polyvinyl alcohol Polymers 0.000 description 2
- 238000010149 post-hoc-test Methods 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000002335 preservative effect Effects 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 235000019260 propionic acid Nutrition 0.000 description 2
- 229960004063 propylene glycol Drugs 0.000 description 2
- 235000013772 propylene glycol Nutrition 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- IUVKMZGDUIUOCP-BTNSXGMBSA-N quinbolone Chemical compound O([C@H]1CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)CC[C@@]21C)C1=CCCC1 IUVKMZGDUIUOCP-BTNSXGMBSA-N 0.000 description 2
- 230000002285 radioactive effect Effects 0.000 description 2
- 229960004586 rosiglitazone Drugs 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 238000002864 sequence alignment Methods 0.000 description 2
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 2
- 239000001632 sodium acetate Substances 0.000 description 2
- 235000017281 sodium acetate Nutrition 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 238000007619 statistical method Methods 0.000 description 2
- TYFQFVWCELRYAO-UHFFFAOYSA-N suberic acid Chemical compound OC(=O)CCCCCCC(O)=O TYFQFVWCELRYAO-UHFFFAOYSA-N 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 229940095064 tartrate Drugs 0.000 description 2
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 2
- HQHCYKULIHKCEB-UHFFFAOYSA-N tetradecanedioic acid Chemical compound OC(=O)CCCCCCCCCCCCC(O)=O HQHCYKULIHKCEB-UHFFFAOYSA-N 0.000 description 2
- CWERGRDVMFNCDR-UHFFFAOYSA-N thioglycolic acid Chemical compound OC(=O)CS CWERGRDVMFNCDR-UHFFFAOYSA-N 0.000 description 2
- 150000003573 thiols Chemical group 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 238000003146 transient transfection Methods 0.000 description 2
- PIEPQKCYPFFYMG-UHFFFAOYSA-N tris acetate Chemical compound CC(O)=O.OCC(N)(CO)CO PIEPQKCYPFFYMG-UHFFFAOYSA-N 0.000 description 2
- 125000002221 trityl group Chemical group [H]C1=C([H])C([H])=C([H])C([H])=C1C([*])(C1=C(C(=C(C(=C1[H])[H])[H])[H])[H])C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 2
- 239000012588 trypsin Substances 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 235000002374 tyrosine Nutrition 0.000 description 2
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 239000013598 vector Substances 0.000 description 2
- 238000011179 visual inspection Methods 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- DNIAPMSPPWPWGF-VKHMYHEASA-N (+)-propylene glycol Chemical compound C[C@H](O)CO DNIAPMSPPWPWGF-VKHMYHEASA-N 0.000 description 1
- LSPHULWDVZXLIL-UHFFFAOYSA-N (+/-)-Camphoric acid Chemical compound CC1(C)C(C(O)=O)CCC1(C)C(O)=O LSPHULWDVZXLIL-UHFFFAOYSA-N 0.000 description 1
- GOLACPLOSPDXLA-UHFFFAOYSA-N (2-acetamido-4-hydroxyphenyl)arsonic acid Chemical compound C(C)(=O)NC1=C(C=CC(=C1)O)[As](O)(=O)O GOLACPLOSPDXLA-UHFFFAOYSA-N 0.000 description 1
- FUKOTTQGWQVMQB-UHFFFAOYSA-N (2-bromoacetyl) 2-bromoacetate Chemical compound BrCC(=O)OC(=O)CBr FUKOTTQGWQVMQB-UHFFFAOYSA-N 0.000 description 1
- CMIBUZBMZCBCAT-HZPDHXFCSA-N (2r,3r)-2,3-bis[(4-methylbenzoyl)oxy]butanedioic acid Chemical compound C1=CC(C)=CC=C1C(=O)O[C@@H](C(O)=O)[C@H](C(O)=O)OC(=O)C1=CC=C(C)C=C1 CMIBUZBMZCBCAT-HZPDHXFCSA-N 0.000 description 1
- XXMYDXUIZKNHDT-QNGWXLTQSA-N (2s)-2-(9h-fluoren-9-ylmethoxycarbonylamino)-3-(1-tritylimidazol-4-yl)propanoic acid Chemical compound C([C@@H](C(=O)O)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C21)C(N=C1)=CN1C(C=1C=CC=CC=1)(C=1C=CC=CC=1)C1=CC=CC=C1 XXMYDXUIZKNHDT-QNGWXLTQSA-N 0.000 description 1
- HNICLNKVURBTKV-NDEPHWFRSA-N (2s)-5-[[amino-[(2,2,4,6,7-pentamethyl-3h-1-benzofuran-5-yl)sulfonylamino]methylidene]amino]-2-(9h-fluoren-9-ylmethoxycarbonylamino)pentanoic acid Chemical compound C12=CC=CC=C2C2=CC=CC=C2C1COC(=O)N[C@H](C(O)=O)CCCN=C(N)NS(=O)(=O)C1=C(C)C(C)=C2OC(C)(C)CC2=C1C HNICLNKVURBTKV-NDEPHWFRSA-N 0.000 description 1
- NIVRJEWVLMOZNV-QWWZWVQMSA-N (3r,4r)-3-amino-4-hydroxypentanoic acid Chemical group C[C@@H](O)[C@H](N)CC(O)=O NIVRJEWVLMOZNV-QWWZWVQMSA-N 0.000 description 1
- GOPWHXPXSPIIQZ-FQEVSTJZSA-N (4s)-4-(9h-fluoren-9-ylmethoxycarbonylamino)-5-[(2-methylpropan-2-yl)oxy]-5-oxopentanoic acid Chemical compound C1=CC=C2C(COC(=O)N[C@@H](CCC(O)=O)C(=O)OC(C)(C)C)C3=CC=CC=C3C2=C1 GOPWHXPXSPIIQZ-FQEVSTJZSA-N 0.000 description 1
- GHOKWGTUZJEAQD-ZETCQYMHSA-N (D)-(+)-Pantothenic acid Chemical compound OCC(C)(C)[C@@H](O)C(=O)NCCC(O)=O GHOKWGTUZJEAQD-ZETCQYMHSA-N 0.000 description 1
- DNIAPMSPPWPWGF-GSVOUGTGSA-N (R)-(-)-Propylene glycol Chemical compound C[C@@H](O)CO DNIAPMSPPWPWGF-GSVOUGTGSA-N 0.000 description 1
- MXOAEAUPQDYUQM-QMMMGPOBSA-N (S)-chlorphenesin Chemical compound OC[C@H](O)COC1=CC=C(Cl)C=C1 MXOAEAUPQDYUQM-QMMMGPOBSA-N 0.000 description 1
- BJEPYKJPYRNKOW-REOHCLBHSA-N (S)-malic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O BJEPYKJPYRNKOW-REOHCLBHSA-N 0.000 description 1
- JYEUMXHLPRZUAT-UHFFFAOYSA-N 1,2,3-triazine Chemical compound C1=CN=NN=C1 JYEUMXHLPRZUAT-UHFFFAOYSA-N 0.000 description 1
- YPFDHNVEDLHUCE-UHFFFAOYSA-N 1,3-propanediol Substances OCCCO YPFDHNVEDLHUCE-UHFFFAOYSA-N 0.000 description 1
- 229940035437 1,3-propanediol Drugs 0.000 description 1
- HNSDLXPSAYFUHK-UHFFFAOYSA-N 1,4-bis(2-ethylhexyl) sulfosuccinate Chemical compound CCCCC(CC)COC(=O)CC(S(O)(=O)=O)C(=O)OCC(CC)CCCC HNSDLXPSAYFUHK-UHFFFAOYSA-N 0.000 description 1
- DFPYXQYWILNVAU-UHFFFAOYSA-N 1-hydroxybenzotriazole Chemical compound C1=CC=C2N(O)N=NC2=C1.C1=CC=C2N(O)N=NC2=C1 DFPYXQYWILNVAU-UHFFFAOYSA-N 0.000 description 1
- WLXGQMVCYPUOLM-UHFFFAOYSA-N 1-hydroxyethanesulfonic acid Chemical compound CC(O)S(O)(=O)=O WLXGQMVCYPUOLM-UHFFFAOYSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- 238000005160 1H NMR spectroscopy Methods 0.000 description 1
- VTAKZNRDSPNOAU-UHFFFAOYSA-M 2-(chloromethyl)oxirane;hydron;prop-2-en-1-amine;n-prop-2-enyldecan-1-amine;trimethyl-[6-(prop-2-enylamino)hexyl]azanium;dichloride Chemical compound Cl.[Cl-].NCC=C.ClCC1CO1.CCCCCCCCCCNCC=C.C[N+](C)(C)CCCCCCNCC=C VTAKZNRDSPNOAU-UHFFFAOYSA-M 0.000 description 1
- UHTQHHLSGVOGQR-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-4-ium-1-yl]ethanesulfonate Chemical compound OCCN1CCN(CCS(O)(=O)=O)CC1.OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 UHTQHHLSGVOGQR-UHFFFAOYSA-N 0.000 description 1
- MLONYBFKXHEPCD-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol Chemical compound OCC(N)(CO)CO.OCC(N)(CO)CO MLONYBFKXHEPCD-UHFFFAOYSA-N 0.000 description 1
- RDBCQSHUCYOVHR-UHFFFAOYSA-N 2-bromo-1-nitropropane-1,1-diol Chemical compound CC(Br)C(O)(O)[N+]([O-])=O RDBCQSHUCYOVHR-UHFFFAOYSA-N 0.000 description 1
- ARSWQPLPYROOBG-ZETCQYMHSA-N 2-methylleucine Chemical group CC(C)C[C@](C)(N)C(O)=O ARSWQPLPYROOBG-ZETCQYMHSA-N 0.000 description 1
- WBBPRCNXBQTYLF-UHFFFAOYSA-N 2-methylthioethanol Chemical compound CSCCO WBBPRCNXBQTYLF-UHFFFAOYSA-N 0.000 description 1
- QCDWFXQBSFUVSP-UHFFFAOYSA-N 2-phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-M 3-carboxy-2,3-dihydroxypropanoate Chemical compound OC(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-M 0.000 description 1
- ALKYHXVLJMQRLQ-UHFFFAOYSA-M 3-carboxynaphthalen-2-olate Chemical compound C1=CC=C2C=C(C([O-])=O)C(O)=CC2=C1 ALKYHXVLJMQRLQ-UHFFFAOYSA-M 0.000 description 1
- MVDXXGIBARMXSA-PYUWXLGESA-N 5-[[(2r)-2-benzyl-3,4-dihydro-2h-chromen-6-yl]methyl]-1,3-thiazolidine-2,4-dione Chemical compound S1C(=O)NC(=O)C1CC1=CC=C(O[C@@H](CC=2C=CC=CC=2)CC2)C2=C1 MVDXXGIBARMXSA-PYUWXLGESA-N 0.000 description 1
- JDDWRLPTKIOUOF-UHFFFAOYSA-N 9h-fluoren-9-ylmethyl n-[[4-[2-[bis(4-methylphenyl)methylamino]-2-oxoethoxy]phenyl]-(2,4-dimethoxyphenyl)methyl]carbamate Chemical compound COC1=CC(OC)=CC=C1C(C=1C=CC(OCC(=O)NC(C=2C=CC(C)=CC=2)C=2C=CC(C)=CC=2)=CC=1)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C21 JDDWRLPTKIOUOF-UHFFFAOYSA-N 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 102100033770 Alpha-amylase 1C Human genes 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 229940124035 Amylin receptor agonist Drugs 0.000 description 1
- 206010003571 Astrocytoma Diseases 0.000 description 1
- 235000021357 Behenic acid Nutrition 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- 229940123208 Biguanide Drugs 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- 108010074051 C-Reactive Protein Proteins 0.000 description 1
- 102100032752 C-reactive protein Human genes 0.000 description 1
- RDRBIXSNGAYLPT-UHFFFAOYSA-N CC1=CC=C(COC2=CC3=C(C=C2)C(NC(=O)OCC2C4=C(C=CC=C4)C4=C2C=CC=C4)C2=C(O3)C=CC=C2)C=C1 Chemical compound CC1=CC=C(COC2=CC3=C(C=C2)C(NC(=O)OCC2C4=C(C=CC=C4)C4=C2C=CC=C4)C2=C(O3)C=CC=C2)C=C1 RDRBIXSNGAYLPT-UHFFFAOYSA-N 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- GHXZTYHSJHQHIJ-UHFFFAOYSA-N Chlorhexidine Chemical compound C=1C=C(Cl)C=CC=1NC(N)=NC(N)=NCCCCCCN=C(N)N=C(N)NC1=CC=C(Cl)C=C1 GHXZTYHSJHQHIJ-UHFFFAOYSA-N 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- RKWGIWYCVPQPMF-UHFFFAOYSA-N Chloropropamide Chemical compound CCCNC(=O)NS(=O)(=O)C1=CC=C(Cl)C=C1 RKWGIWYCVPQPMF-UHFFFAOYSA-N 0.000 description 1
- 235000001258 Cinchona calisaya Nutrition 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 229920002905 Colesevelam Polymers 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- HEBKCHPVOIAQTA-QWWZWVQMSA-N D-arabinitol Chemical compound OC[C@@H](O)C(O)[C@H](O)CO HEBKCHPVOIAQTA-QWWZWVQMSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- KDXKERNSBIXSRK-RXMQYKEDSA-N D-lysine Chemical compound NCCCC[C@@H](N)C(O)=O KDXKERNSBIXSRK-RXMQYKEDSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- XBPCUCUWBYBCDP-UHFFFAOYSA-N Dicyclohexylamine Chemical class C1CCCCC1NC1CCCCC1 XBPCUCUWBYBCDP-UHFFFAOYSA-N 0.000 description 1
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000283070 Equus zebra Species 0.000 description 1
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical group OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- XZWYTXMRWQJBGX-VXBMVYAYSA-N FLAG peptide Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 XZWYTXMRWQJBGX-VXBMVYAYSA-N 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 108010049003 Fibrinogen Proteins 0.000 description 1
- 102000008946 Fibrinogen Human genes 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- 102000051325 Glucagon Human genes 0.000 description 1
- 108060003199 Glucagon Proteins 0.000 description 1
- 229920001503 Glucan Polymers 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 102000017011 Glycated Hemoglobin A Human genes 0.000 description 1
- 108010008488 Glycylglycine Proteins 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 229920003114 HPC-L Polymers 0.000 description 1
- 229920003115 HPC-SL Polymers 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- SQUHHTBVTRBESD-UHFFFAOYSA-N Hexa-Ac-myo-Inositol Natural products CC(=O)OC1C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C1OC(C)=O SQUHHTBVTRBESD-UHFFFAOYSA-N 0.000 description 1
- 101000779871 Homo sapiens Alpha-amylase 1A Proteins 0.000 description 1
- 101000779870 Homo sapiens Alpha-amylase 1B Proteins 0.000 description 1
- 101000779869 Homo sapiens Alpha-amylase 1C Proteins 0.000 description 1
- 101000741435 Homo sapiens Calcitonin receptor Proteins 0.000 description 1
- 101000609277 Homo sapiens Inactive serine protease PAMR1 Proteins 0.000 description 1
- 101000684208 Homo sapiens Prolyl endopeptidase FAP Proteins 0.000 description 1
- 101000584590 Homo sapiens Receptor activity-modifying protein 2 Proteins 0.000 description 1
- 101000584593 Homo sapiens Receptor activity-modifying protein 3 Proteins 0.000 description 1
- 101000788669 Homo sapiens Zinc finger MYM-type protein 2 Proteins 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-O Htris Chemical compound OCC([NH3+])(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-O 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- 229920001612 Hydroxyethyl starch Polymers 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 1
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 102100039437 Inactive serine protease PAMR1 Human genes 0.000 description 1
- LKDRXBCSQODPBY-AMVSKUEXSA-N L-(-)-Sorbose Chemical compound OCC1(O)OC[C@H](O)[C@@H](O)[C@@H]1O LKDRXBCSQODPBY-AMVSKUEXSA-N 0.000 description 1
- 239000004201 L-cysteine Substances 0.000 description 1
- 235000013878 L-cysteine Nutrition 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 241000239218 Limulus Species 0.000 description 1
- LTXREWYXXSTFRX-QGZVFWFLSA-N Linagliptin Chemical compound N=1C=2N(C)C(=O)N(CC=3N=C4C=CC=CC4=C(C)N=3)C(=O)C=2N(CC#CC)C=1N1CCC[C@@H](N)C1 LTXREWYXXSTFRX-QGZVFWFLSA-N 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- XVVOERDUTLJJHN-UHFFFAOYSA-N Lixisenatide Chemical compound C=1NC2=CC=CC=C2C=1CC(C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)NC(CC(N)=O)C(=O)NCC(=O)NCC(=O)N1C(CCC1)C(=O)NC(CO)C(=O)NC(CO)C(=O)NCC(=O)NC(C)C(=O)N1C(CCC1)C(=O)N1C(CCC1)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)CC)NC(=O)C(NC(=O)C(CC(C)C)NC(=O)C(CCCNC(N)=N)NC(=O)C(NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(CCC(O)=O)NC(=O)C(CCC(O)=O)NC(=O)C(CCSC)NC(=O)C(CCC(N)=O)NC(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(CC(O)=O)NC(=O)C(CO)NC(=O)C(NC(=O)C(CC=1C=CC=CC=1)NC(=O)C(NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)CNC(=O)C(N)CC=1NC=NC=1)C(C)O)C(C)O)C(C)C)CC1=CC=CC=C1 XVVOERDUTLJJHN-UHFFFAOYSA-N 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical class OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 1
- 238000006957 Michael reaction Methods 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- FSVCELGFZIQNCK-UHFFFAOYSA-N N,N-bis(2-hydroxyethyl)glycine Chemical compound OCCN(CCO)CC(O)=O FSVCELGFZIQNCK-UHFFFAOYSA-N 0.000 description 1
- ZKGNPQKYVKXMGJ-UHFFFAOYSA-N N,N-dimethylacetamide Chemical compound CN(C)C(C)=O.CN(C)C(C)=O ZKGNPQKYVKXMGJ-UHFFFAOYSA-N 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 102400000319 Oxyntomodulin Human genes 0.000 description 1
- 101800001388 Oxyntomodulin Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 108010022233 Plasminogen Activator Inhibitor 1 Proteins 0.000 description 1
- 102100039418 Plasminogen activator inhibitor 1 Human genes 0.000 description 1
- 229920002562 Polyethylene Glycol 3350 Polymers 0.000 description 1
- 229920002565 Polyethylene Glycol 400 Polymers 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 239000004373 Pullulan Substances 0.000 description 1
- 229920001218 Pullulan Polymers 0.000 description 1
- 108010033585 Receptor Activity-Modifying Protein 3 Proteins 0.000 description 1
- 102100030696 Receptor activity-modifying protein 2 Human genes 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 101100221606 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) COS7 gene Proteins 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 239000004288 Sodium dehydroacetate Substances 0.000 description 1
- 229940123518 Sodium/glucose cotransporter 2 inhibitor Drugs 0.000 description 1
- 101001126150 Solanum lycopersicum Probable aquaporin PIP-type pTOM75 Proteins 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 206010042618 Surgical procedure repeated Diseases 0.000 description 1
- 208000002463 Sveinsson chorioretinal atrophy Diseases 0.000 description 1
- 229920002253 Tannate Chemical class 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- 229940123464 Thiazolidinedione Drugs 0.000 description 1
- JLRGJRBPOGGCBT-UHFFFAOYSA-N Tolbutamide Chemical compound CCCCNC(=O)NS(=O)(=O)C1=CC=C(C)C=C1 JLRGJRBPOGGCBT-UHFFFAOYSA-N 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Triethanolamine Chemical compound OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- RDWDVLFMPFUBDV-PXMDEAMVSA-N [(e)-(1-cyano-2-ethoxy-2-oxoethylidene)amino]oxy-tripyrrolidin-1-ylphosphanium;hexafluorophosphate Chemical compound F[P-](F)(F)(F)(F)F.C1CCCN1[P+](N1CCCC1)(O/N=C(C(=O)OCC)\C#N)N1CCCC1 RDWDVLFMPFUBDV-PXMDEAMVSA-N 0.000 description 1
- 210000000579 abdominal fat Anatomy 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 238000010306 acid treatment Methods 0.000 description 1
- 239000003929 acidic solution Substances 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 102000030621 adenylate cyclase Human genes 0.000 description 1
- 108060000200 adenylate cyclase Proteins 0.000 description 1
- WNLRTRBMVRJNCN-UHFFFAOYSA-L adipate(2-) Chemical compound [O-]C(=O)CCCCC([O-])=O WNLRTRBMVRJNCN-UHFFFAOYSA-L 0.000 description 1
- 230000008484 agonism Effects 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- 239000012670 alkaline solution Substances 0.000 description 1
- 150000001350 alkyl halides Chemical class 0.000 description 1
- 229960001667 alogliptin Drugs 0.000 description 1
- ZSBOMTDTBDDKMP-OAHLLOKOSA-N alogliptin Chemical compound C=1C=CC=C(C#N)C=1CN1C(=O)N(C)C(=O)C=C1N1CCC[C@@H](N)C1 ZSBOMTDTBDDKMP-OAHLLOKOSA-N 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 150000001371 alpha-amino acids Chemical class 0.000 description 1
- 235000008206 alpha-amino acids Nutrition 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 229910021529 ammonia Inorganic materials 0.000 description 1
- 101150062861 amy3 gene Proteins 0.000 description 1
- 239000003945 anionic surfactant Substances 0.000 description 1
- 239000000611 antibody drug conjugate Substances 0.000 description 1
- 229940049595 antibody-drug conjugate Drugs 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 230000036528 appetite Effects 0.000 description 1
- 235000019789 appetite Nutrition 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 229940114079 arachidonic acid Drugs 0.000 description 1
- 235000021342 arachidonic acid Nutrition 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 238000007681 bariatric surgery Methods 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 229940116224 behenate Drugs 0.000 description 1
- UKMSUNONTOPOIO-UHFFFAOYSA-M behenate Chemical compound CCCCCCCCCCCCCCCCCCCCCC([O-])=O UKMSUNONTOPOIO-UHFFFAOYSA-M 0.000 description 1
- 229940116226 behenic acid Drugs 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- JUHORIMYRDESRB-UHFFFAOYSA-N benzathine Chemical compound C=1C=CC=CC=1CNCCNCC1=CC=CC=C1 JUHORIMYRDESRB-UHFFFAOYSA-N 0.000 description 1
- LZCZIHQBSCVGRD-UHFFFAOYSA-N benzenecarboximidamide;hydron;chloride Chemical compound [Cl-].NC(=[NH2+])C1=CC=CC=C1 LZCZIHQBSCVGRD-UHFFFAOYSA-N 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- ADSALMJPJUKESW-UHFFFAOYSA-N beta-Homoproline Chemical compound OC(=O)CC1CCCN1 ADSALMJPJUKESW-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 150000004283 biguanides Chemical class 0.000 description 1
- 229920000080 bile acid sequestrant Polymers 0.000 description 1
- 229940096699 bile acid sequestrants Drugs 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 238000012575 bio-layer interferometry Methods 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000004305 biphenyl Substances 0.000 description 1
- 235000010290 biphenyl Nutrition 0.000 description 1
- 125000006267 biphenyl group Chemical group 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 238000005864 bromoacetylation reaction Methods 0.000 description 1
- OZVBMTJYIDMWIL-AYFBDAFISA-N bromocriptine Chemical compound C1=CC(C=2[C@H](N(C)C[C@@H](C=2)C(=O)N[C@]2(C(=O)N3[C@H](C(N4CCC[C@H]4[C@]3(O)O2)=O)CC(C)C)C(C)C)C2)=C3C2=C(Br)NC3=C1 OZVBMTJYIDMWIL-AYFBDAFISA-N 0.000 description 1
- 229960002802 bromocriptine Drugs 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 235000019437 butane-1,3-diol Nutrition 0.000 description 1
- 229960003773 calcitonin (salmon synthetic) Drugs 0.000 description 1
- FATUQANACHZLRT-KMRXSBRUSA-L calcium glucoheptonate Chemical compound [Ca+2].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)C([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)C([O-])=O FATUQANACHZLRT-KMRXSBRUSA-L 0.000 description 1
- MIOPJNTWMNEORI-UHFFFAOYSA-N camphorsulfonic acid Chemical compound C1CC2(CS(O)(=O)=O)C(=O)CC1C2(C)C MIOPJNTWMNEORI-UHFFFAOYSA-N 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 230000021235 carbamoylation Effects 0.000 description 1
- 125000005517 carbenium group Chemical group 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 229910002091 carbon monoxide Inorganic materials 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 229960003362 carbutamide Drugs 0.000 description 1
- VDTNNGKXZGSZIP-UHFFFAOYSA-N carbutamide Chemical compound CCCCNC(=O)NS(=O)(=O)C1=CC=C(N)C=C1 VDTNNGKXZGSZIP-UHFFFAOYSA-N 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 239000003093 cationic surfactant Substances 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000012412 chemical coupling Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229960003260 chlorhexidine Drugs 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 229960002242 chlorocresol Drugs 0.000 description 1
- VDANGULDQQJODZ-UHFFFAOYSA-N chloroprocaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1Cl VDANGULDQQJODZ-UHFFFAOYSA-N 0.000 description 1
- 229960002023 chloroprocaine Drugs 0.000 description 1
- 229960003993 chlorphenesin Drugs 0.000 description 1
- 229960001761 chlorpropamide Drugs 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- 238000013375 chromatographic separation Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 229950009226 ciglitazone Drugs 0.000 description 1
- YZFWTZACSRHJQD-UHFFFAOYSA-N ciglitazone Chemical compound C=1C=C(CC2C(NC(=O)S2)=O)C=CC=1OCC1(C)CCCCC1 YZFWTZACSRHJQD-UHFFFAOYSA-N 0.000 description 1
- LOUPRKONTZGTKE-UHFFFAOYSA-N cinchonine Natural products C1C(C(C2)C=C)CCN2C1C(O)C1=CC=NC2=CC=C(OC)C=C21 LOUPRKONTZGTKE-UHFFFAOYSA-N 0.000 description 1
- 238000005352 clarification Methods 0.000 description 1
- 230000007012 clinical effect Effects 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 229960001152 colesevelam Drugs 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 239000007891 compressed tablet Substances 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 239000006184 cosolvent Substances 0.000 description 1
- 239000007822 coupling agent Substances 0.000 description 1
- 238000009295 crossflow filtration Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- 239000000625 cyclamic acid and its Na and Ca salt Substances 0.000 description 1
- 150000004294 cyclic thioethers Chemical group 0.000 description 1
- HCAJEUSONLESMK-UHFFFAOYSA-N cyclohexylsulfamic acid Chemical compound OS(=O)(=O)NC1CCCCC1 HCAJEUSONLESMK-UHFFFAOYSA-N 0.000 description 1
- 150000001945 cysteines Chemical class 0.000 description 1
- 229950006689 darglitazone Drugs 0.000 description 1
- QQKNSPHAFATFNQ-UHFFFAOYSA-N darglitazone Chemical compound CC=1OC(C=2C=CC=CC=2)=NC=1CCC(=O)C(C=C1)=CC=C1CC1SC(=O)NC1=O QQKNSPHAFATFNQ-UHFFFAOYSA-N 0.000 description 1
- DEZRYPDIMOWBDS-UHFFFAOYSA-N dcm dichloromethane Chemical compound ClCCl.ClCCl DEZRYPDIMOWBDS-UHFFFAOYSA-N 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000011033 desalting Methods 0.000 description 1
- 239000002274 desiccant Substances 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- ACYGYJFTZSAZKR-UHFFFAOYSA-J dicalcium;2-[2-[bis(carboxylatomethyl)amino]ethyl-(carboxylatomethyl)amino]acetate Chemical compound [Ca+2].[Ca+2].[O-]C(=O)CN(CC([O-])=O)CCN(CC([O-])=O)CC([O-])=O ACYGYJFTZSAZKR-UHFFFAOYSA-J 0.000 description 1
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- UXGNZZKBCMGWAZ-UHFFFAOYSA-N dimethylformamide dmf Chemical compound CN(C)C=O.CN(C)C=O UXGNZZKBCMGWAZ-UHFFFAOYSA-N 0.000 description 1
- 229940090124 dipeptidyl peptidase 4 (dpp-4) inhibitors for blood glucose lowering Drugs 0.000 description 1
- 239000001177 diphosphate Substances 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-M dodecanoate Chemical compound CCCCCCCCCCCC([O-])=O POULHZVOKOAJMA-UHFFFAOYSA-M 0.000 description 1
- MOTZDAYCYVMXPC-UHFFFAOYSA-N dodecyl hydrogen sulfate Chemical compound CCCCCCCCCCCCOS(O)(=O)=O MOTZDAYCYVMXPC-UHFFFAOYSA-N 0.000 description 1
- 229940043264 dodecyl sulfate Drugs 0.000 description 1
- 239000003136 dopamine receptor stimulating agent Substances 0.000 description 1
- 239000008298 dragée Substances 0.000 description 1
- 239000003651 drinking water Substances 0.000 description 1
- 235000020188 drinking water Nutrition 0.000 description 1
- 230000002183 duodenal effect Effects 0.000 description 1
- 229940009662 edetate Drugs 0.000 description 1
- 230000009881 electrostatic interaction Effects 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 108010072542 endotoxin binding proteins Proteins 0.000 description 1
- 229950002375 englitazone Drugs 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 1
- OCLXJTCGWSSVOE-UHFFFAOYSA-N ethanol etoh Chemical compound CCO.CCO OCLXJTCGWSSVOE-UHFFFAOYSA-N 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 235000010228 ethyl p-hydroxybenzoate Nutrition 0.000 description 1
- OJCSPXHYDFONPU-UHFFFAOYSA-N etoac etoac Chemical compound CCOC(C)=O.CCOC(C)=O OJCSPXHYDFONPU-UHFFFAOYSA-N 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 238000013265 extended release Methods 0.000 description 1
- HOXINJBQVZWYGZ-UHFFFAOYSA-N fenbutatin oxide Chemical compound C=1C=CC=CC=1C(C)(C)C[Sn](O[Sn](CC(C)(C)C=1C=CC=CC=1)(CC(C)(C)C=1C=CC=CC=1)CC(C)(C)C=1C=CC=CC=1)(CC(C)(C)C=1C=CC=CC=1)CC(C)(C)C1=CC=CC=C1 HOXINJBQVZWYGZ-UHFFFAOYSA-N 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 1
- 238000001640 fractional crystallisation Methods 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- FBPFZTCFMRRESA-GUCUJZIJSA-N galactitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-GUCUJZIJSA-N 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 238000012215 gene cloning Methods 0.000 description 1
- 229960004580 glibenclamide Drugs 0.000 description 1
- 229960001764 glibornuride Drugs 0.000 description 1
- RMTYNAPTNBJHQI-LLDVTBCESA-N glibornuride Chemical compound C1=CC(C)=CC=C1S(=O)(=O)NC(=O)N[C@H]1[C@H](C2(C)C)CC[C@@]2(C)[C@H]1O RMTYNAPTNBJHQI-LLDVTBCESA-N 0.000 description 1
- 229960004346 glimepiride Drugs 0.000 description 1
- WIGIZIANZCJQQY-RUCARUNLSA-N glimepiride Chemical compound O=C1C(CC)=C(C)CN1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)N[C@@H]2CC[C@@H](C)CC2)C=C1 WIGIZIANZCJQQY-RUCARUNLSA-N 0.000 description 1
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 description 1
- 229960004666 glucagon Drugs 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 230000014101 glucose homeostasis Effects 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 235000004554 glutamine Nutrition 0.000 description 1
- ZNNLBTZKUZBEKO-UHFFFAOYSA-N glyburide Chemical compound COC1=CC=C(Cl)C=C1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)NC2CCCCC2)C=C1 ZNNLBTZKUZBEKO-UHFFFAOYSA-N 0.000 description 1
- 108091005995 glycated hemoglobin Proteins 0.000 description 1
- 229960005150 glycerol Drugs 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 229940043257 glycylglycine Drugs 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- FBPFZTCFMRRESA-UHFFFAOYSA-N hexane-1,2,3,4,5,6-hexol Chemical compound OCC(O)C(O)C(O)C(O)CO FBPFZTCFMRRESA-UHFFFAOYSA-N 0.000 description 1
- 238000000589 high-performance liquid chromatography-mass spectrometry Methods 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- XGIHQYAWBCFNPY-AZOCGYLKSA-N hydrabamine Chemical compound C([C@@H]12)CC3=CC(C(C)C)=CC=C3[C@@]2(C)CCC[C@@]1(C)CNCCNC[C@@]1(C)[C@@H]2CCC3=CC(C(C)C)=CC=C3[C@@]2(C)CCC1 XGIHQYAWBCFNPY-AZOCGYLKSA-N 0.000 description 1
- 150000004677 hydrates Chemical class 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- 229940071870 hydroiodic acid Drugs 0.000 description 1
- 229940050526 hydroxyethylstarch Drugs 0.000 description 1
- ZCTXEAQXZGPWFG-UHFFFAOYSA-N imidurea Chemical compound O=C1NC(=O)N(CO)C1NC(=O)NCNC(=O)NC1C(=O)NC(=O)N1CO ZCTXEAQXZGPWFG-UHFFFAOYSA-N 0.000 description 1
- 229940113174 imidurea Drugs 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000005462 in vivo assay Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- CDAISMWEOUEBRE-GPIVLXJGSA-N inositol Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O CDAISMWEOUEBRE-GPIVLXJGSA-N 0.000 description 1
- 229960000367 inositol Drugs 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 238000003402 intramolecular cyclocondensation reaction Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 125000000741 isoleucyl group Chemical group [H]N([H])C(C(C([H])([H])[H])C([H])([H])C([H])([H])[H])C(=O)O* 0.000 description 1
- FZWBNHMXJMCXLU-BLAUPYHCSA-N isomaltotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)O1 FZWBNHMXJMCXLU-BLAUPYHCSA-N 0.000 description 1
- 230000000155 isotopic effect Effects 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 229940001447 lactate Drugs 0.000 description 1
- 229940099584 lactobionate Drugs 0.000 description 1
- JYTUSYBCFIZPBE-AMTLMPIISA-N lactobionic acid Chemical compound OC(=O)[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O JYTUSYBCFIZPBE-AMTLMPIISA-N 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229940070765 laurate Drugs 0.000 description 1
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 229960002397 linagliptin Drugs 0.000 description 1
- 230000004576 lipid-binding Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- 108010004367 lixisenatide Proteins 0.000 description 1
- 229960001093 lixisenatide Drugs 0.000 description 1
- 229950007685 lobeglitazone Drugs 0.000 description 1
- CHHXEZSCHQVSRE-UHFFFAOYSA-N lobeglitazone Chemical compound C1=CC(OC)=CC=C1OC1=CC(N(C)CCOC=2C=CC(CC3C(NC(=O)S3)=O)=CC=2)=NC=N1 CHHXEZSCHQVSRE-UHFFFAOYSA-N 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 159000000003 magnesium salts Chemical class 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 229940049920 malate Drugs 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- 125000005439 maleimidyl group Chemical group C1(C=CC(N1*)=O)=O 0.000 description 1
- 239000001630 malic acid Substances 0.000 description 1
- 235000011090 malic acid Nutrition 0.000 description 1
- IWYDHOAUDWTVEP-UHFFFAOYSA-M mandelate Chemical compound [O-]C(=O)C(O)C1=CC=CC=C1 IWYDHOAUDWTVEP-UHFFFAOYSA-M 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000001819 mass spectrum Methods 0.000 description 1
- BCVXHSPFUWZLGQ-UHFFFAOYSA-N mecn acetonitrile Chemical compound CC#N.CC#N BCVXHSPFUWZLGQ-UHFFFAOYSA-N 0.000 description 1
- 229960003194 meglumine Drugs 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 229940098779 methanesulfonic acid Drugs 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- UZKWTJUDCOPSNM-UHFFFAOYSA-N methoxybenzene Substances CCCCOC=C UZKWTJUDCOPSNM-UHFFFAOYSA-N 0.000 description 1
- 229940102396 methyl bromide Drugs 0.000 description 1
- LRMHVVPPGGOAJQ-UHFFFAOYSA-N methyl nitrate Chemical compound CO[N+]([O-])=O LRMHVVPPGGOAJQ-UHFFFAOYSA-N 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- JZMJDSHXVKJFKW-UHFFFAOYSA-M methyl sulfate(1-) Chemical compound COS([O-])(=O)=O JZMJDSHXVKJFKW-UHFFFAOYSA-M 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- PXZWGQLGAKCNKD-DPNMSELWSA-N molport-023-276-326 Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 PXZWGQLGAKCNKD-DPNMSELWSA-N 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 229910000403 monosodium phosphate Inorganic materials 0.000 description 1
- 235000019799 monosodium phosphate Nutrition 0.000 description 1
- PJUIMOJAAPLTRJ-UHFFFAOYSA-N monothioglycerol Chemical compound OCC(O)CS PJUIMOJAAPLTRJ-UHFFFAOYSA-N 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 229940105132 myristate Drugs 0.000 description 1
- PSZYNBSKGUBXEH-UHFFFAOYSA-M naphthalene-1-sulfonate Chemical compound C1=CC=C2C(S(=O)(=O)[O-])=CC=CC2=C1 PSZYNBSKGUBXEH-UHFFFAOYSA-M 0.000 description 1
- KVBGVZZKJNLNJU-UHFFFAOYSA-N naphthalene-2-sulfonic acid Chemical compound C1=CC=CC2=CC(S(=O)(=O)O)=CC=C21 KVBGVZZKJNLNJU-UHFFFAOYSA-N 0.000 description 1
- 229960000698 nateglinide Drugs 0.000 description 1
- OELFLUMRDSZNSF-BRWVUGGUSA-N nateglinide Chemical compound C1C[C@@H](C(C)C)CC[C@@H]1C(=O)N[C@@H](C(O)=O)CC1=CC=CC=C1 OELFLUMRDSZNSF-BRWVUGGUSA-N 0.000 description 1
- 238000004848 nephelometry Methods 0.000 description 1
- 230000000955 neuroendocrine Effects 0.000 description 1
- FEMOMIGRRWSMCU-UHFFFAOYSA-N ninhydrin Chemical compound C1=CC=C2C(=O)C(O)(O)C(=O)C2=C1 FEMOMIGRRWSMCU-UHFFFAOYSA-N 0.000 description 1
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- VIKNJXKGJWUCNN-XGXHKTLJSA-N norethisterone Chemical compound O=C1CC[C@@H]2[C@H]3CC[C@](C)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1 VIKNJXKGJWUCNN-XGXHKTLJSA-N 0.000 description 1
- 238000000655 nuclear magnetic resonance spectrum Methods 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- TVMXDCGIABBOFY-UHFFFAOYSA-N octane Chemical compound CCCCCCCC TVMXDCGIABBOFY-UHFFFAOYSA-N 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 229940049964 oleate Drugs 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical class 0.000 description 1
- 238000001543 one-way ANOVA Methods 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 239000012074 organic phase Substances 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 235000006408 oxalic acid Nutrition 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000006174 pH buffer Substances 0.000 description 1
- KDLHZDBZIXYQEI-UHFFFAOYSA-N palladium Substances [Pd] KDLHZDBZIXYQEI-UHFFFAOYSA-N 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 229940014662 pantothenate Drugs 0.000 description 1
- 235000019161 pantothenic acid Nutrition 0.000 description 1
- 239000011713 pantothenic acid Substances 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 235000019371 penicillin G benzathine Nutrition 0.000 description 1
- JLFNLZLINWHATN-UHFFFAOYSA-N pentaethylene glycol Chemical compound OCCOCCOCCOCCOCCO JLFNLZLINWHATN-UHFFFAOYSA-N 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 239000000863 peptide conjugate Substances 0.000 description 1
- 125000001151 peptidyl group Chemical group 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229960005323 phenoxyethanol Drugs 0.000 description 1
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- ZUOUZKKEUPVFJK-UHFFFAOYSA-N phenylbenzene Natural products C1=CC=CC=C1C1=CC=CC=C1 ZUOUZKKEUPVFJK-UHFFFAOYSA-N 0.000 description 1
- PARWUHTVGZSQPD-UHFFFAOYSA-N phenylsilane Chemical compound [SiH3]C1=CC=CC=C1 PARWUHTVGZSQPD-UHFFFAOYSA-N 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 150000004714 phosphonium salts Chemical class 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 229960005095 pioglitazone Drugs 0.000 description 1
- 229950010765 pivalate Drugs 0.000 description 1
- IUGYQRQAERSCNH-UHFFFAOYSA-N pivalic acid Chemical compound CC(C)(C)C(O)=O IUGYQRQAERSCNH-UHFFFAOYSA-N 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 229920000166 polytrimethylene carbonate Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229960003975 potassium Drugs 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 159000000001 potassium salts Chemical class 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 238000004237 preparative chromatography Methods 0.000 description 1
- GCYXWQUSHADNBF-AAEALURTSA-N preproglucagon 78-108 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 GCYXWQUSHADNBF-AAEALURTSA-N 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 239000012562 protein A resin Substances 0.000 description 1
- 230000003331 prothrombotic effect Effects 0.000 description 1
- 235000019423 pullulan Nutrition 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- 238000003908 quality control method Methods 0.000 description 1
- 150000003242 quaternary ammonium salts Chemical class 0.000 description 1
- 229960000948 quinine Drugs 0.000 description 1
- 150000003254 radicals Chemical class 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 210000001202 rhombencephalon Anatomy 0.000 description 1
- 238000007142 ring opening reaction Methods 0.000 description 1
- 102200067010 rs587621539 Human genes 0.000 description 1
- 102220045199 rs587781908 Human genes 0.000 description 1
- 102220058908 rs751646468 Human genes 0.000 description 1
- YGSDEFSMJLZEOE-UHFFFAOYSA-M salicylate Chemical class OC1=CC=CC=C1C([O-])=O YGSDEFSMJLZEOE-UHFFFAOYSA-M 0.000 description 1
- 229960001860 salicylate Drugs 0.000 description 1
- 108010068072 salmon calcitonin Proteins 0.000 description 1
- 230000036186 satiety Effects 0.000 description 1
- 235000019627 satiety Nutrition 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 229960004937 saxagliptin Drugs 0.000 description 1
- QGJUIPDUBHWZPV-SGTAVMJGSA-N saxagliptin Chemical compound C1C(C2)CC(C3)CC2(O)CC13[C@H](N)C(=O)N1[C@H](C#N)C[C@@H]2C[C@@H]21 QGJUIPDUBHWZPV-SGTAVMJGSA-N 0.000 description 1
- 108010033693 saxagliptin Proteins 0.000 description 1
- CDAISMWEOUEBRE-UHFFFAOYSA-N scyllo-inosotol Natural products OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 238000004904 shortening Methods 0.000 description 1
- 238000007086 side reaction Methods 0.000 description 1
- 229960004034 sitagliptin Drugs 0.000 description 1
- MFFMDFFZMYYVKS-SECBINFHSA-N sitagliptin Chemical compound C([C@H](CC(=O)N1CC=2N(C(=NN=2)C(F)(F)F)CC1)N)C1=CC(F)=C(F)C=C1F MFFMDFFZMYYVKS-SECBINFHSA-N 0.000 description 1
- 229940126586 small molecule drug Drugs 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 235000017550 sodium carbonate Nutrition 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 235000019259 sodium dehydroacetate Nutrition 0.000 description 1
- 229940079839 sodium dehydroacetate Drugs 0.000 description 1
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 235000011008 sodium phosphates Nutrition 0.000 description 1
- DSOWAKKSGYUMTF-GZOLSCHFSA-M sodium;(1e)-1-(6-methyl-2,4-dioxopyran-3-ylidene)ethanolate Chemical compound [Na+].C\C([O-])=C1/C(=O)OC(C)=CC1=O DSOWAKKSGYUMTF-GZOLSCHFSA-M 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 229940032147 starch Drugs 0.000 description 1
- 229940114926 stearate Drugs 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- WPLOVIFNBMNBPD-ATHMIXSHSA-N subtilin Chemical compound CC1SCC(NC2=O)C(=O)NC(CC(N)=O)C(=O)NC(C(=O)NC(CCCCN)C(=O)NC(C(C)CC)C(=O)NC(=C)C(=O)NC(CCCCN)C(O)=O)CSC(C)C2NC(=O)C(CC(C)C)NC(=O)C1NC(=O)C(CCC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C1NC(=O)C(=C/C)/NC(=O)C(CCC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C2NC(=O)CNC(=O)C3CCCN3C(=O)C(NC(=O)C3NC(=O)C(CC(C)C)NC(=O)C(=C)NC(=O)C(CCC(O)=O)NC(=O)C(NC(=O)C(CCCCN)NC(=O)C(N)CC=4C5=CC=CC=C5NC=4)CSC3)C(C)SC2)C(C)C)C(C)SC1)CC1=CC=CC=C1 WPLOVIFNBMNBPD-ATHMIXSHSA-N 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 230000019635 sulfation Effects 0.000 description 1
- 238000005670 sulfation reaction Methods 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 230000001502 supplementing effect Effects 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 229960001367 tartaric acid Drugs 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- YBRBMKDOPFTVDT-UHFFFAOYSA-N tert-butylamine Chemical compound CC(C)(C)N YBRBMKDOPFTVDT-UHFFFAOYSA-N 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- TUNFSRHWOTWDNC-UHFFFAOYSA-N tetradecanoic acid Chemical compound CCCCCCCCCCCCCC(O)=O TUNFSRHWOTWDNC-UHFFFAOYSA-N 0.000 description 1
- WROMPOXWARCANT-UHFFFAOYSA-N tfa trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.OC(=O)C(F)(F)F WROMPOXWARCANT-UHFFFAOYSA-N 0.000 description 1
- 238000011287 therapeutic dose Methods 0.000 description 1
- 150000001467 thiazolidinediones Chemical class 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- DLFVBJFMPXGRIB-UHFFFAOYSA-N thioacetamide Natural products CC(N)=O DLFVBJFMPXGRIB-UHFFFAOYSA-N 0.000 description 1
- 229940035024 thioglycerol Drugs 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 238000001269 time-of-flight mass spectrometry Methods 0.000 description 1
- 229960002277 tolazamide Drugs 0.000 description 1
- OUDSBRTVNLOZBN-UHFFFAOYSA-N tolazamide Chemical compound C1=CC(C)=CC=C1S(=O)(=O)NC(=O)NN1CCCCCC1 OUDSBRTVNLOZBN-UHFFFAOYSA-N 0.000 description 1
- 229960005371 tolbutamide Drugs 0.000 description 1
- 239000012929 tonicity agent Substances 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 238000011824 transgenic rat model Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- UFTFJSFQGQCHQW-UHFFFAOYSA-N triformin Chemical compound O=COCC(OC=O)COC=O UFTFJSFQGQCHQW-UHFFFAOYSA-N 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- GXPHKUHSUJUWKP-UHFFFAOYSA-N troglitazone Chemical compound C1CC=2C(C)=C(O)C(C)=C(C)C=2OC1(C)COC(C=C1)=CC=C1CC1SC(=O)NC1=O GXPHKUHSUJUWKP-UHFFFAOYSA-N 0.000 description 1
- 229960001641 troglitazone Drugs 0.000 description 1
- GXPHKUHSUJUWKP-NTKDMRAZSA-N troglitazone Natural products C([C@@]1(OC=2C(C)=C(C(=C(C)C=2CC1)O)C)C)OC(C=C1)=CC=C1C[C@H]1SC(=O)NC1=O GXPHKUHSUJUWKP-NTKDMRAZSA-N 0.000 description 1
- 229960004418 trolamine Drugs 0.000 description 1
- 229960000281 trometamol Drugs 0.000 description 1
- 125000000430 tryptophan group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C2=C([H])C([H])=C([H])C([H])=C12 0.000 description 1
- 238000007492 two-way ANOVA Methods 0.000 description 1
- 238000000825 ultraviolet detection Methods 0.000 description 1
- 229920003176 water-insoluble polymer Polymers 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
- 239000002888 zwitterionic surfactant Substances 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/72—Receptors; Cell surface antigens; Cell surface determinants for hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
Abstract
The present invention relates to amylin mimetic peptide analogs, and derivatives thereof, in which the N-terminus of each peptide is covalently linked to an internal amino acid side chain thiol functional group through a nonpeptidyl cyclization bridge element. Thioether-cyclized amylin mimetic analogs and derivatives thereof may comprise one or more alterations (including substitutions, insertions, deletions, and modifications), and may optionally comprise a serum albumin binding element such as an alkyl chain of at least 14 carbon atoms, optionally with additional pendant carboxylate moieties or half-life extending biological moieties such as HSA, non-targeting mabs, or Fc. In addition, the present invention relates to compositions thereof and methods of treating conditions responsive to amylin receptor modulation.
Description
This application claims the benefit of U.S. provisional patent application serial No. 62/662,492, filed 2018, 4, 25, which is hereby incorporated by reference in its entirety.
Sequence listing
This application contains a sequence listing that has been electronically submitted in ASCII format and is hereby incorporated by reference in its entirety. The ASCII copy was created in 2019 on 16.4.2019, named PRD3471WOPCT1_ sl. txt, and was 55,747 bytes in size.
Technical Field
The present invention relates to thioether-cyclized analogs of amylin, pramlintide and davalintide and derivatives thereof (referred to herein as "amylin mimetics") that act as agonists of the amylin receptor and are therefore useful in the treatment of metabolic diseases and disorders, such as obesity, type 2 diabetes, metabolic syndrome, insulin resistance and dyslipidemia.
Background
Amylin is a naturally occurring 37 amino acid peptide that is a structurally related member of the calcitonin family of peptides, including Calcitonin (CT), calcitonin gene-related peptide (CGRP), Adrenomedullin (AM) and intermediums (AM 2). It is synthesized and secreted by the pancreas in response to the inflow of nutrients into the gastrointestinal tract. After release into the circulation, amylin binds with high affinity to specific class B GPCRs located predominantly in the rearmost region of the hindbrain region of the central nervous system. Thus, it is a centrally acting neuroendocrine hormone used to regulate glucose homeostasis by inhibiting gastric emptying, inhibiting glucagon release and inducing satiety (reviewed in HayDL et al, Pharmacol Rev 2015; 67: 564-. Amylin has been found to interact in vitro with three target receptor subtypes, AMY1R, AMY2R and AMY3R, which are heterodimeric structures consisting of a calcitonin receptor (CTR) and a receptor modifying protein (RAMP 1, RAMP2 and RAMP3, respectively) (Christopoulos G et al, Mol Pharmacol 1999; 56: 235-42). The association of CTR with these RAMPs results in an increase in amylin affinity relative to CTR alone and provides the basis for selective receptor pharmacology of amylin (relative to CT) (Bower RL and Hay DL, Br J Pharmacol 2016; 173: 1883-98). While it is generally accepted that amylin is involved in high affinity/potency interactions, particularly with AMY1R and AMY3R, simultaneous agonism at all receptor subtypes may not necessarily be necessary for pharmacologically beneficial effects. (Hay DL et al, Br J Pharmacol 2018; 175: 3-17; Hay DL, Headache 2017; 57: 89-96).
Human amylin, also known as amylin islet amyloid polypeptide (IAPP), has several physicochemical properties that make it unsuitable for use as a pharmaceutical agent, including most notably its low water solubility and a tendency to self-aggregate and adhere to surfaces. Pramlintide, an equivalent amylin analog, was developed by incorporating three specific residue mutations (A25P, S28P, and S29P) into the amylin sequence (Young AA et al, Drug Dev Res 1996; 37: 231-48). These mutations result in improved physicochemical properties (reduced tendency to aggregate) relative to amylin. Pramlintide reduces food intake (Smith SR et al, AAm J Physiol Endocrinol Metab 2007; 293: E620-7) and body weight (Aronne L et al, J Clin Endocrinol Metab 2007; 92:2977-83) in obese subjects. It is approved as an adjuvant therapy for insulin for the treatment of adult patients with type 1 diabetes, and as an adjuvant therapy for insulin alone or for concurrent treatment with metformin and/or sulfonylureas for adult patients with type 2 diabetes (Pullman J et al, Vasc Health Risk Manag 2006; 2: 203-12). The darvan peptide is related synthetic peptide with the length of 32 amino acids, and the structure of the darvan peptide is a chimera of pramlintide and salmon calcitonin primary sequence. Thus, it lacks the amyloid gene residues of human amylin (Westermark P et al, Proc Natl Acad Sci USA 1990; 87: 5036-40). It is a potent agonist of both the amylin and calcitonin receptors, which exhibits stronger pharmacological properties than native (rat) amylin in reducing food intake and body weight in rats (Mack CM et al, Int J Obes 2010; 34: 385-95). Amylin, pramlintide and davalin each have a very short in vivo half-life (<0.75h), which limits their practical therapeutic utility (Roth JD et al, Immun endo metals Agents in Med Chem 2008; 8: 317-24; Mack CM et al, Diabetes Obes Metab 2011; 13: 1105-13). In the case of pramlintide, this short half-life requires a multiple daily administration regimen to achieve clinical effects. Thus, it would be desirable to obtain amylin agonist peptides or derivatives thereof having improved metabolic stability and pharmacokinetic characteristics.
One technique for extending the half-life of these peptides involves conjugation to a biological carrier, such as albumin, a suitable mAb or antigen-binding fragment thereof, or a mAb-derived crystalline fragment domain (Fc) protein. Such bioconjugation chemistry proceeds through the reaction of selectively reactive thiol functional groups on the bio-carrier molecule with complementary electrophilic sites engineered into the peptide of interest. Although the maleimide functional group incorporated onto the peptide molecule has served as a suitable electrophile for bioconjugation chemistry, the resulting bioconjugate can undergo a reverse conjugation reaction (reverse michael reaction) in vivo, resulting in the loss of the peptide from the biocontainer. Thus, the more stable thioacetamide bond formed by coupling to the reactive haloacetamide-derived peptide serves to avoid the possibility of such reverse conjugation. However, the conditions required for the bromoacetamide conjugation reaction cannot be successfully used with its selectively bioconjugated disulfide-containing amylin analogs due to the unhindered reactivity of the disulfide ring. Such attempted chemistry results in concomitant ring opening and associated complex side reactions. It has long been recognized that AN intact disulfide ring is a key molecular feature required for receptor activation and biological function (Roberts AN et al, Proc Natl Acad Sci USA 1989; 86: 9662-. Herein, an N-terminal cyclic thioether alternative for the dithiocysteine linkage of pramlintide and davalintide was identified that unexpectedly maintained amylin receptor agonist activity and was chemically stable to bioconjugation reactions.
Disclosure of Invention
In one general aspect, the present invention relates to novel amylin mimetic compounds. Also provided herein are amylin mimetic derivatives of pramlintide or davalintide and conjugates thereof comprising a monoclonal antibody or antigen-binding fragment thereof coupled to an amylin mimetic peptide.
In one aspect, the invention is represented by: a compound of formula I or a derivative thereof (SEQ ID NO:53)
Wherein
n is 1 or 2;
Z2is a direct bond, serine or glycine;
Z10Is Q or E;
Z11is R or K, wherein-amine of K is optionally substituted by-C (═ NH) NH2Substitution;
Z25Is P or K, wherein-amine of said K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z26is I or K, wherein-amine of said K is optionally substituted with-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
x is ATZ10Z11Z12ANFZ16VHSSNNFGZ25Z26LPZ29TNVGZ34(SEQ ID NO:54) or VLGRLSQELHRLQTYPRTNTGS (SEQ ID NO: 55);
Z29is P or K, wherein-amine of said K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z34is S or K, wherein-amine of K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
and pharmaceutically acceptable salts thereof.
In certain embodiments, the invention is represented by: a compound of formula I or a derivative thereof, wherein:
n is 1 or 2;
Z2is a direct bond;
Z6Is T;
Z10is Q or E;
Z11is R or K, wherein-amine of K is optionally substituted by-C (═ NH) NH2Substitution;
Z25Is P or K, wherein-amine of said K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z26is I or K, wherein-amine of said K is optionally substituted with-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
x is ATZ10Z11Z12ANFZ16VHSSNNFGZ25Z26LPZ29TNVGZ34(SEQ ID NO:54) or VLGRLSQELHRLQTYPRTNTGS (SEQ ID NO: 55);
Z29is P or K, wherein-amine of said K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z34is S or K, wherein-amine of K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
and pharmaceutically acceptable salts thereof.
In certain embodiments, the invention is represented by: a compound of formula I or a derivative thereof, wherein:
n is 1 or 2;
Z2is a direct bond or serine;
Z10Is Q or E;
Z11is R or K, wherein-amine of K is optionally substituted by-C (═ NH) NH2Substitution;
Z16Is L;
Z25is P or K, wherein-amine of said K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z26is I or K, wherein-amine of said K is optionally substituted with-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
x is ATZ10Z11Z12ANFZ16VHSSNNFGZ25Z26LPZ29TNVGZ34(SEQ ID NO:54) or VLGRLSQELHRLQTYPRTNTGS (SEQ ID NO: 55);
Z29is P or K, wherein-amine of said K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z34is S or K, wherein-amine of K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
and pharmaceutically acceptable salts thereof.
In certain embodiments, the invention is represented by: a compound of formula I or a derivative thereof, wherein:
n is 1 or 2;
Z2is a direct bond;
Z6Is T;
Z10is Q or E;
Z11is R or K, wherein-amine of K is optionally substituted by-C (═ NH) NH2Substitution;
Z16Is L;
Z25is P or K, wherein-amine of said K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond, such that the mAb is present thereonTwo identical compounds of formula I;
Z26is I or K, wherein-amine of said K is optionally substituted with-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
x is ATZ10Z11Z12ANFZ16VHSSNNFGZ25Z26LPZ29TNVGZ34(SEQ ID NO:54) or VLGRLSQELHRLQTYPRTNTGS (SEQ ID NO: 55);
Z29is P or K, wherein-amine of said K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z34is S or K, wherein-amine of K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
and pharmaceutically acceptable salts thereof.
In certain embodiments, the invention is represented by: a compound of formula I or a derivative thereof, wherein:
n is 1 or 2;
Z2is a direct bond or serine;
Z10Is Q or E;
Z11is R or K, wherein-amine of K is-C (═ NH) NH2Substitution;
Z16Is L;
Z25is P or K, wherein-amine of said K is-C (═ O) CH3OrSubstitutionWherein the mAb is substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z26is I or K, wherein-amine of said K is-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
x is ATZ10Z11Z12ANFZ16VHSSNNFGZ25Z26LPZ29TNVGZ34(SEQ ID NO:54) or VLGRLSQELHRLQTYPRTNTGS (SEQ ID NO: 55);
Z29is P or K, wherein-amine of said K is-C (═ O) CH3Substitution;
Z34is S or K, wherein-amine of said K is-C (═ O) CH3Substitution;
and pharmaceutically acceptable salts thereof.
In certain embodiments, the invention is represented by: a compound of formula I or a derivative thereof, wherein:
n is 1 or 2;
Z2is a direct bond;
Z6Is T;
Z10is Q or E;
Z11is R or K, wherein K is-amines by-C (═ NH) NH2Substitution;
Z16Is L;
Z25is P or K, wherein-amine of said K is-C (═ O) CH3Or(ii) substitution, wherein the mAb is substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z26is I or K, wherein-amine of said K is-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
x is ATZ10Z11Z12ANFZ16VHSSNNFGZ25Z26LPZ29TNVGZ34(SEQ ID NO:54) or VLGRLSQELHRLQTYPRTNTGS (SEQ ID NO: 55);
Z29is P or K, wherein-amine of said K is-C (═ O) CH3Substitution;
Z34is S or K, wherein-amine of said K is-C (═ O) CH3Substitution;
and pharmaceutically acceptable salts thereof.
In certain embodiments, the invention is represented by: a compound of formula I or a derivative thereof, wherein:
n is 1 or 2;
Z2is a direct bond or serine;
Z10Is Q or E;
Z11is R or K, wherein-amine of K is-C (═ NH) NH2Substitution;
Z16Is L;
Z25is P or K, wherein-amine of said K is-C (═ O) CH3Or(ii) substitution, wherein the mAb is substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z26is I or K, wherein-amine of said K is-C (═ O) CH3、-C(O)CH2CH=CH2、
Substitution wherein the mAb is via another thioether bond(ii) substitution to a second compound of formula I such that there are two identical compounds of formula I on the mAb;
x is ATZ10Z11Z12ANFZ16VHSSNNFGZ25Z26LPZ29TNVGZ34(SEQ ID NO:54) or VLGRLSQELHRLQTYPRTNTGS (SEQ ID NO: 55);
Z29is P or K, wherein-amine of said K is-C (═ O) CH3Substitution;
Z34is S or K, wherein-amine of said K is-C (═ O) CH3Substitution;
and pharmaceutically acceptable salts thereof.
In certain embodiments, the compound is selected from SEQ ID NOS 4-42, or a pharmaceutically acceptable salt thereof.
In certain embodiments, the monoclonal antibody or antigen binding fragment thereof is covalently attached to the amylin mimetic peptide at a lysine residue of the amylin mimetic peptide via a linker. Non-limiting examples of joints include: PEG chain of 2-24 PEG units, (OEG)(0-4)-γ-Glu)、(OEG(1-4)) Or an alkyl chain containing 2 to 10 carbon atoms, wherein the linker may comprise a group such as, but not limited to, acetyl.
In certain embodiments, Z in formula I25、Z26、Z29And Z34Is a lysine, and the lysine is covalently linked via a linker to an engineered cysteine residue of the monoclonal antibody or antigen binding fragment thereof.
Another embodiment of the invention is a pharmaceutical composition comprising a compound of formula I or a compound selected from SEQ ID NOS 4-42 and a pharmaceutically acceptable carrier.
In certain embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises heavy chain complementarity determining region 1(HCDR1), HCDR2, HCDR3, and light chain complementarity determining region 1(LCDR1), LCDR2, and LCDR3 having polypeptide sequences of SEQ ID NOs: 47, 48, 49, 50, 51, and 52, respectively. In certain embodiments, the isolated monoclonal antibody comprises a heavy chain variable domain (VH) having the polypeptide sequence SEQ ID NO 43 and a light chain variable domain (VL) having the polypeptide sequence SEQ ID NO 45. In certain embodiments, the isolated monoclonal antibody further comprises an Fc portion. In certain embodiments, the isolated monoclonal antibody comprises a Heavy Chain (HC) having the polypeptide sequence of SEQ ID NO:44 and a Light Chain (LC) having the polypeptide sequence of SEQ ID NO: 46.
The present invention also provides a conjugate comprising a monoclonal antibody or antigen-binding fragment thereof coupled to an amylin mimetic peptide, wherein the monoclonal antibody or antigen-binding fragment thereof comprises heavy chain complementarity determining region 1(HCDR1), HCDR2, HCDR3 and light chain complementarity determining region 1(LCDR1), LCDR2 and LCDR3 having polypeptide sequences of SEQ ID NOs 47, 48, 49, 50, 51 and 52, respectively, preferably the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain (VH) having polypeptide sequence SEQ ID NO 43 and a light chain variable domain (VL) having polypeptide sequence SEQ ID NO 45, and more preferably the monoclonal antibody comprises a Heavy Chain (HC) having polypeptide sequence SEQ ID NO 44 and a Light Chain (LC) having polypeptide sequence SEQ ID NO 46; the amylin mimetic peptide comprises a polypeptide sequence selected from the group consisting of SEQ ID NOs 4-28, or a pharmaceutically acceptable salt thereof; and the monoclonal antibody or antigen binding fragment thereof is conjugated to the amylin mimetic peptide at residue 25, 26, 29, or 34 of the amylin mimetic peptide, preferably at lysine residue 25 or 26 of the amylin mimetic peptide, either directly or via a linker.
The invention also provides methods of making the conjugates of the invention. The method comprises reacting an electrophile, preferably bromoacetamide, introduced onto a side chain of, or a linker on, the side chain, preferably a side chain of a lysine residue of the amylin mimetic peptide, with a thiol group of a cysteine residue of SEQ ID NO:49 of the monoclonal antibody or antigen-binding fragment thereof, thereby forming a covalent bond between the amylin mimetic peptide and the monoclonal antibody or antigen-binding fragment thereof.
The invention also provides a pharmaceutical composition comprising a conjugate of the invention and a pharmaceutically acceptable carrier.
The present invention also provides a method for treating or preventing a disease or disorder in a subject in need thereof, wherein the disease or disorder is selected from the group consisting of: obesity, type I or type II diabetes, metabolic syndrome, insulin resistance, impaired glucose tolerance, hyperglycemia, hyperinsulinemia, hypertriglyceridemia, hypoglycemia due to Congenital Hyperinsulinemia (CHI), dyslipidemia, atherosclerosis, diabetic nephropathy, and other cardiovascular risk factors such as hypertension and cardiovascular risk factors associated with unmanaged cholesterol and/or lipid levels, osteoporosis, inflammation, non-alcoholic fatty liver disease (NAFLD), non-alcoholic steatohepatitis (NASH), kidney disease, and eczema. The method comprises administering to a subject in need thereof an effective amount of a pharmaceutical composition of the invention.
The invention also provides methods of reducing food intake in a subject in need thereof. The method comprises administering to a subject in need thereof an effective amount of a pharmaceutical composition of the invention.
The invention also provides methods of modulating amylin receptor activity in a subject in need thereof. The method comprises administering to a subject in need thereof an effective amount of a pharmaceutical composition of the invention.
The present invention also provides methods of modulating amylin receptor activity in a subject in need thereof, wherein the amylin receptor comprises AMY1R, and/or AMY2R, and/or AMY 3R. The method comprises administering to a subject in need thereof an effective amount of a pharmaceutical composition of the invention.
The present invention also provides a method of modulating the activity of an amylin receptor in a subject in need thereof, wherein the amylin receptor is AMY 1R.
The present invention also provides a method of modulating the activity of an amylin receptor in a subject in need thereof, wherein the amylin receptor is AMY 3R.
The method comprises administering to a subject in need thereof an effective amount of a pharmaceutical composition of the invention.
In certain embodiments, the pharmaceutical composition is administered via injection. In certain embodiments, the pharmaceutical composition is administered in combination with at least one antidiabetic agent. The antidiabetic agent may be, for example, a glucagon-like peptide-1 receptor modulator. In certain embodiments, the pharmaceutical composition is administered in combination with liraglutide.
The invention also provides a conjugate comprising the invention, preferably also liraglutide and a device for injection.
The invention also provides a method for preparing the pharmaceutical composition of the invention. The invention includes combining the conjugate with a pharmaceutically acceptable carrier to obtain a pharmaceutical composition.
Other aspects, features and advantages of the present invention will become better understood from a reading of the following detailed description of the invention and the claims.
Drawings
The foregoing summary, as well as the following detailed description of preferred embodiments of the present patent application, will be better understood when read in conjunction with the appended drawings. It should be understood, however, that the application is not limited to the precise embodiments shown in the drawings.
Detailed Description
Various publications, articles and patents are cited or described in the background and throughout the specification; each of these references is incorporated herein by reference in its entirety. The discussion of documents, acts, materials, devices, articles and the like which has been included in this specification is intended to provide a context for the invention. Such discussion is not an admission that any or all of these matters form part of the prior art with respect to any invention disclosed or claimed.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Otherwise, certain terms used herein have the meanings described in the specification.
It should be noted that, as used herein and in the appended claims, the singular forms "a," "an," and "the" include plural referents unless the context clearly dictates otherwise.
Unless otherwise indicated, any numerical value, such as concentrations or concentration ranges set forth herein, is to be understood as being modified in all instances by the term "about". Accordingly, numerical values typically include the stated values ± 10%. For example, a concentration of 1mg/mL includes 0.9mg/mL to 1.1 mg/mL. Also, a concentration range of 1% to 10% (w/v) includes 0.9% (w/v) to 11% (w/v). As used herein, unless the context clearly indicates otherwise, a numerical range used explicitly includes all possible subranges, all individual numerical values within the range, including integers within such range and fractions within the range.
The term "at least" preceding a series of elements is to be understood as referring to each element in the series, unless otherwise indicated. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.
As used herein, the terms "comprises," "comprising," "includes," "including," "has," "having," "contains" or any other variation thereof, are to be construed to mean that a specified integer or group of integers is included, but that no other integer or group of integers is excluded, and that it is non-exclusive or open-ended. For example, a composition, mixture, process, method, article, or apparatus that comprises a list of elements is not necessarily limited to only those elements but may include other elements not expressly listed or inherent to such composition, mixture, process, method, article, or apparatus. Furthermore, unless explicitly stated to the contrary, "or" means an inclusive "or" rather than an exclusive "or". For example, condition a or B is satisfied by either: a is true (or present) and B is false (or not present), a is false (or not present) and B is true (or present), and both a and B are true (or present).
It should also be understood that when referring to dimensions or characteristics of components of the preferred invention, "about", "approximately", "substantially" and similar terms are used herein to indicate that the described dimensions/characteristics are not strict boundaries or parameters and do not exclude minor variations that are functionally identical or similar, as will be understood by those skilled in the art. At the very least, such reference to include numerical parameters is intended to include variations that do not alter the least significant digit using mathematical and industrial principles accepted in the art (e.g., rounding, measurement or other systematic errors, manufacturing tolerances, etc.).
In two or more nucleic acid or polypeptide sequences (e.g., amylin mimetics)3-36Polypeptide sequences, antibody light or heavy chain sequences), the term "identical" or percent "identity" refers to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, or that are the same, when compared and aligned for maximum correspondence, according to the present disclosure, when compared using one of the following sequence comparison algorithms or by visual inspection using methods known in the art.
For sequence alignment, one sequence is typically used as a reference sequence to which test sequences are aligned. When using a sequence alignment algorithm, the test and reference sequences are entered into a computer, subsequence coordinates are designated (if necessary), and program parameters of the sequence algorithm are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence relative to the reference sequence based on the specified program parameters.
Optimal alignment of sequences for comparison can be carried out, for example, by the local homology algorithm of Smith & Waterman, high-end application mathematics, volume 2: page 482(1981) (adv. appl. Math.2:482(1981)) by using the homology alignment algorithm of Needleman & Wunsch, journal of molecular biology, volume 48: page 443(1970) (J mol. biol. 48: 443(1970)), by a method of searching for similarities of Pearson & Lipman, journal of the national academy of sciences of the united states, volume 85: on page 2444(1988) (Proc. Nat' l. Acad. Sci. USA 85: 2444(1988)), by these algorithms (GAP, BESTFIT, FASTA and TFASTA, in the state of Wisconsin genetics software package, genetics computing group, Wisconsin, Madison, Wis., Science No. 575 (Science Dr., Madison, Wis.), computerized implementation, or by visual inspection (see generally, molecular biology laboratory Manual, F.M. Ausubel et al, edited by laboratory Manual, Greeny publishing Association and the Joint venture of Williams (supplementary 1995) (Ausubel)).
Examples of algorithms suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al (1990) journal of molecular biology, Vol.215, p.403-: page 3389-3402 (Nucleic Acids Res.25: 3389-3402). Software for performing BLAST analysis is publicly available through the national center for biotechnology information.
Another indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross-reactive with the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, e.g., where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions.
As used herein, "subject" refers to any animal, preferably a mammal, most preferably a human. As used herein, the term "mammal" encompasses any mammal. Examples of mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, monkeys, humans, and the like, and more preferably, humans.
With respect to the methods of the present invention, the term "administering" means a method of therapeutically or prophylactically preventing, treating, or ameliorating a syndrome, disorder, or disease described herein by using the conjugates of the present invention or forms, compositions, or medicaments thereof. Such methods include administering an effective amount of the conjugate, form, composition or medicament thereof at different times during the course of treatment, or simultaneously in combination. The methods of the invention are understood to encompass all known therapeutic treatment regimens.
The term "effective amount" means that amount of active conjugate that elicits the biological or medicinal response in a tissue system, animal or human that is being sought by a researcher, veterinarian, medical doctor or other clinician, which includes prevention, treatment, or amelioration of the syndrome, disorder, or disease being treated, or the symptoms of the syndrome, disorder, or disease being treated.
As used herein, the term "composition" is intended to encompass a product comprising the specified ingredients in the specified amounts, as well as any product which results, directly or indirectly, from combination of the specified ingredients in the specified amounts.
The term "coupled" as used herein refers to the association or linking together of two or more objects. When referring to a chemical or biological compound, coupling may refer to covalent linkage between two or more chemical or biological compounds. By way of non-limiting example, an antibody of the invention can be coupled to a peptide of interest (e.g., an amylin mimetic peptide of the invention) to form an antibody-coupled peptide. In certain embodiments, an antibody of the invention can be covalently coupled to a peptide of the invention via a linker. The linker may, for example, be first covalently linked to the antibody or peptide and then covalently linked to the peptide or antibody. Antibody-coupled peptides can be formed by specific chemical reactions designed to conjugate antibodies to peptides. By way of example, mAb-coupled amylin mimetic peptide conjugates may be formed by a conjugation reaction. The conjugation reaction may, for example, involve reacting an electrophilic group (e.g., bromoacetamide or maleimide) with the thiol group of a cysteine residue on the mAb. The electrophilic groups may, for example, be introduced onto the side chains of the amino acid residues of the amylin mimetic peptides. The reaction of the electrophilic group with the thiol group results in the formation of covalent thioether bonds.
As used herein, the term "linker" refers to a chemical moiety comprising a covalent chain or atomic chain that covalently links an antibody to a peptide. Linkers can, for example, include, but are not limited to, peptide linkers, hydrocarbon linkers, polyethylene glycol (PEG) linkers, polypropylene glycol (PPG) linkers, polysaccharide linkers, polyester linkers, mixed linkers consisting of PEG and embedded heterocycles, and hydrocarbon chains.
The term "conjugated" as used herein refers to the covalent coupling of an antibody or fragment thereof to a pharmaceutically active moiety. The term "conjugated to" means that the antibody or fragment thereof of the invention is covalently bonded or covalently linked, either directly or indirectly through a linker, to a pharmaceutically active moiety, preferably a therapeutic peptide. By way of non-limiting example, the antibody may be a monoclonal antibody of the invention and the pharmaceutically active moiety may be a therapeutic peptide, such as an amylin mimetic peptide of interest.
Antibodies
As used herein, in the context of an antibody, the term "non-targeted" refers to an antibody that does not specifically bind to any target in vivo. As used herein, an antibody that "specifically binds to a target" refers to a binding at 1 × 108M or less, preferably 5X 109M or less, 1X 10-9M or less, 5X 10-10M or less, or 1X 10-10An antibody with a KD of M or less that binds to a target antigen. The term "KD" refers to the dissociation constant obtained from the ratio of KD to Ka (i.e., KD/Ka) and expressed as molar concentration (M). In accordance with the present disclosure, the KD value of an antibody can be determined using methods in the art. For example, the KD of an antibody can be determined by using surface plasmon resonance, such as by using a biosensor system (e.g., using a biosensor system)System) or by using a bio-layer interferometry technique, such as the OctetRED96 system. The smaller the value of antibody KD, the higher the affinity of the antibody for binding to the target antigen.
Monoclonal antibodies, either intact or fragments thereof, can be used as half-life extending moieties. Monoclonal antibodies are well studied proteins that have been exploited and characterized for in vivo use, and therefore, the mechanisms to achieve their prolonged in vivo half-life and their in vivo elimination mechanisms are well known. In addition, spatial separation and display of the two "arms" of a monoclonal antibody may be advantageous for efficient bivalent display of therapeutic moieties (i.e., therapeutic peptides). Therapeutic agents have been developed in which toxins or other small molecule drugs are chemically bonded to monoclonal antibodies, but they typically utilize monoclonal antibodies that bind to a particular antigen and target the antibody-drug conjugate to the tissue/cell of interest, which preferably expresses the antigen, and typically the drug/small molecule is linked to the antibody in a manner that does not affect the antigen binding of the antibody.
For therapeutic peptide-mAb conjugates, antigen-specific binding of half-life extending monoclonal antibodies is not desired. Thus, pairs of Heavy (HC) and Light (LC) variable (V) domains that do not specifically bind any target would be expected to be useful in the preparation of non-targeted monoclonal antibodies capable of conjugation in accordance with the present invention. To obtain a non-targeted monoclonal antibody capable of conjugation, the cysteine residue is engineered into one of the Complementarity Determining Regions (CDRs) of the selected non-targeted antibody. The pharmaceutically active moiety (e.g., therapeutic peptide/compound) may comprise a suitable chemical moiety to allow conjugation of the pharmaceutically active moiety to the engineered cysteine residue of the non-targeted monoclonal antibody.
As used herein, the term "antibody" is broad and includes non-human (e.g., murine, rat), human adapted, humanized and chimeric monoclonal antibodies; an antibody fragment; bispecific or multispecific antibodies; dimeric, tetrameric or multimeric antibodies; and single chain antibodies.
The light chain of an antibody of any vertebrate species can be assigned to one of two completely different types, κ and λ, based on the amino acid sequence of its constant domains. Thus, an antibody of the invention may contain a kappa or lambda light chain constant domain. According to a particular embodiment, the antibody of the invention comprises heavy and/or light chain constant regions from a mouse or human antibody. In addition to the heavy and light chain constant domains, antibodies comprise an antigen binding region consisting of a light chain variable region and a heavy chain variable region, each variable region comprising three domains (i.e., complementarity determining regions 1-3; (CDR1, CDR2, and CDR 3)). The light chain variable regions are alternatively referred to as LCDR1, LCDR2, and LCRD3, and the heavy chain variable regions are alternatively referred to as HCDR1, HCRD2, and HCDR 3.
Depending on the heavy chain constant domain amino acid sequence, immunoglobulins can be assigned to five major classes, namely IgA, IgD, IgE, IgG and IgM. IgG is the most stable of the five classes of immunoglobulins, with a serum half-life in humans of about 23 days. IgA and IgG are further sub-classified as isotypes IgA1、IgA2、IgG1、IgG2、IgG3And IgG4. Each of the four IgG subclasses has a different biological function, which is referred to as an effector function. These effector functions are typically mediated by interaction with Fc receptors (Fc γ R) or by binding to C1q and fixing complement. Binding to Fc γ R results in antibody-dependent cell-mediated lysis, while binding to complement factors results in complement-mediated lysis. The antibodies of the invention utilized for their ability to extend the half-life of a therapeutic peptide have no or minimal effector function, but retain its ability to bind FcRn, which can be the primary means by which an antibody has an extended half-life in vivo.
In certain embodiments, the invention relates to a conjugate comprising an isolated antibody or antigen-binding fragment thereof comprising a light chain variable region having a fully human Ig germline V gene sequence and a heavy chain variable region having a fully human Ig germline V gene sequence, except that HCDR3 has the amino acid sequence SEQ ID NO:49 and a pharmaceutically active moiety conjugated thereto (e.g., an amylin mimetic peptide of the present invention), wherein the antibody or antigen-binding fragment thereof does not specifically bind to any human antigen in vivo. In the present disclosure, the phrase "a conjugate comprising an antibody or an antigen-binding fragment thereof and a pharmaceutically active moiety conjugated thereto" is used interchangeably with the phrase "an antibody or an antigen-binding fragment thereof conjugated to a pharmaceutically active moiety" in relation to an antibody or an antigen-binding fragment thereof according to embodiments of the present invention.
As used herein, the term "antigen-binding fragment" refers to antibody fragments, such as diabodies, Fab ', F (ab')2, Fv fragments, disulfide stabilized Fv fragments (dsFv), (dsFv)2Bispecific dsFv (dsFv-dsFv'), disulfide stabilized diabodies (ds diabodies), single chain antibody molecules (scFv), single domain antibodies (sdab), scFv dimers (diabodies), multispecific antibodies formed from a portion of an antibody comprising one or more CDRs, camelized single domain antibodies, nanobodies, domain antibodies, bivalent domain antibodies, or any other antibody fragment that binds an antigen but does not comprise a complete antibody structure. The antigen binding fragment is capable of binding to the same antigen as the parent antibody or the antigen to which the parent antibody fragment binds. According to the specific implementationIn one embodiment, the antigen binding fragment comprises a light chain variable region, a light chain constant region, and an Fd segment (i.e., the portion of the heavy chain that is comprised in the Fab fragment). According to other specific embodiments, the antigen binding fragment comprises Fab and F (ab').
As used herein, the term "single chain antibody" refers to a single chain antibody as is conventional in the art, which comprises a heavy chain variable region and a light chain variable region linked by a short peptide of about 15 to about 20 amino acids. As used herein, the term "single domain antibody" refers to a single domain antibody as is conventional in the art, which comprises a heavy chain variable region and a heavy chain constant region or only a heavy chain variable region.
The phrase "isolated antibody or antibody fragment" refers to an antibody or antibody fragment that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds a target antigen is substantially free of antibodies that do not specifically bind the target antigen). Furthermore, an isolated antibody or antibody fragment can be substantially free of other cellular material and/or chemicals.
The antibody variable region consists of a "framework" region interrupted by three "antigen binding sites". Different terms are used to define antigen binding sites: (i) three Complementarity Determining Regions (CDRs) in the VH (HCDR1, HCDR2, HCDR3) and three in the VL (LCDR1, LCDR2, LCDR3) are based on sequence variability (Wu and Kabat, J Exp Med 132: 211-. (ii) Three "hypervariable regions", "HVRs" or "HV" in VH (H1, H2, H3) and three in VL (L1, L2, L3) refer to regions of antibody variable domains which are hypervariable in structure, as defined by Chothia and Lesk (Chothia and Lesk, Mol Biol 196:901-17, 1987). Other terms include "IMGT-CDR" (Lefranc et al, Dev company Immunol 27:55-77,2003) and "specificity determining residue usage" (SDRU) (Almagro, Mol Recognit 17: 132-. The International Immunogenetics (IMGT) database (http:// www-mgt _ org) provides a standardized numbering and definition of antigen binding sites. The correspondence between CDR, HV and IMGT descriptions is described in Lefranc et al, Dev company Immunol 27:55-77,2003.
"framework" or "framework sequence" is the remaining sequence of the variable region except for those sequences defined as antigen binding sites. Because the antigen binding site can be defined by various terms as described above, the exact amino acid sequence of the framework depends on how the antigen binding site is defined.
In one embodiment of the invention, the isolated antibody or antigen-binding fragment thereof comprises a light chain variable region having LCDR1, LCDR2 and LCDR3 having the amino acid sequences SEQ ID NO:50, SEQ ID NO:51 and SEQ ID NO:52, respectively, and a heavy chain variable region having HCDR1, HCDR2 and HCDR3 having the amino acid sequences SEQ ID NO:47, SEQ ID NO:48 and SEQ ID NO:49, respectively.
In another embodiment, the isolated antibody further comprises an Fc region derived from the Fc region of human IgG 4. The human IgG4Fc region has a reduced ability to bind Fc γ R and complement factors compared to other IgG subtypes. Preferably, the Fc region comprises a substituted human IgG4Fc region with an elimination of effector function. Thus, the isolated antibody further comprises an Fc region having a modified human IgG4Fc region comprising one or more of the following substitutions: proline for glutamic acid at residue 233, alanine or valine for phenylalanine at residue 234, and alanine or glutamic acid for leucine at residue 235 (EU numbering, Kabat et al (1991) Sequences of Proteins of Immunological Interest, 5 th edition, U.S. Dept. of Health and Human Services, Bethesda, Md., NIH publication No. 91-3242). Removal of the N-bonded glycosylation site in the IgG4Fc region by replacement of Asn with Ala at residue 297(EU numbering) is another way to ensure elimination of residual effector activity.
Preferably, the antibodies of the invention may exist as dimers held together by disulfide bonds and various non-covalent interactions. Thus, the Fc portion useful in the antibodies of the invention may be a human IgG4Fc region comprising a substitution, such as a serine to proline substitution at position 228(EU numbering), that stabilizes heavy chain dimer formation and prevents the formation of the hemi IgG4Fc chain.
In another embodiment, the C-terminal Lys residue in the heavy chain is removed, as is common in recombinantly produced monoclonal antibodies.
"human antibody" refers to an antibody having a heavy chain variable region and a light chain variable region, wherein both the framework and the antigen-binding site are derived from sequences of human origin. If the antibody comprises a constant region, the constant region is also derived from a sequence of human origin.
A human antibody comprises a heavy chain variable region or a light chain variable region "derived" from a sequence of human origin if the variable regions of the human antibody are derived from a system using human germline immunoglobulins or rearranged immunoglobulin genes. Such systems include human immunoglobulin gene libraries displayed on phage, as well as transgenic non-human animals, such as mice bearing human immunoglobulin loci as described herein. A "human antibody" may comprise amino acid differences resulting from, for example, naturally occurring somatic mutations or deliberate introduction of substitutions in the framework or antigen-binding site when compared to human germline or rearranged immunoglobulin sequences. Typically, the amino acid sequence of a "human antibody" has at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the amino acid sequence encoded by a human germline or rearranged immunoglobulin gene. In some cases, a "human antibody" can comprise a consensus framework sequence derived from human framework sequence analysis (e.g., as described in Knappik et al, J Mol Biol 296:57-86,2000); or binding to synthetic HCDR3 in a human immunoglobulin gene library displayed on phage (e.g., as described in Shi et al, J Mol Biol 397: 385-. Antibodies whose antigen-binding sites are derived from non-human species are not included in the definition of "human antibodies".
The isolated humanized antibody may be synthetic. Although human antibodies are derived from human immunoglobulin sequences, they can be generated using systems such as phage display in conjunction with synthetic CDRs and/or synthetic frameworks, or can be subjected to in vitro mutagenesis to improve antibody properties, resulting in antibodies that do not naturally occur within the full complement of human antibody germline in vivo.
As used herein, the term "recombinant antibody" includes all antibodies prepared, expressed, formed or isolated by recombinant methods, such as antibodies isolated from animals (e.g., mice), i.e., transgenic or transchromosomes of human immunoglobulin genes, or antibodies isolated from hybridomas prepared therefrom; an antibody isolated from a host cell transformed to express the antibody; antibodies isolated from a recombinant combinatorial antibody library; and antibodies prepared, expressed, created or isolated by any other method involving the splicing of human immunoglobulin gene sequences with other DNA sequences, or antibodies generated in vitro using Fab arm swapping.
As used herein, the term "monoclonal antibody" refers to a preparation of antibody molecules of a single molecular composition. The monoclonal antibody of the present invention can be prepared by a hybridoma method, a phage display technique, a single lymphocyte gene cloning technique, or by a recombinant DNA method. For example, a monoclonal antibody can be produced by a hybridoma that includes a B cell obtained from a transgenic non-human animal, such as a transgenic mouse or rat, having a genome comprising a human heavy chain transgene and a light chain transgene.
In certain embodiments, the term "mAb" refers to a monoclonal antibody having a variable heavy chain (VH) sequence comprising SEQ ID NO:43 and a variable light chain (VL) sequence comprising SEQ ID NO: 45. In certain embodiments, the mAb is a fully human monoclonal antibody having a Heavy Chain (HC) sequence comprising SEQ ID NO 44 and a Light Chain (LC) sequence comprising SEQ ID NO 46. In certain embodiments, the lysine residue at position 446 of SEQ ID No. 44 is optionally deleted.
As used herein, the term "chimeric antibody" refers to an antibody in which the amino acid sequences of the immunoglobulin molecules are derived from two or more species. The variable regions of both the light and heavy chains often correspond to those of an antibody derived from one mammalian species (e.g., mouse, rat, rabbit, etc.) with the desired specificity, affinity, and capacity, while the constant regions correspond to sequences in an antibody derived from another mammalian species (e.g., human) in order to avoid eliciting an immune response in that species.
As used herein, the term "multispecific antibody" refers to an antibody comprising a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality of immunoglobulin variable domain sequences has a binding specificity for a first epitope or comprises a germline sequence lacking any known binding specificity, and a second immunoglobulin variable domain sequence of the plurality of immunoglobulin variable domain sequences has a binding specificity for a second epitope or comprises a germline sequence lacking any known binding specificity, and wherein the first immunoglobulin variable domain and/or the second immunoglobulin variable domain optionally comprise a conjugated pharmaceutically active moiety (e.g., a therapeutic peptide). In one embodiment, the first epitope and the second epitope are on the same antigen, e.g., the same protein (or subunit of a multimeric protein). In one embodiment, the first epitope and the second epitope overlap or substantially overlap. In one embodiment, the first epitope and the second epitope do not overlap or do not substantially overlap. In one embodiment, the first epitope and the second epitope are on different antigens, such as different proteins (or different subunits of a multimeric protein). In one embodiment, the first immunoglobulin variable domain and the second immunoglobulin variable domain comprise the same conjugated pharmaceutically active moiety. In one embodiment, the first immunoglobulin variable domain and the second immunoglobulin variable domain comprise different pharmaceutically active portions. In one embodiment, only the first immunoglobulin variable domain comprises a conjugated pharmaceutically active moiety. In one embodiment, only the second immunoglobulin variable domain comprises a conjugated pharmaceutically active moiety. In one embodiment, the multispecific antibody comprises a third, fourth or fifth immunoglobulin variable domain. In one embodiment, the multispecific antibody is a bispecific antibody molecule, a trispecific antibody or a tetraspecific antibody molecule.
As used herein, the term "bispecific antibody" refers to a multispecific antibody that binds no more than two epitopes or two antigens and/or comprises two conjugated pharmaceutically active moieties (e.g., the same or different pharmaceutically active moieties). The bispecific antibody is characterized in that the first immunoglobulin variable domain sequence has a binding specificity for the first epitope or comprises a germline sequence lacking any known binding specificity and the second immunoglobulin variable domain sequence has a binding specificity for the second epitope or comprises a germline sequence lacking any known binding specificity and wherein the first immunoglobulin variable domain and/or the second immunoglobulin variable domain optionally comprises a conjugated pharmaceutically active moiety. In one embodiment, the first epitope and the second epitope are on the same antigen, e.g., the same protein (or subunit of a multimeric protein). In one embodiment, the first epitope and the second epitope overlap or substantially overlap. In one embodiment, the first epitope and the second epitope are on different antigens, such as different proteins (or different subunits of a multimeric protein). In one embodiment, the first immunoglobulin variable domain and the second immunoglobulin variable domain comprise the same conjugated pharmaceutically active moiety. In one embodiment, the first immunoglobulin variable domain and the second immunoglobulin variable domain comprise different pharmaceutically active portions. In one embodiment, only the first immunoglobulin variable domain comprises a conjugated pharmaceutically active moiety. In one embodiment, only the second immunoglobulin variable domain comprises a conjugated pharmaceutically active moiety. In one embodiment, the bispecific antibody comprises a first heavy chain variable domain sequence and a light chain variable domain sequence having binding specificity for a first epitope or comprising a germline sequence lacking any known binding specificity, and a second heavy chain variable domain sequence and a light chain variable domain sequence having binding specificity for a second epitope or comprising a germline sequence lacking any known binding specificity, and wherein the first heavy chain variable domain and/or the second heavy chain variable domain optionally comprises a conjugated pharmaceutically active moiety. In one embodiment, the first heavy chain variable domain and the second heavy chain variable domain comprise the same conjugated pharmaceutically active moiety. In one embodiment, the first heavy chain variable domain and the second heavy chain variable domain comprise different conjugated pharmaceutically active moieties. In one embodiment, only the first heavy chain variable domain comprises a conjugated pharmaceutically active moiety. In one embodiment, only the second heavy chain variable domain comprises a conjugated pharmaceutically active moiety.
As used herein, "full-length antibody" refers to an antibody having two full-length antibody heavy chains and two full-length antibody light chains. The full length antibody Heavy Chain (HC) consists of the well known variable and constant regions of the heavy chain VH, CH1, CH2 and CH 3. Full-length antibody Light Chains (LCs) consist of the well-known variable and constant regions of the light chain, VL and CL. Full-length antibodies may lack a C-terminal lysine (K) in one or both heavy chains.
The term "Fab arm" or "half molecule" refers to a heavy chain-light chain pair that specifically binds to an antigen.
A full-length bispecific antibody can be generated, for example, using Fab arm exchange (or half-molecule exchange) between two monospecific bivalent antibodies by: substitutions are introduced at the heavy chain CH3 interface in each half molecule to facilitate heterodimer formation of two antibody halves with different specificities in an in vitro cell-free environment or using co-expression. The Fab arm exchange reaction is the result of disulfide bond isomerization and dissociation-association of the CH3 domain. The heavy chain disulfide bonds in the hinge region of the parent monospecific antibody are reduced. The resulting free cysteine of one of the parent monospecific antibodies forms an inter-heavy chain disulfide bond with the cysteine residue of a second parent monospecific antibody molecule, while the CH3 domain of the parent antibody is released and reformed by dissociation-association. The CH3 domain of the Fab arm can be engineered to favor heterodimerization rather than homodimerization. The resulting product is a bispecific antibody with two Fab arms or half-molecules, each binding a different epitope.
As used herein, with respect to antibodies, "homodimerization" refers to the interaction of two heavy chains having the same CH3 amino acid sequence. As used herein, with respect to antibodies, "homodimers" refers to antibodies having two heavy chains with the same CH3 amino acid sequence.
As used herein, with respect to antibodies, "heterodimerization" refers to the interaction of two heavy chains having different CH3 amino acid sequences. As used herein, with respect to antibodies, "heterodimer" refers to an antibody having two heavy chains with different CH3 amino acid sequences.
The "knob-in-hole" strategy (see, e.g., PCT international publication WO 2006/028936) can be used to generate full-length bispecific antibodies. Briefly, selected amino acids that form the boundary of the CH3 domain in human IgG may be mutated at positions that affect the CH3 domain interaction, thereby promoting heterodimer formation. Amino acids with small side chains (knobs) are introduced into the heavy chain of an antibody that specifically binds a first antigen, and amino acids with large side chains (knobs) are introduced into the heavy chain of an antibody that specifically binds a second antigen. Upon co-expression of both antibodies, heterodimers are formed due to the preferential interaction of the heavy chain with the "button" with the heavy chain with the "button". An exemplary CH3 substitution pair (denoted as modification position in the first CH3 domain of the first heavy chain/modification position in the second CH3 domain of the second heavy chain) that forms a button and clasp is: T366Y/F405A, T366W/F405W, F405W/Y407A, T394W/Y407T, T394S/Y407A, T366W/T394S, F405W/T394S and T366W/T366S _ L368A _ Y407V.
Other strategies may also be used, such as promoting heavy chain heterodimerization using electrostatic interactions by replacing positively charged residues on one CH3 surface and negatively charged residues on the second CH3 surface, as described in U.S. patent publication US 2010/0015133; U.S. patent publication US 2009/0182127; U.S. patent publication US2010/028637 or U.S. patent publication US 2011/0123532. In other strategies, heterodimerization may be promoted by the following substitutions (expressed as modified position in the first CH3 domain of the first heavy chain/modified position in the second CH3 domain of the second heavy chain): L351Y _ F405A _ Y407V/T394W, T366I _ K392M _ T394W/F405A _ Y407V, T366L _ K392M _ T394W/F405A _ Y407V, L351Y _ Y407A/T366A _ K409F, L351Y _ Y407A/T366V _ K409F, Y407A/T366A _ K409F, or T350V _ L351Y _ F405A _ Y407V/T350V _ T366 _ V _ K V _ T394 363672 as described in US patent publication US 2012/V or US patent publication US 2013/V.
In addition to the above methods, bispecific antibodies can be generated in vitro in a cell-free environment by introducing asymmetric mutations in the CH3 regions of two monospecific homodimeric antibodies and forming bispecific heterodimeric antibodies from the two parent monospecific homodimeric antibodies under reducing conditions that allow disulfide bond isomerization as described in international patent publication WO 2011/131746. In the method, the first monospecific bivalent antibody and the second monospecific bivalent antibody are engineered to have certain substitutions at the CH3 domain that promote heterodimer stability; incubating the antibodies together under reducing conditions sufficient to disulfide isomerization of cysteines in the hinge region; thereby generating bispecific antibodies by Fab arm exchange. The incubation conditions are optimally restored to non-reducing conditions. Exemplary reducing agents that can be used are 2-mercaptoethylamine (2-MEA), Dithiothreitol (DTT), Dithioerythritol (DTE), glutathione, tris (2-carboxyethyl) phosphine (TCEP), L-cysteine and β -mercaptoethanol, preferably a reducing agent selected from 2-mercaptoethylamine, dithiothreitol and tris (2-carboxyethyl) phosphine. For example, the following conditions may be used: incubating at a pH of 5-8, e.g., pH7.0 or pH7.4, in the presence of at least 25mM 2-MEA or in the presence of at least 0.5mM dithiothreitol at a temperature of at least 20 ℃ for at least 90 minutes.
Unless otherwise specifically indicated, the numbering of amino acid residues in the constant region of an antibody is performed according to the EU index as described in Kabat et al, Sequences of Proteins of Immunological Interest, published Health Service 5 th edition, National Institutes of Health, Bethesda, Md. (1991).
Conjugates
In another general aspect, the invention relates to conjugates comprising an antibody of the invention covalently conjugated to a pharmaceutically active moiety, such as a synthetic therapeutic peptide (e.g., an amylin mimetic peptide), in a site-specific manner such that the antibody-coupled peptide has an extended/increased half-life compared to the peptide alone. The invention also relates to pharmaceutical compositions and methods of use thereof. The conjugates are useful for preventing, treating or ameliorating diseases or disorders such as obesity, type 2 diabetes, metabolic syndrome (i.e., syndrome X), insulin resistance, impaired glucose tolerance (e.g., glucose intolerance), hyperglycemia, hyperinsulinemia, hypertriglyceridemia, hypoglycemia due to Congenital Hyperinsulinemia (CHI), dyslipidemia, atherosclerosis, diabetic nephropathy, and other cardiovascular risk factors such as hypertension and cardiovascular risk factors associated with unmanaged cholesterol and/or lipid levels, osteoporosis, inflammation, non-alcoholic fatty liver disease (NAFLD), non-alcoholic steatohepatitis (NASH), kidney disease, eczema, and the like.
In certain embodiments, the antibodies of the invention are modified to include at least one cysteine residue substitution, thereby enabling conjugation to a pharmaceutically active moiety to extend/increase the half-life of the pharmaceutically active moiety. In certain embodiments, at least one cysteine residue substitution is comprised in a complementarity determining region of an antibody. In certain embodiments, at least one cysteine residue is substituted in the heavy chain complementarity determining region (HCDR). In certain embodiments, at least one cysteine residue is substituted in HCDR3, wherein HCDR3 comprises the amino acid sequence of SEQ ID No. 49. In certain embodiments, an antibody comprising HCDR3 having the amino acid sequence of SEQ ID No. 49 has at least one additional cysteine substitution capable of being conjugated to a pharmaceutically active moiety.
In certain embodiments, the pharmaceutically active moiety may comprise a linker. The linker may be chemically modified to allow conjugation of the antibody to a pharmaceutically active moiety. The linker may, for example, include, but is not limited to, a peptide linker, a hydrocarbon linker, a polyethylene glycol (PEG) linker, a polypropylene glycol (PPG) linker, a polysaccharide linker, a polyester linker, a mixed linker composed of PEG and embedded heterocycles, or a hydrocarbon chain. The PEG linker may, for example, comprise 2-24 PEG units.
In certain embodiments, a monoclonal antibody of the invention is conjugated to one, two, three, four, five, or six pharmaceutically active moieties of interest (e.g., therapeutic peptides). In a preferred embodiment, the non-targeted monoclonal antibody is conjugated to two pharmaceutically active moieties of interest. In certain embodiments where a monoclonal antibody is conjugated to at least two pharmaceutically active moieties of interest, the pharmaceutically active moieties of interest may be the same pharmaceutically active moiety or may be different pharmaceutically active moieties.
Methods of conjugating an antibody of the invention to a pharmaceutically active moiety of the invention are known in the art. Briefly, an antibody of the invention can be reduced with a reducing agent (e.g., TCEP tris (2-carboxyethyl) phosphine), purified (e.g., by protein a adsorption or gel filtration), and conjugated to a pharmaceutically active moiety (e.g., by providing the reduced antibody with a lyophilized peptide under conditions that allow conjugation). Following the conjugation reaction, the conjugate can be purified by ion exchange chromatography or Hydrophobic Interaction Chromatography (HIC), with the final purification step being protein a adsorption. In certain embodiments, the antibodies of the invention may be purified prior to reduction using the HIC method. For a more detailed description of the conjugation procedure see, e.g., example 103 and Dennler et al, Antibodies 4:197-224 (2015).
In certain embodiments, the amylin mimetic peptide is a derivative of the amylin mimetic peptide of formula I, or a pharmaceutically acceptable salt thereof, that is modified by one or more methods selected from the group consisting of: amidation, lipidation and pegylation.
In certain embodiments, the conjugates comprise a monoclonal antibody or fragment thereof conjugated to an amylin mimetic peptide, wherein the amylin mimetic peptide is selected from SEQ ID NOs 4-28.
In certain embodiments, the monoclonal antibody or antigen-binding fragment thereof is covalently attached to the amylin mimetic peptide at a lysine residue of the amylin mimetic peptide via a linker. The linker may for example comprise a linker selected from the group consisting of: a PEG chain of 2 to 24 PEG units, an alkyl chain containing 2-10 carbon atoms, or a bond.
In certain embodiments, Z in formula I25、Z26、Z29And Z34Is a lysine, and the lysine is covalently linked via a linker to an engineered cysteine residue of the monoclonal antibody or antigen binding fragment thereof. In a preferred embodiment, a monoclonal antibody or antigen-binding fragment thereof according to an embodiment of the invention is conjugated to an amylin mimetic peptide at residue 25 or 26 of the amylin mimetic. In another preferred embodiment, an electrophile, such as bromoacetamide, is introduced into the amylin mimetic at residue 25 or 26 of the amylin mimeticAnd site-specifically reacting the electrophile with a thiol group of a Cys residue engineered into a CDR of the monoclonal antibody or fragment thereof (preferably HCDR3), thereby forming a covalent bond between the amylin mimetic peptide and the monoclonal antibody or fragment thereof. More preferably, the amylin mimetic peptide is selected from the group consisting of SEQ ID NO6, SEQ ID NO 7, SEQ ID NO 8, SEQ ID NO 13, SEQ ID NO 14, SEQ ID NO 19, SEQ ID NO 25, SEQ ID NO 26, SEQ ID NO 27 and SEQ ID NO 28. In one embodiment, the electrophile is introduced directly onto the side chain of the amylin mimetic. In another embodiment, the electrophile is introduced indirectly via a linker to the side chain of the amylin mimetic.
The invention also provides pharmaceutical compositions comprising the conjugates of the invention and further comprising a pharmaceutically acceptable carrier.
Also provided herein are amylin mimetic peptides that exhibit at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% sequence identity to pramlintide or davalintide. As an example of a method for determining sequence identity between two analogues, two peptides (pramlintide (SEQ ID NO:2) and (SEQ ID NO:4)) were aligned.
The sequence identity of an analog relative to pramlintide is given by the total number of aligned residues minus the number of different residues (i.e., the number of aligned identical residues) divided by the total number of residues in pramlintide. In this example, the different residues are K1 and C2, which are not present. N3 is now replaced, but remains in its original position. Thus, in this example, the sequence identity is (37-2)/37X 100.
In the case where the compound according to the invention is an amylin mimetic peptide coupled to a mAb, it is expected that the mAb will have two copies of the peptide coupled thereto. It will be appreciated by those skilled in the art that the reaction product may comprise a partial conjugation product, thereby producing an amylin mimetic peptide coupled to the mAb. It is to be understood that all such mono-coupling compounds, di-coupling compounds and mixtures thereof are encompassed within the scope of the present invention.
Amylin mimetic peptides
In view of their role in controlling appetite and food intake, pramlintide and/or davalintide may be effective in the treatment of obesity. However, the therapeutic utility of pramlintide and/or davalintide as a treatment agent is limited by its rapid metabolism and short circulatory half-life. Thus, the present invention relates generally to modified pramlintide and/or davalintide conjugates that extend the half-life of amylin mimetic peptides and reduce the metabolism of the peptides in vivo.
In certain embodiments of the invention, the modified pramlintide and/or davalin peptide is an amylin mimetic peptide. The terms "amylin mimetic peptide," "amylin mimetic analog," and "amylin mimetic peptide analog" are used interchangeably.
The peptide sequences described herein are written according to common practice with the N-terminal region of the peptide on the left and the C-terminal region on the right. Although the isomeric form of an amino acid is known, it is the L form of the amino acid represented, unless specifically indicated otherwise. For convenience in describing the molecules of the invention, conventional and non-conventional abbreviations for the various amino acids (both single and three letter codes) and functional moieties are used. These abbreviations are familiar to those skilled in the art, but for clarity are listed below: a ═ Ala ═ alanine; r ═ Arg ═ arginine; n ═ Asn ═ asparagine; d ═ Asp ═ aspartic acid; β a ═ β Ala ═ β -alanine; C-Cys-cysteine; hC ═ hCys ═ homocysteine; e ═ Glu ═ glutamic acid; q ═ Gln ═ glutamic acid; g ═ Gly ═ glycine; H-His-histidine; i ═ Ile ═ isoleucine; l ═ Leu ═ leucine; k ═ Lys ═ lysine; nle ═ norleucine; phe ═ phenylalanine; p ═ Pro ═ proline; s ═ Ser ═ serine; t ═ Thr ═ threonine; w ═ Trp ═ tryptophan; y ═ Tyr ═ tyrosine and V ═ Val ═ valine.
Additional amino acid abbreviations used herein are listed below: ACPC ═ 2-aminocyclopentanecarboxylic acid; β -Aib ═ β aminoisobutyric acid ═ 3-amino-2-methylpropionic acid; β -hA ═ β -ala ═ β -homoalanine ═ 3-aminobutyric acid; α -MeL ═ α -MeLeu ═ α -methylleucine; β -hpo ═ β -homoproline; β -hT ═ β -hThr ═ β -homothreonine;
for convenience, the numbering convention used to designate amino acid residues of the amylin mimetic peptides of the present invention follows that of pramlintide and/or davalinin. Specific amino acid substitutions that have been introduced into these peptides are indicated by appropriate amino acid codes relative to the natural residue at the corresponding position in pramlintide and/or davalintide, followed by the position of the substitution. Thus, "hC 7" in the amylin mimetic peptide refers to a peptide in which the homocysteine has replaced the corresponding native Cys7 residue of pramlintide. Similarly, "K (Ac) 26" in amylin mimetics refers to those in which the-amine is CH-substituted3C (O) -substituted lysine has replaced the peptide of the corresponding native Ile26 residue of pramlintide. According to this convention, additional amino acid substitutions that occur within the amylin mimetic peptide are described and will likewise be recognized by those skilled in the art.
For convenience, the naming convention for amylin mimetic peptides used in the present invention binds the amino acid residues involved in the loop, along with the linking group between them, in a left to right direction, starting from the N-terminal residue involved in the loop. In all cases, the N-terminal amino acid residue of the loop is attached with its alpha-amino function to an acetyl linker which in turn is attached to the thiol side chain residue of the amino acid at position 7 of the amylin mimetic peptide. Thus, "Ring- (N3-COCH)2-hC7) "is used to describe the loop of amylin mimetics in which the native Lys1 and Cys2 residues have been deleted from the sequence and the a-amino function of Asn3 has been acylated with an acetyl residue whose methyl group is further linked to the side chain of the hCys7 residue by a thioether bond. Similarly, "Ring- (S2-COCH)2-hC7) "is used to describe the loop of amylin mimetics in which the native Lys1 residue has been deleted, the native Cys2 residue has been replaced by Ser2, the a-amino function of said Ser2 has been acylated with an acetyl group which is in turn linked to the hCys7 residue by a thioether bondSide chains.
Lysine residues can be incorporated at various positions in the sequence of the amylin mimetic to provide a convenient functional handle for further derivatization. Lysine residues may be modified to couple directly or indirectly to monoclonal antibodies. In indirect coupling to a monoclonal antibody, the lysine residues may be modified to include a linker that will allow the amylin mimetic peptide to be coupled to the monoclonal antibody. Those skilled in the art will recognize that related orthologs may also be used so effectively and are contemplated herein.
The term "K (γ -Glu)" appearing in the peptide sequence denotes a lysyl residue whose side chain-amino group has been acylated by the γ -carboxyl group of glutamic acid.
The term "k (ac)" denotes a lysyl residue whose side chain-amino group has been replaced by an acetyl group.
The term "k (alloc)" denotes a lysyl residue whose side chain-amino group has been replaced by an allyloxycarbonyl group.
The term "K (OEG)2-Pal) "denotes a lysyl residue whose side chain-amino group has been replaced by 17-amino-10-oxo-3, 6,12, 15-tetraoxa-9-azaheptadecanoic acid through an amide bond between the 17-amino group and palmitic acid, wherein the 17-amino group has also been replaced by palmitic acid.
Term "(OEG)2"denotes two OEG units linked together in series by an amide bond (i.e., 17-amino-10-oxo-3, 6,12, 15-tetraoxa-9-azaheptadecanoic acid).
The term "K (OEG)2"denotes a lysyl residue whose side chain-amino group has been acylated with 17-amino-10-oxo-3, 6,12, 15-tetraoxa-9-azaheptadecanoic acid.
The term "K (OEG)2- γ -Glu-Pal) "denotes a lysyl residue whose side chain-amino group has been acylated with (22S) -22-amino-10, 19-dioxo-3, 6,12, 15-tetraoxa-9, 18-diazicosyldiacid via its 1-carboxylic acid function, and wherein said 22-amino group is amidated with palmitic acid.
The term "dPEGx" refers to a discrete oligomer comprising x ethylene glycol units attached to propionic acid at one end and comprising a terminal amino functional group at the distal end, which may be further functionalized.
The term "K (dPEG 12)" denotes a lysyl residue whose side chain-amino group has been acylated with 1-amino-3, 6,9,12,15,18,21,24,27,30,33, 36-dodecaoxatriacontane-39-acid via its 39-carboxylic acid function.
The term "K (dPEG 12-AcBr)" denotes a lysyl residue whose side chain-amino group has been acylated with 1-amino-3, 6,9,12,15,18,21,24,27,30,33, 36-dodecaoxatriacontan-39-acid via its 39-carboxylic acid function, and wherein the acid is substituted on its 1-amine group with-C (O) CH2Amidating the Br group.
Half-life extending moieties
In addition to the antibodies or antigen-binding fragments thereof of the invention, the conjugates of the invention can bind one or more other moieties for the purpose of extending the half-life of a pharmaceutically active moiety (e.g., amylin mimetic peptide), e.g., via covalent interactions. Exemplary other half-life extending moieties include, but are not limited to, albumin variants, albumin-binding proteins and/or domains, transferrin, fragments thereof, and analogs thereof. Additional half-life extending moieties that can be incorporated into the conjugates of the invention include, for example, polyethylene glycol (PEG) molecules, such as PEG5000 or PEG20,000; fatty acids and fatty acid esters of different chain lengths, such as laurate, myristate, stearate, arachinate, behenate, oleate, arachidonic acid, suberic acid, tetradecanedioic acid, octadecanedioic acid, behenic acid, etc., polylysine, octane, carbohydrates (dextran, cellulose, oligosaccharides or polysaccharides) in order to obtain the desired properties. These portions can be fused directly to the protein scaffold coding sequence and can be produced by standard cloning and expression techniques. Alternatively, well-known chemical coupling methods can be used to attach these moieties to the recombinantly and chemically prepared conjugates of the invention.
The pegyl moiety may for example be added to the peptide molecule of the invention by binding a cysteine residue to the C-terminus of the molecule and linking the pegyl group to the cysteine using well known methods.
The functionality of the peptide molecules of the invention incorporating additional moieties can be compared by a variety of well-known assays. For example, the biological or pharmacokinetic activity of a therapeutic peptide of interest, alone or in the form of a conjugate according to the invention, can be determined and compared using known in vitro or in vivo assays.
Pharmaceutical composition
In another general aspect, the invention relates to pharmaceutical compositions comprising the conjugates and compounds of the invention and a pharmaceutically acceptable carrier. The term "pharmaceutical composition" as used herein means a product comprising a conjugate of the invention and a pharmaceutically acceptable carrier. The conjugates and compounds of the invention, and compositions comprising them, are also useful in the manufacture of medicaments for the therapeutic applications described herein.
As used herein, the term "carrier" refers to any excipient, diluent, filler, salt, buffer, stabilizer, solubilizer, oil, lipid-containing vesicle, microsphere, liposome encapsulation, or other material known in the art for use in pharmaceutical formulations. It will be appreciated that the characteristics of the carrier, excipient or diluent will depend on the route of administration for a particular application. As used herein, the term "pharmaceutically acceptable carrier" refers to a non-toxic material that does not interfere with the effect of, or the biological activity of, the composition according to the present invention. According to the present disclosure, any pharmaceutically acceptable carrier suitable for use in antibody pharmaceutical compositions may be used in the present invention, according to a specific embodiment.
Pharmaceutically acceptable acid/anion salts for use in the present invention include, but are not limited to, acetate, benzenesulfonate, benzoate, bicarbonate, bitartrate, bromide, calcium edetate, camphorsulfonate, carbonate, chloride, citrate, dihydrochloride, edetate, edisylate, etonate, ethanesulfonate, fumarate, glucoheptonate, gluconate, glutamate, p-hydroxyacetaminophenylarsonate, hexylresorcinate, hydrabamine, hydrobromide, hydrochloride, hydroxynaphthoate, iodide, isethionate, lactate, lactobionate, malate, maleate, mandelate, methanesulfonate, methylbromide, methylnitrate, methylsulfate, mucate, naphthalenesulfonate, nitrate, pamoate, pantothenate, phosphate/diphosphate, salts of sodium, Polygalacturonate, salicylate, stearate, subacetate, succinate, sulfate, tannate, tartrate, theachlorate, tosylate, and triethyliodide. Organic or inorganic acids also include, without limitation, hydroiodic acid, perchloric acid, sulfuric acid, phosphoric acid, propionic acid, glycolic acid, methanesulfonic acid, hydroxyethanesulfonic acid, oxalic acid, 2-naphthalenesulfonic acid, p-toluenesulfonic acid, cyclamic acid, saccharinic acid, or trifluoroacetic acid.
Pharmaceutically acceptable base/cationic salts include, without limitation, aluminum, 2-amino-2-hydroxymethyl-propane-1, 3-diol (also known as TRIS (hydroxymethyl) aminomethane, trometamol or "TRIS"), ammonia, benzathine, tert-butylamine, chloroprocaine, choline, cyclohexylamine, diethanolamine, ethylenediamine, lithium, L-lysine, magnesium, meglumine, N-methyl-D-glucamine, piperidine, potassium, procaine, quinine, sodium, triethanolamine or zinc.
In some embodiments of the invention, pharmaceutical formulations are provided comprising a conjugate of the invention in an amount from about 0.001mg/ml to about 100mg/ml, from about 0.01mg/ml to about 50mg/ml, or from about 0.1mg/ml to about 25 mg/ml. The pharmaceutical formulation has a pH of about 3.0 to about 10, for example about 3 to about 7, or about 5 to about 9. The formulation may further comprise at least one ingredient selected from the group consisting of: a buffer system, a preservative, a tonicity agent, a chelating agent, a stabilizer, and a surfactant.
The formulation of pharmaceutically active ingredients with pharmaceutically acceptable carriers is known in The art, e.g., Remington: The Science and Practice of Pharmacy (e.g., 21 st edition (2005) and any subsequent editions). Non-limiting examples of additional ingredients include: buffers, diluents, solvents, tonicity adjusting agents, preservatives, stabilizers and chelating agents. One or more pharmaceutically acceptable carriers may be used to formulate the pharmaceutical compositions of the present invention.
In one embodiment of the invention, the pharmaceutical composition is a liquid formulation. One preferred example of a liquid formulation is an aqueous formulation, i.e. a formulation comprising water. Liquid formulations may comprise solutions, suspensions, emulsions, microemulsions, gels, and the like. The aqueous formulation typically comprises at least 50% w/w water, or at least 60%, 70%, 75%, 80%, 85%, 90% or at least 95% w/w water.
In one embodiment, the pharmaceutical composition may be formulated as an injectable, which may be injected, for example, via an injection device (e.g., a syringe or infusion pump). Injection may be delivered, for example, subcutaneously, intramuscularly, intraperitoneally, or intravenously.
In another embodiment, the pharmaceutical composition is a solid formulation, e.g., a freeze-dried or spray-dried composition, which may be used as such, or with the addition of solvents and/or diluents by a physician or patient prior to use. Solid dosage forms may include tablets, such as compressed tablets and/or coated tablets, and capsules (e.g., hard gelatin capsules or soft gelatin capsules). The pharmaceutical compositions may also be in the form of sachets, dragees, powders, granules, lozenges or powders, for example for reconstitution.
The dosage forms may be immediate release, in which case they may comprise a water-soluble or water-dispersible carrier, or they may be delayed, sustained or modified release, in which case they may comprise a water-insoluble polymer which modulates the dissolution rate of the dosage form in the gastrointestinal tract.
In other embodiments, the pharmaceutical composition may be delivered intranasally, buccally or sublingually.
The pH in the aqueous formulation may be between pH3 and pH 10. In one embodiment of the invention, the pH of the formulation is from about 7.0 to about 9.5. In another embodiment of the invention, the pH of the formulation is from about 3.0 to about 7.0.
In another embodiment of the present invention, the pharmaceutical composition comprises a buffering agent. Non-limiting examples of buffers include: arginine, aspartic acid, dihydroxyethylglycine, citrate, disodium hydrogen phosphate, fumaric acid, glycine, glycylglycine, histidine, lysine, maleic acid, malic acid, sodium acetate, sodium carbonate, sodium dihydrogen phosphate, sodium phosphate, succinate, tartaric acid, triazine, and tris (hydroxymethyl) aminomethane, and mixtures thereof. The buffer may be present alone or in the aggregate at a concentration of about 0.01mg/ml to about 50mg/ml, for example about 0.1mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each of these specific buffers constitute an alternative embodiment of the present invention.
In another embodiment of the invention, the pharmaceutical composition comprises a preservative. Non-limiting examples of buffers include: benzethonium chloride, benzoic acid, benzyl alcohol, bromonitropropanediol, butyl 4-hydroxybenzoate, chlorobutanol, chlorocresol, chlorohexidine, chlorphenesin, o-cresol, m-cresol, p-cresol, ethyl 4-hydroxybenzoate, imidurea, methyl 4-hydroxybenzoate, phenol, 2-phenoxyethanol, 2-phenylethanol, propyl 4-hydroxybenzoate, sodium dehydroacetate, thimerosal, and mixtures thereof. Preservatives may be present alone or in the aggregate at a concentration of from about 0.01mg/ml to about 50mg/ml, for example from about 0.1mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each of these particular preservatives constitute alternative embodiments of the present invention.
In another embodiment of the invention, the pharmaceutical composition comprises an isotonic agent. Non-limiting examples of this embodiment include salts (such as sodium chloride), amino acids (such as glycine, histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, and threonine), sugar alcohols (such as glycerol, 1, 2-propanediol, propylene glycol), 1, 3-propanediol, and 1, 3-butanediol), polyethylene glycols (e.g., PEG400), and mixtures thereof. Another example of an isotonic agent includes sugars. Non-limiting examples of sugars can be mono-, di-, or polysaccharides, or water-soluble glucans, including, for example, fructose, glucose, mannose, sorbose, xylose, maltose, lactose, sucrose, trehalose, dextran, pullulan, dextrin, cyclodextrin, alpha and beta-HPCD, soluble starch, hydroxyethyl starch, and sodium carboxymethyl cellulose. Another example of an isotonicity agent is a sugar alcohol, where the term "sugar alcohol" is defined as a C (4-8) hydrocarbon having at least one-OH group. Non-limiting examples of sugar alcohols include mannitol, sorbitol, inositol, galactitol, hexitol, xylitol, and arabitol. Pharmaceutical compositions comprising each of the isotonic agents listed in this paragraph constitute alternative embodiments of the present invention. The isotonic agent may be present alone or in the aggregate at a concentration of about 0.01mg/ml to about 50mg/ml, for example about 0.1mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each of these specific isotonic agents constitute alternative embodiments of the present invention.
In another embodiment of the present invention, the pharmaceutical composition comprises a chelating agent. Non-limiting examples of chelating agents include salts of citric acid, aspartic acid, ethylenediaminetetraacetic acid (EDTA), and mixtures thereof. The chelating agent may be present alone or in the aggregate at a concentration of about 0.01mg/ml to about 50mg/ml, for example about 0.1mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each of these specific chelating agents constitute an alternative embodiment of the present invention.
In another embodiment of the present invention, the pharmaceutical composition comprises a stabilizer. Non-limiting examples of stabilizers include one or more aggregation inhibitors, one or more oxidation inhibitors, one or more surfactants, and/or one or more protease inhibitors.
In another embodiment of the invention, the pharmaceutical composition comprises a stabilizer, wherein said stabilizer is carboxy-/hydroxycellulose and derivatives thereof (such as HPC, HPC-SL, HPC-L and HPMC), cyclodextrin, 2-methylthioethanol, polyethylene glycol (such as PEG 3350), polyvinyl alcohol (PVA), polyvinylpyrrolidone, salts (such as sodium chloride), sulfur-containing substances such as thioglycerol or thioglycolic acid. The stabilizer may be present alone or in the aggregate at a concentration of about 0.01mg/ml to about 50mg/ml, for example about 0.1mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each of these particular stabilizers constitute an alternative embodiment of the present invention.
In another embodiment of the invention, the pharmaceutical composition comprises one or more surfactants, preferably one surfactant, at least one surfactant or two different surfactants. The term "surfactant" refers to any molecule or ion that consists of a water-soluble part (hydrophilic) and a fat-soluble and partly (lipophilic). For example, the surfactant is selected from: anionic surfactants, cationic surfactants, nonionic surfactants, and/or zwitterionic surfactants. The surfactant may be present alone or in the aggregate at a concentration of about 0.1mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each of these specific surfactants constitute an alternative embodiment of the present invention.
In another embodiment of the invention, the pharmaceutical composition comprises one or more protease inhibitors, such as, for example, EDTA and/or benzamidine hydrochloride (HCl). The protease inhibitor may be present alone or in the aggregate at a concentration of about 0.1mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each of these specific protease inhibitors constitute alternative embodiments of the present invention.
The pharmaceutical compositions of the invention may comprise an amount of amino acid bases sufficient to reduce aggregation of the polypeptide during storage of the composition. The term "amino acid base" refers to one or more amino acids (such as methionine, histidine, imidazole, arginine, lysine, isoleucine, aspartic acid, tryptophan, threonine) or analogs thereof. Any amino acid may be present in its free base form or its salt form. Any stereoisomer of the amino acid base (i.e., L, D or mixtures thereof) may be present. The amino acid bases may be present alone or in combination with other amino acid bases, at a concentration of about 0.01mg/ml to about 50mg/ml, for example about 0.1mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each of these specific amino acid bases constitute alternative embodiments of the invention.
It will also be apparent to those skilled in the art that the therapeutically effective dose of the conjugates of the invention or pharmaceutical compositions thereof will vary depending on the desired effect. Thus, the optimal dosage to be administered can be readily determined by one skilled in the art, and will vary with the particular conjugate used, the mode of administration, the strength of the formulation, and the advancement of the disease condition. In addition, factors associated with the particular subject being treated, including subject age, weight, diet and time of administration, will result in the need to adjust the dosage to the appropriate therapeutic level.
For all indications, the conjugates of the invention are preferably peripherally administered in a dose of about 1 μ g to about 50mg per day in single or divided doses (e.g., a single dose can be divided into 2, 3, 4, 5, 6,7, 8, 9, or 10 sub-doses), or in a dose of about 0.01 μ g/kg to about 500 μ g/kg, more preferably about 0.05 μ g/kg to about 250 μ g/kg, most preferably less than about 50 μ g/kg. Dosages within these ranges will, of course, vary with the potency of each agonist and are readily determined by those skilled in the art. Thus, the above dosages are exemplary of the general case. Of course, there may be individual instances where higher or lower dosage ranges should be used, and such are within the scope of this invention.
In certain embodiments, the conjugates of the invention are administered at a dose of about 1 μ g to about 5mg, or at a dose of about 0.01 μ g/kg to about 500 μ g/kg, more preferably at a dose of about 0.05 μ g/kg to about 250 μ g/kg, most preferably at a dose of less than about 50 μ g/kg, with a second therapeutic agent (e.g., liraglutide) at a dose of about 1 μ g/kg to about 5mg, or at a dose of about 0.01 μ g/kg to about 500 μ g/kg, more preferably at a dose of about 0.05 μ g/kg to about 250 μ g/kg, most preferably at a dose of less than about 50 μ g/kg.
Pharmaceutically acceptable salts of the conjugates of the invention include conventional non-toxic salts or quaternary ammonium salts formed from inorganic or organic acids or bases. Examples of such acid addition salts include acetate, adipate, benzoate, benzenesulfonate, citrate, camphorate, dodecylsulfate, hydrochloride, hydrobromide, lactate, maleate, methanesulfonate, nitrate, oxalate, pivalate, propionate, succinate, sulfate and tartrate. Base salts include ammonium salts, alkali metal salts such as sodium and potassium salts, alkaline earth metal salts such as calcium and magnesium salts, organic base salts such as dicyclohexylamine salts, and salts of amino acids such as arginine. In addition, the basic nitrogen-containing groups can be quaternized with, for example, alkyl halides.
The pharmaceutical compositions of the present invention may be administered by any means that achieves their intended purpose. Examples include administration by parenteral, subcutaneous, intravenous, intramuscular, intraperitoneal, transdermal, buccal or ocular routes. Administration may be by the oral route. Formulations suitable for parenteral administration include aqueous solutions of the active conjugate in water-soluble form (e.g., a water-soluble salt), acidic solutions, alkaline solutions, aqueous dextrose, isotonic carbohydrate solutions, and cyclodextrin inclusion complexes.
The invention also encompasses a method of making a pharmaceutical composition comprising mixing a pharmaceutically acceptable carrier with any one of the conjugates of the invention. In addition, the invention includes pharmaceutical compositions prepared by mixing one or more pharmaceutically acceptable carriers with any of the conjugates of the invention.
Furthermore, the conjugates of the invention may have one or more polymorphs or amorphous crystalline forms and are therefore intended to be included within the scope of the present invention. Furthermore, these conjugates can form solvates with, for example, water (i.e., hydrates) or common organic solvents. The term "solvate" as used herein means a physical association of a conjugate of the invention with one or more solvent molecules. The physical association involves varying degrees of ionic bonding and covalent bonding, including hydrogen bonding. In some cases, the solvate will be able to separate out when, for example, one or more solvent molecules are incorporated into the crystal lattice of the crystalline solid. The term "solvate" is intended to encompass both solution-phase and isolatable solvates. Non-limiting examples of suitable solvates include ethanolates, methanolates, and the like.
The present invention is intended to include within its scope polymorphs and solvates of the conjugates of the invention. Thus, in the methods of treatment of the present invention, the term "administering" shall encompass methods for treating, ameliorating or preventing the syndromes, conditions or diseases described herein using the conjugates of the present invention or polymorphs or solvates thereof, which although not specifically disclosed, are expressly included within the scope of the present invention.
In another embodiment, the invention relates to a conjugate according to the invention for use as a medicament.
The present invention includes within its scope prodrugs of the conjugates of the invention. Generally, such prodrugs will be functional derivatives of the conjugates that can be readily converted in vivo to the desired conjugates. Thus, in the methods of treatment of the present invention, the term "administering" shall encompass the use of specifically disclosed conjugates or conjugates not specifically disclosed to treat the various disorders described, and such non-specifically disclosed conjugates can be converted in vivo to the designated conjugates following administration to a patient. Conventional methods for selecting and preparing suitable prodrug derivatives are described, for example, in "Design of produgs" edited by h.
Furthermore, within the scope of the present invention, any element (especially when mentioned in relation to the conjugates of the invention) is intended to be intended to comprise all isotopes or isotopic mixtures (naturally occurring or synthetically prepared) of said element in its natural abundance or in its isotopically enriched form. For example, references to hydrogen include within their scope1H、2H, (D) and3h (T). Similarly, references to carbon and oxygen include within their scope 12C, respectively,13C and14c and16o and18and O. The isotope may be radioactive or non-radioactive. The radiolabeled conjugates of the invention may comprise a compound selected from3H、11C、18F、122I、123I、125I、131I、75Br、76Br、77Br and82a radioisotope of Br. Preferably, the radioisotope is selected from3H、11C and18F。
some conjugates of the invention may exist in the form of atropisomers. Atropisomers are stereoisomers obtained by hindered rotation about a single bond, wherein the steric strain barrier to rotation is sufficiently high to allow separation of conformers. It is to be understood that all such conformers and mixtures thereof are encompassed within the scope of the present invention.
When the conjugates according to the invention have at least one stereocenter, they may accordingly exist as enantiomers or diastereomers. It is to be understood that all such isomers and mixtures thereof are encompassed within the scope of the present invention.
If the process for preparing the conjugates according to the invention yields a mixture of stereoisomers, these isomers may be separated by conventional techniques such as preparative chromatography. The conjugates may be prepared in racemic form, or the individual enantiomers may be prepared by enantiospecific synthesis or by resolution. For example, the conjugates can be resolved into their component enantiomers by standard techniques, such as by formation of diastereomeric pairs by salt formation with an optically active acid (such as (-) -di-p-toluoyl-D-tartaric acid and/or (+) -di-p-toluoyl-L-tartaric acid), followed by fractional crystallization and regeneration of the free base. The conjugate can also be resolved by formation of diastereomeric esters or amides, followed by chromatographic separation and removal of the chiral auxiliary. Alternatively, the conjugate can be resolved by High Performance Liquid Chromatography (HPLC) or SFC using a chiral column. In some cases, rotamers of the conjugate may be present, which can be passed through1H NMR observation, thereby resulting in1Complex multiplets and peak integration in H NMR spectra.
In any of the methods for preparing the conjugates of the present invention, it may be necessary and/or desirable to protect sensitive or reactive groups in any of the molecules concerned. This can be achieved by conventional protecting groups, such as protective groups in organic synthesis, edited by j.f.w.mcomie, plenem press, 1973; (Protective Groups in Organic Chemistry, ed.J.F.W.McOmie, Plenum Press, 1973; and T.W.Greene and P.G.M.Wuts, Protective Groups in Organic Synthesis, John Wiley & Sons,1991 (Protective Groups in Organic Synthesis, John Wiley & Sons,1991), each of which is incorporated herein by reference in its entirety for all purposes.
Application method
The present invention relates to a method for preventing, treating or ameliorating an amylin receptor mediated syndrome, disorder or disease in a subject in need thereof, the method comprising administering to the subject in need thereof an effective amount of a conjugate, compound or pharmaceutical composition of the present invention.
The invention also provides a method for preventing, treating or ameliorating the onset of a disorder, disease or condition or ameliorating any one or more symptoms of said disorder, disease or condition in a subject in need thereof, said method comprising administering to the subject in need thereof an effective amount of a conjugate, compound or pharmaceutical composition of the invention.
According to a particular embodiment, the disease, disorder or condition is selected from: obesity, type I or type II diabetes, metabolic syndrome (i.e., syndrome X), insulin resistance, impaired glucose tolerance (e.g., glucose intolerance), hyperglycemia, hyperinsulinemia, hypertriglyceridemia, hypoglycemia due to Congenital Hyperinsulinemia (CHI), dyslipidemia, atherosclerosis, diabetic nephropathy, and other cardiovascular risk factors such as hypertension and cardiovascular risk factors associated with unmanaged cholesterol and/or lipid levels, osteoporosis, inflammation, nonalcoholic fatty liver disease (NAFLD), nonalcoholic steatohepatitis (NASH), kidney disease, and/or eczema.
According to particular embodiments, a therapeutically effective amount refers to a therapeutic amount sufficient to achieve one, two, three, four, or more of the following effects: (i) reducing or ameliorating the severity of or symptoms associated with a disease, disorder, or condition to be treated; (ii) reducing the duration of the disease, disorder or condition being treated or symptoms associated therewith; (iii) preventing the development of the disease, disorder or condition being treated or symptoms associated therewith; (iv) causing regression of the disease, disorder or condition being treated or symptoms associated therewith; (v) preventing the development or onset of the disease, disorder or condition being treated or symptoms associated therewith; (vi) preventing the recurrence of the disease, disorder or condition being treated or symptoms associated therewith; (vii) reducing hospitalization of the subject with the treated disease, disorder or condition or symptoms associated therewith; (viii) reducing the length of hospitalization of a subject having the treated disease, disorder or condition or symptoms associated therewith; (ix) increasing survival of a subject having the treated disease, disorder, or condition or symptoms associated therewith; (xi) Inhibiting or reducing the disease, disorder or condition being treated or symptoms associated therewith in a subject; and/or (xii) enhances or improves the prophylactic or therapeutic effect of the other therapy.
A therapeutically effective amount or dose may vary depending on various factors, such as the disease, disorder or condition to be treated, the mode of administration, the target site, the physiological state of the subject (including, for example, age, weight, health), whether the subject is human or animal, other drugs administered, and whether prophylactic or therapeutic treatment is employed. Therapeutic doses are optimally titrated to optimize safety and efficacy.
As used herein, the terms "treatment," "treating," and "therapy" are all intended to mean an improvement or reversal of at least one measurable physical parameter associated with a disease, disorder, or condition, which is not necessarily identifiable in a subject, but which is identifiable in a subject. The terms "treat" and "treating" may also refer to causing regression, preventing progression, or at least delaying progression of a disease, disorder, or condition. In a particular embodiment, "treating," "treatment," and "therapy" refer to alleviating, preventing the development or onset of, or shortening the duration of one or more symptoms associated with a disease, disorder, or condition. In particular embodiments, "treating" and "treatment" refer to preventing the recurrence of a disease, disorder, or condition. In particular embodiments, "treating" and "treatment" refer to an increase in survival of a subject having a disease, disorder, or condition. In particular embodiments, "treating" and "treatment" refer to the elimination of a disease, disorder, or condition in a subject.
In one embodiment, the present invention provides a method for preventing, treating or delaying the onset of obesity, or ameliorating obesity, or any one or more symptoms of obesity, in a subject in need thereof, comprising administering to the subject in need thereof an effective amount of a conjugate, compound or pharmaceutical composition of the present invention. In some embodiments, prior to administration of any of the conjugates, compounds, pharmaceutical compositions, forms or medicaments of the invention described herein, the amount of the conjugate, compound, pharmaceutical composition, form or medicament in the subject is, relative to the body weight of the subject, or a reduction in the body weight of the subject as compared to a control subject that does not receive any of the conjugates, compositions, forms, medicaments or combinations of the invention described herein, for example, between about 0.01% and about 0.1%, between about 0.1% and about 0.5%, between about 0.5% and about 1%, between about 1% and about 5%, between about 2% and about 3%, between about 5% and about 10%, between about 10% and about 15%, between about 15% and about 20%, between about 20% and about 25%, between about 25% and about 30%, between about 30% and about 35%, between about 35% and about 40%, between about 40% and about 45%, or between about 45% and about 50%.
In some embodiments, the reduction in body weight is sustained for, e.g., about 1 week, about 2 weeks, about 3 weeks, about 1 month, about 2 months, about 3 months, about 4 months, about 5 months, about 6 months, about 7 months, about 8 months, about 9 months, about 10 months, about 11 months, about 1 year, about 1.5 years, about 2 years, about 2.5 years, about 3 years, about 3.5 years, about 4 years, about 4.5 years, about 5 years, about 6 years, about 7 years, about 8 years, about 9 years, about 10 years, about 15 years, or about 20 years.
The present invention provides methods of preventing, treating, delaying the onset of, or ameliorating a syndrome, disorder or disease, or any one or more symptoms of said syndrome, disorder or disease, in a subject in need thereof, wherein said syndrome, disorder or disease is selected from the group consisting of: obesity, type I or type II diabetes, metabolic syndrome (i.e., syndrome X), insulin resistance, impaired glucose tolerance (e.g., glucose intolerance), hyperglycemia, hyperinsulinemia, hypertriglyceridemia, hypoglycemia due to Congenital Hyperinsulinemia (CHI), dyslipidemia, atherosclerosis, diabetic nephropathy, and other cardiovascular risk factors such as hypertension and cardiovascular risk factors associated with unmanaged cholesterol and/or lipid levels, osteoporosis, inflammation, nonalcoholic fatty liver disease (NAFLD), nonalcoholic steatohepatitis (NASH), kidney disease, and eczema, comprising administering to a subject in need thereof an effective amount of a conjugate, compound, or pharmaceutical composition of the present invention.
As used herein, metabolic syndrome refers to a subject having any one or more of the following: hyperglycemia (e.g., high fasting blood glucose), hypertension, abnormal cholesterol levels (e.g., low HDL levels), abnormal triglyceride levels (e.g., high triglycerides), large waist circumference (i.e., waist circumference), increased abdominal fat, insulin resistance, glucose intolerance, elevated levels of C-reactive protein (i.e., proinflammatory state), and increased levels of plasminogen activator inhibitor-1 and fibrinogen (i.e., prothrombotic state).
The present invention provides a method of reducing food intake in a subject in need thereof, the method comprising administering to a subject in need thereof an effective amount of a conjugate, compound or pharmaceutical composition of the invention. In some embodiments, prior to administration of any of the conjugates, compounds, compositions, forms, medicaments, or combinations of the invention described herein, the subject's food intake is reduced, e.g., between about 0.01% to about 0.1%, between about 0.1% to about 0.5%, between about 0.5% to about 1%, between about 1% to about 5%, between about 2% to about 3%, between about 5% to about 10%, between about 10% to about 15%, between about 15% to about 20%, between about 20% to about 25%, between about 25% to about 30%, between about 30% to about 35%, between about 35% to about 40% relative to the subject's food intake, or compared to a control subject that does not receive any of the conjugates, compounds, compositions, forms, medicaments, or combinations of the invention described herein, between about 40% and about 45% or between about 45% and about 50%.
In some embodiments, the decrease in food intake lasts, for example, about 1 week, about 2 weeks, about 3 weeks, about 1 month, about 2 months, about 3 months, about 4 months, about 5 months, about 6 months, about 7 months, about 8 months, about 9 months, about 10 months, about 11 months, about 1 year, about 1.5 years, about 2 years, about 2.5 years, about 3 years, about 3.5 years, about 4 years, about 4.5 years, about 5 years, about 6 years, about 7 years, about 8 years, about 9 years, about 10 years, about 15 years, or about 20 years.
The present invention provides a method of reducing glycated hemoglobin (AIC) in a subject in need thereof, the method comprising administering to the subject in need thereof an effective amount of a conjugate, compound or pharmaceutical composition of the present invention. In some embodiments, prior to administration of any of the conjugates, compounds, compositions, forms, medicaments, or combinations of the invention described herein, the subject's A1C is reduced relative to A1C of the subject, or compared to a control subject that does not receive any of the conjugates, compounds, compositions, forms, medicaments, or combinations of the invention described herein, e.g., about between about 0.001% and about 0.01%, between about 0.01% and about 0.1%, between about 0.1% and about 0.2%, between about 0.2% and about 0.3%, between about 0.3% and about 0.4%, between about 0.4% and about 0.5%, between about 0.5% and about 1%, between about 1% and about 1.5%, between about 1.5% and about 2%, between about 2% and about 2.5%, between about 2.5% and about 3%, between about 3% and about 4%, between about 4% and about 5%, between about 4% and about 4% of the subject, Between about 5% and about 6%, between about 6% and about 7%, between about 7% and about 8%, between about 8% and about 9%, or between about 9% and about 10%.
In other embodiments, there is provided a method for reducing fasting blood glucose levels in a subject in need thereof, the method comprising administering to the subject in need thereof an effective amount of a conjugate, compound, or pharmaceutical composition of the invention. Prior to administration of any of the conjugates, compounds, compositions, forms, medicaments, or combinations of the invention described herein, the fasting blood glucose level may be lowered to less than about 140 to about 150mg/dL, less than about 140 to about 130mg/dL, less than about 130 to about 120mg/dL, less than about 120 to about 110mg/dL, less than about 110 to about 100mg/dL, less than about 100 to about 90mg/dL, or less than about 90 to about 80mg/dL relative to the fasting blood glucose level of the subject, or compared to a control subject that has not received any of the conjugates, compounds, compositions, forms, medicaments, or combinations of the invention described herein.
The present invention provides a method of modulating amylin receptor activity in a subject in need thereof comprising administering to the subject in need thereof an effective amount of a conjugate, compound or pharmaceutical composition of the present invention. As used herein, "modulate" refers to increasing or decreasing receptor activity.
In some embodiments, an effective amount of a conjugate or compound of the invention, or a form, composition, or medicament thereof, is administered to a subject in need thereof once a day, twice a day, three times a day, four times a day, five times a day, six times a day, seven times a day, or eight times a day. In other embodiments, an effective amount of a conjugate or compound of the invention or a form, composition, or medicament thereof is administered once every other day, once a week, twice a week, three times a week, four times a week, five times a week, six times a week, two times a month, three times a month, or four times a month to a subject in need thereof.
Another embodiment of the invention includes a method of preventing, treating, delaying the onset of, or ameliorating a disease, disorder or syndrome, or one or more symptoms of the disease, disorder or syndrome, in a subject in need thereof, comprising administering to the subject in need thereof a conjugate, compound or pharmaceutical composition of the invention in a combination therapy. In certain embodiments, the combination therapy is a second therapeutic agent. In certain embodiments, the combination therapy is a surgical therapy.
As used herein, the term "combination" in the context of administering two or more therapies to a subject refers to the use of more than one therapy.
As used herein, combination therapy involves administering one or more additional therapeutic agents, or one or more surgical therapies to a subject in need thereof concurrently with an effective amount of a conjugate or compound of the invention, or a form, composition, or medicament thereof. In some embodiments, one or more additional therapeutic agents or surgical therapies can be administered with an effective amount of a conjugate of the invention on the same day, and in other embodiments, one or more additional therapeutic agents or surgical therapies can be administered with an effective amount of a conjugate or compound of the invention for the same week or month.
In certain embodiments, wherein the disease or disorder is selected from: obesity, type II diabetes, metabolic syndrome, insulin resistance, and dyslipidemia, and the second therapeutic agent may be an anti-diabetic agent. In certain embodiments, the antidiabetic agent may be a glucagon-like peptide-1 (GLP-1) receptor modulator.
The present invention also contemplates preventing, treating, delaying the onset of, or ameliorating any of the diseases, disorders, syndromes, or symptoms described herein in a subject in need thereof using a combination therapy comprising administering to a subject in need thereof an effective amount of a conjugate, compound, or pharmaceutical composition of the invention in combination with any one or more of the following therapeutic agents: dipeptidyl peptidase-4 (DPP-4) inhibitors (e.g., sitagliptin, saxagliptin, linagliptin, alogliptin, etc.); GLP-1 receptor agonists (e.g., short acting GLP-1 receptor agonists such as exenatide and lixisenatide; intermediate acting GLP-1 receptor agonists such as liraglutide; long acting GLP-1 receptor agonists such as extended release exenatide, abiratetide, dolaglutide); sodium-glucose cotransporter-2 (SGLT-2) inhibitors (e.g., canaglifozin (canaglifozin), dapaglifozin (dapaglifozin), empaglifozin (empaglifozin)); bile acid sequestrants (e.g., colesevelam, etc.); dopamine receptor agonists (e.g., immediate release bromocriptine); biguanides (e.g., metformin, etc.); insulin; oxyntomodulin; sulfonylureas (e.g., chlorpropamide, glimepiride, glipizide, glyburide, glibornuride, glipizide, glipiride, tolazamide, tolbutamide, acetylbenzenesulfonylcyclohexamide, carbutamide, etc.); and thiazolidinediones (e.g., pioglitazone, rosiglitazone, lobeglitazone, ciglitazone, darglitazone, englitazone, nateglinide, rosiglitazone, troglitazone, etc.). In some embodiments, the dosage of one or more additional therapeutic agents is reduced when provided in combination with a conjugate or compound of the invention. In some embodiments, the additional therapeutic agent may be used at a lower dosage when used in combination with the conjugates or compounds of the invention than when each is used alone.
In certain embodiments, wherein the disease or disorder is selected from: obesity, type I or type II diabetes, metabolic syndrome (i.e., syndrome X), insulin resistance, impaired glucose tolerance (e.g., glucose intolerance), hyperglycemia, hyperinsulinemia, hypertriglyceridemia, hypoglycemia due to Congenital Hyperinsulinemia (CHI), dyslipidemia, atherosclerosis, diabetic nephropathy, and other cardiovascular risk factors such as hypertension and cardiovascular risk factors associated with unmanaged cholesterol and/or lipid levels, osteoporosis, inflammation, nonalcoholic fatty liver disease (NAFLD), nonalcoholic steatohepatitis (NASH), kidney disease, and eczema, and the second therapeutic agent may be liraglutide.
The present invention contemplates preventing, treating, delaying the onset of, or ameliorating any of the diseases, disorders, syndromes, or symptoms described herein in a subject in need thereof using a combination therapy comprising administering to a subject in need thereof an effective amount of a conjugate, compound, or pharmaceutical composition of the invention in combination with a surgical therapy. In certain embodiments, the surgical therapy can be bariatric surgery (e.g., gastric bypass surgery, such as a biliary jejunal gastric bypass surgery, gastric sleeve debulking, adjustable gastric banding, biliopancreatic diversion, duodenal switch, intragastric balloon, gastric plication, and combinations thereof).
In embodiments where one or more additional therapeutic agents or surgical therapies are administered on the same day as an effective amount of a conjugate or compound of the invention, the conjugate or compound of the invention can be administered before, after, or simultaneously with the additional therapeutic agent or surgical therapy. The use of the term "in combination" does not limit the order in which the therapies are administered to a subject. For example, a first therapy (e.g., a composition described herein) can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concurrently with, or after (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the second therapy is administered to the subject.
Other embodiments of the invention include additional proteolytic stabilizing modifications that incorporate the amylin agonist peptide, preferably in the region of the peptide between residues 10 and 17. Such proteolytic stabilizing modifications include, but are not limited to, amino acid substitutions by one or more non-proteinogenic amino acids, C-alpha-alkylated amino acids, homologous amino acids, or synthetic amino acids, and the like. Combinations of more than one such proteolytic stabilizing modification are contemplated herein.
In a further embodiment of the invention, the thioether-cyclized amylin mimetic peptide or derivative thereof comprises at least one amino acid residue derived from a half-life extending moiety. Such half-life extending moieties are introduced at suitable (tolerant) sites via conjugation to residues appropriately mutated at these positions. Examples of half-life extending moieties include, but are not limited to, albumin binding lipids, such as palmitic acid or similar fatty acids, and protein bioconjugates, such as HSA, mAb or Fc conjugates.
Other embodiments of the invention include amino acid substitutions and/or peptide modifications introduced to improve the physicochemical properties of the thioether cyclized amylin peptide. In some cases, the native amylin amino acid residues may be mutated to residues that reduce the pI of the peptide, thereby making it easier to formulate for administration while maintaining amylin receptor potency. In other cases, derivatization with a water-soluble functional group (such as, but not limited to, polyethylene glycol) is contemplated as a means of improving the solubility of the thioether-cyclized amylin analog in a suitable formulation vehicle.
Detailed description of the preferred embodiments
The present invention also provides the following non-limiting embodiments.
Embodiment 1 is a conjugate comprising a monoclonal antibody or antigen-binding fragment thereof coupled to an amylin mimetic peptide, wherein the amylin mimetic peptide is represented by formula I or a derivative or a pharmaceutically acceptable salt thereof (SEQ ID NO: 53):
wherein
n is 1 or 2;
Z2is a direct bond, serine or glycine;
Z10Is Q or E;
Z11is R or K, wherein-amine of K is optionally substituted by-C (═ NH) NH2Substitution;
Z25Is P or K;
Z26is I or K;
x is ATZ10Z11Z12ANFZ16VHSSNNFGZ25Z26LPZ29TNVGZ34(SEQ ID NO:54) or VLGRLSQELHRLQTYPRTNTGS (SEQ ID NO: 55);
Z29is P or K;
Z34is S or K;
wherein the derivative is a compound of formula I modified by one or more methods selected from: amidation, glycosylation, carbamylation, sulfation, phosphorylation, cyclization, lipidation, and pegylation.
Embodiment 2 is the conjugate of embodiment 1 wherein the amylin mimetic peptide is a derivative of an amylin mimetic peptide of formula I, or a pharmaceutically acceptable salt thereof, modified by one or more methods selected from the group consisting of: amidation, lipidation and pegylation.
Embodiment 3 is the conjugate of embodiment 1, wherein the amylin mimetic peptide is represented by formula I or a derivative, or a pharmaceutically acceptable salt thereof, wherein:
Z2is a direct bond;
Z6Is T.
Embodiment 4 is the conjugate of embodiment 1, wherein the amylin mimetic peptide is represented by formula I or a derivative, or a pharmaceutically acceptable salt thereof, wherein:
Z16is L;
Embodiment 5 is the conjugate of embodiment 1, wherein the amylin mimetic peptide is represented by formula I or a derivative, or a pharmaceutically acceptable salt thereof, wherein:
Z11is R;
Embodiment 6 is the conjugate of embodiment 1, wherein the amylin mimetic peptide is selected from SEQ ID NOs 4-28.
Embodiment 7 is the conjugate of any one of embodiments 1 to 6, wherein the monoclonal antibody or antigen binding fragment thereof is covalently attached to the amylin mimetic peptide at a lysine residue of the amylin mimetic peptide via a linker.
Embodiment 8 is the conjugate of any one of embodiments 1 to 7, wherein the monoclonal antibody or antigen-binding fragment thereof comprises heavy chain complementarity determining region 1(HCDR1), HCDR2, HCDR3, and light chain complementarity determining region 1(LCDR1), LCDR2, and LCDR3 having polypeptide sequences of SEQ ID NOs: 47, 48, 49, 50, 51, and 52, respectively.
Embodiment 9 is the conjugate of embodiment 8, wherein the isolated monoclonal antibody comprises a heavy chain variable domain (VH) having the polypeptide sequence SEQ ID NO 43 and a light chain variable domain (VL) having the polypeptide sequence SEQ ID NO 45.
Embodiment 10 is the conjugate of embodiment 9, further comprising an Fc moiety.
Embodiment 11 is the conjugate of embodiment 10, comprising a Heavy Chain (HC) having the polypeptide sequence of SEQ ID NO:44 and a Light Chain (LC) having the polypeptide sequence of SEQ ID NO: 46.
Embodiment 12 is a method of making a conjugate according to any one of embodiments 1 to 11 comprising reacting an electrophile, preferably a bromoacetamide-derived linker, on a side chain of the amylin mimetic peptide, preferably on an amino side chain of a lysine residue of the amylin mimetic peptide, with a thiol group of a cysteine residue of SEQ ID NO:49 of the monoclonal antibody, or antigen-binding fragment thereof, thereby forming a covalent bond between the amylin mimetic peptide and the monoclonal antibody, or antigen-binding fragment thereof.
Embodiment 13 is a pharmaceutical composition comprising a conjugate according to any one of embodiments 1 to 11 and a pharmaceutically acceptable carrier.
Embodiment 14 is a method for treating or preventing obesity in a subject in need thereof, the method comprising administering to the subject in need thereof an effective amount of the pharmaceutical composition according to embodiment 13.
Embodiment 15 is the method of embodiment 14, wherein administering an effective amount of the pharmaceutical composition to a subject in need thereof results in a reduction in body weight of about 5% to about 10%, about 10% to about 15%, about 15% to about 20%, or about 20% to about 25% compared to the body weight of the subject prior to administration of the pharmaceutical composition.
Embodiment 16 is a method for treating or preventing a disease or disorder in a subject in need thereof, wherein the disease or disorder is selected from the group consisting of: obesity, type I or type II diabetes, metabolic syndrome, insulin resistance, impaired glucose tolerance, hyperglycemia, hyperinsulinemia, hypertriglyceridemia, hypoglycemia due to Congenital Hyperinsulinemia (CHI), dyslipidemia, atherosclerosis, diabetic nephropathy, and other cardiovascular risk factors such as hypertension and cardiovascular risk factors associated with unmanaged cholesterol and/or lipid levels, osteoporosis, inflammation, non-alcoholic fatty liver disease (NAFLD), non-alcoholic steatohepatitis (NASH), kidney disease, and eczema, comprising administering to a subject in need thereof an effective amount of a pharmaceutical composition according to embodiment 13.
Embodiment 17 is the method of embodiment 16, wherein the disease or disorder is obesity.
Embodiment 18 is the method of embodiment 16, wherein the disease or disorder is type I diabetes.
Embodiment 19 is the method of embodiment 16, wherein the disease or disorder is type II diabetes.
Embodiment 20 is the method of embodiment 16, wherein the disease or disorder is metabolic syndrome.
Embodiment 21 is the method of embodiment 16, wherein the disease or disorder is kidney disease.
Embodiment 22 is the method of embodiment 16, wherein the disease or disorder is nonalcoholic steatohepatitis (NASH).
Embodiment 23 is the method of embodiment 16, wherein the disease or disorder is non-alcoholic fatty liver disease (NAFLD).
Embodiment 24 is a method of reducing food intake in a subject in need thereof, the method comprising administering to a subject in need thereof an effective amount of the pharmaceutical composition of embodiment 13.
Embodiment 25 is the method of embodiment 24, wherein administering an effective amount of the pharmaceutical composition to a subject in need thereof results in a decrease in food intake of about 5% to about 10%, about 10% to about 15%, about 15% to about 20%, about 20% to about 25%, about 25% to about 30%, about 30% to about 35%, about 35% to about 40%, about 40% to about 45%, or about 45% to about 50% compared to the food intake of the subject prior to administration of the pharmaceutical composition.
Embodiment 26 is a method of modulating amylin receptor activity in a subject in need thereof comprising administering to the subject in need thereof an effective amount of the pharmaceutical composition of embodiment 13.
Embodiment 27 is the method of any one of embodiments 14 to 26, wherein the pharmaceutical composition is administered via injection.
Embodiment 28 is the method of embodiment 27, wherein the injection is delivered subcutaneously, intramuscularly, intraperitoneally, or intravenously.
Embodiment 29 is the method of any one of embodiments 14 to 28, wherein the pharmaceutical composition is administered in combination with a second therapeutic agent.
Embodiment 30 is the method of embodiment 29, wherein the disease or disorder is selected from the group consisting of: obesity, type 2 diabetes, metabolic syndrome, insulin resistance and dyslipidemia, and the second therapeutic agent is at least one antidiabetic agent.
Embodiment 31 is the method of embodiment 30, wherein the anti-diabetic agent is a glucagon-like peptide-1 receptor modulator.
Embodiment 32 is the method of embodiment 29, wherein the second therapeutic agent is liraglutide.
Embodiment 33 is the method of any one of embodiments 14 to 32, wherein the pharmaceutical composition is administered to the subject in need thereof daily, weekly, or monthly.
Embodiment 34 is the method of embodiment 33, wherein the pharmaceutical composition is administered once, twice, three times, four times, five times, or six times daily.
Embodiment 35 is the method of embodiment 33, wherein the pharmaceutical composition is administered once, twice, three times, four times, five times, or six times per week.
Embodiment 36 is the method of embodiment 33, wherein the pharmaceutical composition is administered once, twice, three times, or four times a month.
Embodiment 37 is a kit comprising a conjugate according to any one of embodiments 1 to 14 or a pharmaceutical composition according to embodiment 13, preferably the kit further comprises an effective amount of a second therapeutic agent, more preferably the kit further comprises an effective amount of liraglutide.
Embodiment 38 is the kit of embodiment 37, wherein the kit further comprises an injection device.
Embodiment 39 is a method of making a pharmaceutical composition comprising a compound selected from the group consisting of SEQ ID NOS 4-42 and a pharmaceutically acceptable carrier.
Synthesis of
The compounds or conjugates of the invention can be synthesized according to general synthetic methods known to those skilled in the art. The following description of the synthesis is for illustrative purposes and is in no way intended to be a limitation of the present invention.
The thioether-cyclized amylin mimetic peptides or derivatives of the present invention can be synthesized by a variety of known conventional methods for forming a continuous peptide bond between amino acids, and are preferably performed by Solid Phase Peptide Synthesis (SPPS), as generally described in Merrifield (J.am.chem.1963, 85, 2149-. Conventional methods for peptide synthesis involve condensation between the free amino group of one amino acid residue whose other reactive functional groups have been suitably protected and the free carbonyl group of the other amino acid whose reactive functional group has also been suitably protected. Examples of condensation reagents commonly utilized for peptide bond formation include Diisopropylcarbodiimide (DIC) with or without 1-Hydroxybenzotriazole (HOBT), or ethyl cyano (isonitroso) acetate (Oxyma Pure), 2- (1H-benzotriazol-1-yl) -1,1,3, 3-tetramethylammonium Hexafluorophosphate (HBTU), 2- (1H-7-azabenzotriazol-1-yl) -1,1,3, 3-tetramethylammonium Hexafluorophosphate (HATU), 2- (6-chloro-1H-benzotriazol-1-yl) -1,1,3, 3-tetramethylammonium Hexafluorophosphate (HCTU), 1-cyano-2-ethoxy-2-oxoethylaminooxy-trispyrrolidinylhexafluorophosphate phosphonium salt; (PyOxim), 2- (1H-benzotriazol-1-yl) -1,1,3, 3-tetramethyltetrafluoroborate ammonium salt (TBTU), trispyrrolidinyl phosphonium hexafluorophosphate bromide (PyBroP), and the like.
Automated peptide synthesis processes may be performed at room temperature (rt) or at elevated temperatures, preferably by applying microwave heating, as described by: yu (J.org.chem.,1992,57,4781-4784)) and as newly improved by Palasek (J.Pept.Sci.,2007, Vol.13, p.143-148) (J.Pept.Sci.,2007,13, 143-47148)).
The compounds of the invention (C-terminal amides) can be conveniently prepared using the N- α -FMOC protected amino acid procedure, whereby the carboxy terminus of a suitably protected N- α -FMOC protected amino acid is coupled to a conventional solid phase resin using a suitable coupling agent. Suitable conventional commercially available solid phase resins include: rink amide MBHA resin, Rink amide AM resin, Tentagel S RAM resin, FMOC-PAL-PEG PS resin, SpheriTide Rink amide resin, ChemMatrix Rink resin, Sieber amide resin, TG Sieber resin, etc. The resin bound FMOC-amino acid can then be deprotected by exposure to 20% piperidine in DMF or NMP, which treatment serves to selectively remove the FMOC protecting group. Additional FMOC-protected amino acids are then sequentially coupled and deprotected to yield the desired resin-bound protected peptide. In some cases, it may be necessary to use an orthogonal reactive protecting group for another amine in the peptide sequence that will tolerate FMOC deprotection conditions. Protecting groups, such 4-methyltrityl (Mtt) or 4-methoxytrityl (Mmt), both of which can be removed by treatment with 1% TFA/DCM, or preferably allyloxycarbonyl (alloc; accessible by Pd (PPh)3)4/PhSiH3Treatment removal), 1- (4, 4-dimethyl-2, 6-dioxocyclohex-1-ylidene) ethyl (Dde; removable by treatment with 2-3% hydrazine/DMF) and 1- (4, 4-dimethyl-2, 6-dioxocyclohex-1-ylidene) -3-methylbutyl (ivDde; removable by treatment with 2-3% hydrazine/DMF) can be effectively used in this case.
In conventional peptide synthesis methods, the reactive side chains of alpha amino acids are typically protected throughout the synthesis with suitable protecting groups to render them inert to coupling and deprotection protocols. Although a number of protecting groups are known in the art for amino acid side chains, the following protecting groups are most preferred herein: tert-butyl (t-Bu) for serine, threonine, glutamic acid, aspartic acid, and tyrosine; trityl (Trt) for asparagine, glutamine, cysteine, homocysteine and histidine; t-butyloxycarbonyl (Boc) for the-amino group of tryptophan and lysine; and 2,2,4,6, 7-pentamethyldihydrobenzofuran-5-sulfonyl (Pbf) for arginine. These protecting groups are removed upon strong acid treatment, such as high concentrations of trifluoroacetic acid (TFA).
Upon completion of the SPPS, the resin-bound, side chain-protected peptide is deprotected and concomitantly cleaved from the resin using a cleavage mixture consisting essentially of (TFA) in combination with various combinations of carbenium scavengers such as Triisopropylsilane (TIPS), water, phenol, and anisole. The crude solid peptide was then isolated by precipitation of the peptide/mixture filtrate with cold ether. The crude peptide thus obtained is then dissolved in a predominantly aqueous solvent system comprising an organic co-solvent, such as acetonitrile or ethanol, at low concentrations (about <5 mg/mL). Upon raising the pH of the solution to >7, the peptide then undergoes an intramolecular cyclization reaction to form the corresponding crude thioether-cyclized amylin analog of the present invention. The thioether-cyclized amylin analog so formed may be purified using purification techniques generally known in the art. The preferred method of peptide purification for use herein is reverse phase High Performance Liquid Chromatography (HPLC). The purified peptide was then characterized by liquid chromatography/mass spectrometry (LC/MS).
It is understood that the following examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.
Abbreviations
Herein and throughout the specification, the following abbreviations may be used:
aq aqueous
alloc allyloxycarbonyl radical
Boc tert-butyloxycarbonyl group
BSA bovine serum albumin
CDI 1, 1' -carbonyldiimidazole
CT calcitonin
CTR calcitonin receptor
DCM dichloromethane
Dde 1- (4, 4-dimethyl-2, 6-dioxocyclohex-1-ylidene) ethyl
DIC diisopropylcarbodiimide
DIEA diisopropylethylamine
DMA N, N-dimethylacetamide
DMEM Darbeike modified eagle's medium
DMF N, N-dimethylformamide
EDC N- (3-dimethylaminopropyl) -N' -ethylcarbodiimide
EDTA ethylene diamine tetraacetic acid
Et Ethyl group
EtOAc ethyl acetate
EtOH ethanol
FBS fetal bovine serum
FMOC 9-fluorenylmethyloxycarbonyl
g
h hours
HATU 2- (1H-7-azabenzotriazol-1-yl) -1,1,3, 3-tetramethylammonium hexafluorophosphate
HBSS Hank balanced salt solution
HBTU 2- (1H-benzotriazol-1-yl) -1,1,3, 3-tetramethyluronium hexafluorophosphate)
Ammonium HCTU 2- (6-chloro-1H-benzotriazol-1-yl) -1,1,3, 3-tetramethylhexafluorophosphate
HCl hydrochloric acid
HEPES 4- (2-hydroxyethyl) -1-piperazine ethanesulfonic acid;
HIC hydrophobic interaction chromatography
HOBT 1-hydroxybenzotriazole
HPLC high performance liquid chromatography
HTRF homogeneous time-resolved fluorescence
IBMX 3-isobutyl-1-methylxanthine
ivDde 1- (4, 4-dimethyl-2, 6-dioxocyclohex-1-ylidene) -3-methylbutyl
LCMS high performance liquid chromatography-mass spectrometry
Me methyl group
MeCN acetonitrile
mg of
min for
mL of
Mmt 4-methoxytrityl
Mtt 4-Methyltriphenylmethyl
NMP 1-methyl-2-pyrrolidone
OEG 8-amino-3, 6-dioxaoctanoyl
ORF open reading frame
Oxyma cyano (Isonitroso) acetic acid ethyl ester
Pal palmitoyl radical
Pbf 2,2,4,6, 7-pentamethyldihydrobenzofuran-5-sulfonyl
PBS phosphate buffered saline
Pd(PPh3)4Tetrakis (triphenylphosphine) palladium (0)
PhSiH3Phenyl silane
PyBroP trispyrrolidinylphosphonium hexafluorophosphate Bromide
Pyroxim 1-cyano-2-ethoxy-2-oxoethylaminooxy-tripyrrolidinyl hexakis
Fluorophosphoric acid phosphonium salts
RAMP receptor activity modified protein
rt Room temperature
Retention time of RT
sat'd saturation
SPPS solid phase peptide Synthesis
t-Bu tert-butyl
TBTU 2- (1H-benzotriazol-1-yl) -1,1,3, 3-tetramethyltetrafluoroborate ammonium salt
TFA trifluoroacetic acid
TIPS Tri-isopropyl silyl
Tris Tris (hydroxymethyl) aminomethane
Trt Triphenylmethyl
Examples
Example 1: synthesis of thioether-cyclized amylin mimetics (scheme 1)
Step A: synthesis of resin-bound C-terminal amide peptidesBecome into
The protected peptidyl resin was synthesized on a CEM Liberty Blue Microwave peptide synthesizer using FMOC strategy as described above, using a low load Rink amide resin, preferably FMOC-PAL-PEG PS resin (approximately 0.16-0.2meq/g, supplied by Applied Biosystems), on a 0.1mmol scale, as described in scheme 1. Standard FMOC protected amino acids (supplied by Novabiochem (EMD Millipore), Bachem, Peptides International, Sigma-Aldrich or Chem-Impex) were coupled for 4 minutes at 5-fold excess over resin loading using DIC/Oxyma as coupling reagent and reaction temperature of about 90 ℃. FMOC-Arg (Pbf) -OH was double coupled at 90 ℃ for 4 min each, and FMOC-His (Trt) -OH was coupled using a two-stage protocol: at room temperature for 4 minutes, then at 50 ℃ for 8 minutes. MonoFMOC deprotection was performed in 20% piperidine in DMF (deprotection solution) at 90 ℃ for 1.5 min.
And B: protocol for Bromoacetylation of resin-bound peptides (scheme 2)
The FMOC deprotected peptide resin (0.1mmol) was treated with a solution of bromoacetic anhydride (6-20 equivalents) in DMF (5mL) in a microwave reactor at 50 ℃ for 5 minutes, at which time the reaction was generally determined to be complete according to the Kaiser ninhydrin test. In case it was determined that the coupling was incomplete, the coupling was repeated using fresh reagents.
And C: protocol for cleaving peptides from resins
Upon completion of SPPS, the resin was washed thoroughly with DMF, then DCM, and dried. The resin was then treated with a cleavage mixture (10mL/0.1mmol scale) consisting of TFA/water/TIPS (95:2.5:2.5) (cleavage mixture A), or more preferably TFA/water/phenol/TIPS (88:5:5:2) (cleavage mixture B), and heated in a microwave reactor at 38 ℃ for 40 minutes, followed by filtration. The resin was washed with TFA, and the combined filtrates were concentrated under a stream of nitrogen to a volume of about 2.5mL, and the peptide was precipitated by addition of cold diethyl ether (40 mL). The peptide/ether suspension was centrifuged and the ether layer decanted. The peptide pellet was resuspended in ether, centrifuged and decanted, and the process repeated three times. The crude peptide thus obtained was dried under a gentle stream of nitrogen.
Step D: protocol for peptide cyclization (thioether formation)
To be provided with<The crude cysteine-or homocysteine-containing peptide was dissolved in deoxygenated MeCN/water (50-60% MeCN) or EtOH/water (50-60% EtOH) at a concentration of 4 mg/mL. Then by adding solid NaHCO3、NaHCO3The pH of the peptide solution was raised to about 7-9 with saturated aqueous solution or 1M Tris aqueous buffer (pH 7.5), and the resulting solution was stirred at room temperature for 3-16 hours. Typically, cyclization is complete within 1 hour as determined by LC/MS analysis.
Step E: protocol for peptide purification
The cyclization reaction mixture was acidified to pH 1.5-3 by addition of TFA and the solution was concentrated to remove most of the organic co-solvent (MeCN or EtOH) to the point where slight turbidity appeared. A minimum amount of co-solvent was added back if necessary to homogenize the mixture, and the resulting solution was then directly purified by preparative HPLC in multiple injections. Purification was performed on an Agilent PrepStar HPLC system or a Gilson HPLC 2020 personal purification system using a reverse phase C18 or C8 column selected from: varian Pursuit XRs C18(21x250mm,5μm);Varian Pursuit XRs Diphenyl(30x100mm,5μm);Zorbax 300 SB-C8(21x250mm,5μm);Waters Atlantis T3 C18(19x250mm,5μm);Agilent Polaris 5 C18-A(30x250mm,5 μm). The mobile phase consisted of buffer A (0.1% TFA in water) and buffer B (0.1 in MeCN)% TFA) ranging from an initial concentration of 10-20% B to a final concentration of 40-90% B, run time ranging between 36-80 min. UV detection was monitored at 220nm and 254 nm. The product containing fractions were purified using the fractions from above (4.6x250mm,5 μm) was analyzed by analytical HPLC on an Agilent 1100 HPLC system. Pure fractions were combined, concentrated to remove most of the organic phase, and then lyophilized. TFA/HCl salt exchange was then performed by triple lyophilization from 2mM HCl, according to the procedure described by Andrushchenko et al (j.pept.sci.,2006,13, 37-43).
Wherein LG is a leaving group
X is ATZ10Z11Z12ANFLVHSSNNFGZ25Z26LPZ29 TNVGZ34Or
VLGRLSQELHRLQTYPRTNTGS
Protected amino acid
Scheme 1: synthesis of thioether-cyclized amylin mimetics as follows:
amylin/pramlintide/davalinin analogs (scheme 1 discloses SEQ ID NOs 56, 56-58 and 55, respectively)
Listed in order of occurrence, respectively
Example 2: synthesis of Lipidated amylin mimetics (scheme 2)
Step A: for introducing derivatized lysine residues into peptide sequences stacked on standard Rink amide resins
Protocol (1)
Resin-bound C-terminal amide peptide (set to before the desired point of derivatization) was added under microwave conditions (either manually or on a Liberty Blue peptide synthesizer) using the DIC/Oxyma coupling procedure as described in example 1AAnd prepared as described in example 1A) sequentially couple Dde-lys (FMOC) -OH or ivDde-lys (FMOC) -OH, followed by FMOC-OEG-OH (coupling one or two units in series), optionally followed by FMOC-Glu-OtBu. Deprotection of FMOC followed by application of lipophilic acid [ e.g., palmitic acid ] in microwave conditions at 90 deg.C](5-10 equiv.), DIC (5-10 equiv.), and HOBT or Oxyma (5-10 equiv.) the resin was treated in DMF for 10 minutes. The reaction was then drained and the resin was washed with DMF. Scheme 2 shows that at position Z25Lipidated lysine was introduced. Those skilled in the art will recognize that a similar approach will be at Z26、Z29Or Z3To produce lipidated lysine.
Scheme 2: protocol for the introduction of derivatized lysine residues into amylin mimetic peptides (scheme 2 discloses SEQ
ID NOs 59, 60 and 61, listed in order of occurrence respectively)
And B: protocol for deprotection of Dde-or ivDde-protected lysyl peptides
The derivatized lysyl peptide resin was treated with a solution of 3% hydrazine in DMF (6mL/0.1mmol resin) under microwave conditions at 90 ℃ for 3.5 minutes. The reaction was drained and the procedure repeated two more times. The reaction was drained and the resin was washed thoroughly with DMF and then DCM.
And C: protocol for direct incorporation of FMOC-Lys (Pal-Glu-OtBu) -OH residue
In the case of incorporation of a palmitoylated-gamma Glu-lysyl residue into this sequence, FMOC-Lys (Pal-Glu-OtBu) -OH (available from Peptides International or Activepeptide) can be used directly in the protocol described in example 1A.
Example 3: synthesis of BrAc-dPEGx-derived amylin mimetics (scheme 3)
Thioether cyclized peptide obtained from example 1E (wherein Z25、Z26、Z29Or Z34One of them is K (NH)2) A solution (0.3mL) of (7. mu. mol) and BrAc-dPEGx-OTFP (3 equiv.) in DMA was treated with DIEA (7 equiv.) and the resulting solution was stirred at room temperature. After completion of the reaction (ca.1 h), the mixture was acidified with TFA, diluted with water (0.1% TFA), and purified by reverse phase chromatography as described in example 1E. Scheme 3 shows that at position Z25Lipidated lysine was introduced. Those skilled in the art will recognize that a similar approach will be at Z26、Z29Or Z34To produce a BrAc-dPEGx-derived lysine.
Scheme 3: protocol for the synthesis of BrAc-dPEGx-derived amylin mimetic peptides (scheme 3 discloses SEQ ID)
NO62 and 62-65, listed in order of occurrence respectively)
Example 4: synthesis of thioether-cyclized amylin mimetic peptide-mAb conjugates
Expression and purification of mAbs
Fully human monoclonal antibodies (mabs) can be recombinantly expressed in mammalian expression hosts and purified from cell culture supernatants using standard methods known in the art. For example, cDNA sequences encoding the Light Chain (LC) and Heavy Chain (HC) of a mAb, each comprising an appropriate single peptide that causes secretion, can be cloned into separate mammalian expression vectors or into a single expression vector using standard molecular biology methods. The expression vector used may be a commercially available vector such as pEE12.4, pcDNATM3.1(+) or pIRESpuro3 or any custom-made expression vector with similar functions. In such vectors, transcription of the heavy and light chains of the mAb is each driven by any known effective promoter, such as the hCMV-MIE promoter. Transfection grade Plasmid DNA of separate LC and HC expression constructs or a single construct expressing both LC and HC was prepared using standard methods such as QIAGEN Plasmid Midi kit.
Following the manufacturer's instructions, a lipid-based transfection reagent such as Freestyle was usedTMMax transfection reagents purified plasmid DNA was prepared and then transfected into standard mammalian expression host cell lines, such as CHO-S or HEK 293-F. If the mAbs LC and HC are encoded by separate expression constructs, both constructs are transfected simultaneously. Mammalian cells for maintenance or for mAb expression are cultured according to standard cell culture methods before and after transfection, whereby the range of cell densities maintained, the culture medium used and other cell culture conditions followed are determined by the particular mammalian host cell line utilized. These parameters are usually documented by the supplier of the cell line or in the scientific literature. For example, CHO-S cells are cultured in CHO FreestyleTMSuspension was maintained in medium at 37 ℃ and 8% CO2Was shaken at 125RPM and the cell concentration was 1.5 and 2.0X10 per ml6The other cells divide.
Cell culture supernatants from transiently transfected mammalian cells expressing mabs were harvested several days post transfection, clarified by centrifugation and filtered. The duration of expression of CHO-S cells is typically four days, but can be adjusted and may vary for different mammalian host cell lines. Large scale transfections (>10 liters) were concentrated 10-fold using a concentrator such as Centramate. The mAb is purified from the clarified supernatant using a protein a affinity column such as HiTrap MabSelect Sure using standard methods for binding the mAb to a protein a resin, washing the resin, and eluting the protein using low pH buffer. The protein fractions were immediately neutralized by elution into tubes containing pH7 buffer, and the peak fractions were pooled, filtered and dialyzed overnight at 4 ℃ against pH7.2 Phosphate Buffered Saline (PBS). After dialysis, the mAb was filtered again (0.2 μ filter) and the protein concentration was determined by absorbance at 280 nm. The quality of the purified mAb protein was assessed by SDS-polyacrylamide gel electrophoresis (PAGE) and analytical size exclusion HPLC, and endotoxin content was measured using Limulus Amoebocyte Lysate (LAL) assay. The purified mAb was stored at 4 ℃.
Expression and purification of MSCB97 transiently transfected into CHO cells
MSCB97 was transfected transiently into cells with purified plasmid DNA of the MSCB97 expression construct according to the manufacturer' S recommendations at ExpicCHO-STMExpressed in cells (ThermoFisher Scientific, Waltham, Mass.; Cat. No. A29127). Briefly, 8% CO at 37 ℃ was set2And 125RPM in a shaking incubator ExpicHO-STMCells in ExpicHOTMSuspension was maintained in expression medium (ThermoFisher Scientific, Cat. No. A29100). Cells were passaged so that dilution to 6.0X 10 per ml could be achieved on the day of transfection6Individual cells, maintaining cell viability of 98% or better. Expifeacmine was usedTMTransient transfection was performed using the CHO transfection kit (ThermoFisher Scientific Cat. No. A29131). For each ml of diluted cells to be transfected, one mg of plasmid DNA was used and diluted to OptiPROTMSFM complex medium. Expifeacmine was used at a 1:3 ratio (v/v, DNA: reagent)TMCHO reagent, and also diluted to OptiPROTMIn (1). The diluted DNA and transfection reagent were combined for one minute, allowing DNA/lipid complexes to form, and then added to the cells. After overnight incubation, expihcho was addedTMFeed and ExpifeacamineTMThe CHO enhancer was added to the cells. The cells were cultured with shaking at 32 ℃ for five days, after which the culture supernatant was harvested.
Transient transfection ExpicHO-S was harvested by centrifugation (30min,6000rpm) for clarification followed by filtration (0.2. mu. PES membrane, Corning)TMCulture supernatant of cells. Large-scale transfections (5 to 20 liters) were first concentrated 10-fold using a Pall Centramate Tangential Flow Filtration system. 10 XDPBS (Darbeike phosphate buffered saline), pH7.2, was added to the supernatant to 1 Xfinal concentration and then loaded onto an equilibrated (DPBS, pH 7.2) HiTrap MabSelect Sure Protein A column (GE Healthcare; Little Chalfount, United Kingdom) at a relative concentration of 20mg Protein per ml resin using an AKTA FPLC chromatography system. After loading, the column was washed with 10 column volumes of DPBS pH 7.2. Washing with 10 column volumes of 0.1M sodium acetate pH3.5And (4) deproteinizing. Protein fractions were immediately neutralized by elution to tubes containing 2.0M Tris, pH7, at 20% elution fraction volume. The peak fractions were combined and the pH adjusted to about 5.5 with additional Tris if necessary. The purified protein (0.2 μ) was filtered and the concentration determined by absorbance at 280nm on a BioTek SynergyHTTM spectrophotometer. The quality of the purified proteins was assessed by SDS-PAGE and analytical size exclusion HPLC (Dionex HPLC system). LAL determination by nephelometry (Associates of Cape Cod) endotoxin levels were measured.
Conjugation of MSCB97 to amylin mimetics
To mAb (1.2mL,19mg/mL) was added 4 equivalents of TCEP followed by EDTA (100 mM; 12. mu.L). After 2 hours at room temperature, LCMS analysis indicated complete reduction of the disulfide adduct at position C102. The reduced mAb was treated with a Zebra desalting spin column (7x10mL, 7K MWCO, pre-equilibrated with Tris-acetate 100mM pH 5.6) to remove the released cysteine/GSH. To this reduced mAb was added a solution of bromoacetylated amylin mimetic peptide from example 3 in Milli grade Q water (7 equivalents relative to mAb, 30-35mg/mL), followed by EDTA (100 mM; 13.5. mu.L). The pH of the reaction was adjusted to 7.9 by dropwise addition of 1M Tris-acetate buffer (pH 9). The reaction was allowed to proceed overnight at room temperature with gentle stirring. Then saturated with (NH)4)2SO4The reaction was diluted (10% v/v) and the crude conjugate was purified by hydrophobic interaction chromatography (TOSOH TSKgel Phenyl HIC) with a linear gradient (40-100% B/A, solvent A: 5% i-PrOH,1M (NH)4)2SO4100mM phosphate buffer, pH 6.0; solvent B: 20% i-PrOH,100mM phosphate buffer, pH 6.0). Final purification was achieved by protein a adsorption (PBS buffer) and elution (NaOAc, pH 3.5). The pH of the product was adjusted to 6 with 2.5M Tris (pH 7.7; 10 v%) and dialyzed against PBS to obtain the final sample.
Example 5: peptide and peptide-bioconjugate analysis and characterization
The method A comprises the following steps: on a Hewlett Packard series 1100 MSD system configured with HP 1100 series HPLC, a Waters Atlantis T3C 18(4.6x250mm,5 μm) column, purified peptide was analyzed by LC/MS. Depending on the polar/non-polar nature of the peptide, one of two linear gradients (buffer A: water + 0.1% TFA; buffer B: MeCN + 0.1% TFA) was used at a flow rate of 1mL/min and a column temperature of 35 deg.C [ method A1: 15-60% B, for 22 min; method A2: 40-90% B, for 22min]. Electrospray analysis (ES-API, positive ion scan) provides mass analysis for each peptide. In all cases, a number of charged species were observed, of which 1/3[ M +3 ]]+ and 1/4[ M +4 ]]The + ions are the characteristic, most prominently observed ions. All products produced their desired multiply charged ions within acceptable limits. The results of mass spectrometry analysis of the peptides and the Retention Time (RT) of the LC observed are shown in Table 1.
The method B comprises the following steps: on the Shimadzu 10AVP system, YMC-Pack-ODS-A (4.6x250mm,5 μm) column, and the purified peptide was analyzed by HPLC. A linear solvent gradient (20-80% B over 30min) was used at a flow rate of 1mL/min (buffer A: water + 0.05% TFA; buffer B: MeCN + 0.05% TFA). Mass spectra were obtained on a Waters Xevo G2 ToF spectrometer (ToF MS ES, positive ion scan). In all cases, a number of charged species were observed, of which 1/3[ M +3 ]]+ and 1/4[ M +4 ]]The + ions are the characteristic, most prominently observed ions. All products produced their desired multiply charged ions within acceptable limits. The results of mass spectrometry analysis of the peptides and the Retention Time (RT) of the LC observed are shown in Table 1.
The method C comprises the following steps: on a Hewlett Packard series 1100 MSD system configured with HP 1100 series HPLC, MAbPac HIC-10(4.6x1000mm,5 μm) column, purified amylin molds analyzed by Hydrophobic Interaction Chromatography (HIC)A peptidomimetic-mAb conjugate. A linear solvent gradient (0-100% B over 30min) was used at a flow rate of 0.5mL/min (buffer A: 5% i-PrOH,1.5M (NH)4)2SO4100mM phosphate buffer, pH 6.0; and (3) buffer solution B: 20% i-PrOH,100mM phosphate buffer, pH 6.0). Complete mass measurements were obtained on a Waters Xevo G2-XS QToF spectrometer (TOF MS ES, positive ion scan). The results of analytical characterization of amylin mimetic peptide-mAb conjugates are shown in table 1.
Table 1: analytical data for thioether-cyclized amylin mimetic Compounds。
Example 6: human calcitonin/RAMP 3 receptor cAMP assay (AMY3R assay)
The method for testing the in vitro potency of amylin mimetic analogs is a cell-based assay designed to measure cAMP produced by adenylate cyclase by modulating the human calcitonin G protein-coupled receptor through its interaction with the receptor activity modifying protein 3(CTR/RAMP 3). cAMP production in 1321N1 astrocytoma cells (discover x) transfected with human AMY3R was induced in a dose-dependent manner by amylin mimetic analogs and controls and measured in a LANCE FRET-based competitive cAMP immunoassay (PerkinElmer).
Cells were cultured in DMEM, 10% FBS, 2.5. mu.g/ml puromycin and 800. mu.g/. mu.l G418. For the assay, cells were collected by removing the medium, washing with PBS and verene to lift the cells (Life Technologies). Cells were centrifuged at 450 Xg for 5min and the supernatant aspirated. The cells were incubated at 0.5X 106Each cell/ml was resuspended in 1 XHBSS (Life Technologies), 5mM HEPES (Life Technologies), 0.1% BSA (Perkin Elmer), 1.0mM 3-isobutyl-1-methylxanthine(IBMX) (Sigma) and 10 μ Ι _ of suspended cells were added to each well of 384-well white optimal plate (PerkinElmer) to a final density of 5000 cells/well. Dilutions of amylin analogs and controls were prepared in 1x HBSS, 5mM HEPES, 0.1% BSA, and 10 μ Ι/well of each sample was added to the designated wells. The plates were incubated at room temperature for 30min with shaking. Then 20. mu.L/well of LANCE cAMP detection reagent mix (PerkinElmer) was added to each assay plate, which was incubated at room temperature for 2 to 24h with shaking. Plates were read on a Perkin Elmer Envision plate reader using a protocol based on the manufacturer's recommendations included in the LANCE Ultra cAMP kit. Four replicate measurements were made for all samples. Data were analyzed using the crubile internal data analysis software designed by Eudean Shaw to derive parameters such as EC50, LogEC50, hillslope (nh), top and bottom by plotting raw LANCE cAMP values versus log compound concentration. Use of a non-linear weighted least squares application (open source http:// cran. us. R-project. org/, by Janssen R) within an R environment&Non-clinical statistics and computational department implementation of D), data were fitted with a 4-P model.
The potency of the amylin mimetic analogs of the present invention relative to pramlintide used as a control in the same assay is presented in table 2 below:
table 2: AMY3 receptor potency of thioether-cyclized amylin mimetic Compounds and Pramlintide (seq.2)
Example 7: human calcitonin/RAMP 1 Complex cAMP assay (AMY1R assay)
In vitro potency and selectivity of amylin mimetic analogs were assessed using a cell-based assay designed to measure cAMP production following modulation of human CTR or CTR/RAMP1 complex (AMY 1R). cAMP production in human CTR or AMY1R transiently transfected COS7 cells was induced in a dose-dependent manner by amylin mimetic analogs and controls and measured using HTRF cAMP kit (CisBio cAMP Dynamic kit, catalog No. 62AM4 PEC).
A plasmid encoding the HA-labeled human calcitonin receptor was generated by subcloning the human CTR ORF (ENST00000426151.5) labeled with 3xHA immediately after the signal peptide into pcDNA3.1(+) using EcoRV and XhoI. A plasmid encoding Flag-tagged human RAMP1 was generated by subcloning the human RAMP1 ORF (ENST00000254661.4) into pcDNA3.1(+) using EcoRV and XhoI, the human RAMP1 ORF being tagged with a Flag-tag immediately after the signal peptide at the N-terminus (DYKDDDDK (SEQ ID NO: 66)).
COS-7 cells were cultured in DMEM (ThermoFisher Scientific #11965092) containing 10% FBS (Hyclone # SH30070.03) and 1% penicillin-streptomycin (ThermoFisher Scientific #15140122) and transfected in 384-well white poly-D-lysine coated plates (Corning #356663) using Fugene HD (Promega # E2312). For each condition, DNA (μ g): Fugene HD (μ L) mix ratio was 1:3, and 10,000 cells/well were added at 40 μ L on top of 10 μ L DNA: Fugene mixture. The plates were incubated at 37 ℃ in CO2Incubate in incubator for 48 hours. CTR: RAMP1 cDNA transfection ratio (2:9) was optimized to favor the formation of amylin-1 receptor (AMY1R) and the amount of CTR cDNA transfected was optimized so that the expression of calcitonin and amylin receptor on the cell surface was not significantly different as assessed by ELISA for HA labeling.
On the day of assay, the media was replaced with assay buffer containing calcium and magnesium-containing HBSS, 20mM HEPES and 0.1% fatty acid-free BSA, pH7.4, and the cells were starved for 1h at 37 ℃. The assay buffer was then replaced with fresh assay buffer containing 500 μ M IBMX and the compound was added to the assay buffer (without IBMX). The plates were incubated at room temperature for 30min with shaking. cAMP was detected according to the manufacturer's protocol (CisBio cAMP Dynamic kit, Cat # 62AM4 PEC). Fluorescence was read with a pheasar plate reader using excitation at 337nm and emission at 620nm and 665 nm. Data were normalized for the maximal response of pramlintide. Emax and EC50 determinations were performed from agonist response curves analyzed with a curve fitting program using the 4 parameter logistic dose response equation in Graphpad Prism 7.0. The data presented represent three independent experiments with four replicate measurements for each compound. Data are presented as mean values. The AMY1R potency of the compound relative to pramlintide (seq2) is expressed as fold change. The potency of the compound at AMY1R relative to the potency of the compound at CTR is also shown as a fold difference (table 3).
For cell surface receptor expression assays, cells from the same transfection as used for cAMP assays were seeded into 96-well plates, fixed with 4% paraformaldehyde and blocked with PBS + 1% FBS. Rat anti-HA-peroxidase (clone 3F10, Roche Bioscience #12013819001) was administered at 0.5mg/L for 30 min. After washing with blocking buffer and PBS, chemiluminescence was detected using SuperSignal substrate (Pierce, Rockford, IL, USA) and a PHERAstar plate reader.
Table 3: AMY1 and CT receptor potency of thioether-cyclized amylin mimetic Compounds and Pramlintide (seq.2)
Example 8: in vivo efficacy studies
Gastric emptying: acetaminophen (AAP) uptake in lean C57Bl/6N mice
Male lean C57BL/6 mice (6-8 weeks old) were obtained from Taconic laboratories. Mice were placed as one mouse per cage in a 12-hour light/dark-cycled temperature-controlled chamber bedding with AlphaDri. Mice were exposed to water ad libitum and maintained on a normal diet (laboratory diet catalog: 5K 75). Animals were acclimated to the facility for at least one week prior to the start of the experiment.
The day prior to dosing, mice were divided into groups of ten animals based on individual body weight. On the next day, 5:00-6:00pm, animals were taken off the food and treated with vehicle (PBS, pH7.4) or test compound at a dose of 30nmol/kg (3nmol/mL) via subcutaneous administration. After 18h, the acetaminophen (AAP) suspension mixture [ AAP (10 mg/mL); HPMC (5 mg/mL); acacia gum (50mg/mL) ] was administered to the animals by oral drench (10 mL/kg). Whole blood samples (tail incisions; -25 μ L) were collected into DMPK-C dried blood filter paper sheets at time points of 5, 10, 15, 30, and 60 min. The pieces of hemofilter paper were completely dried and placed in individual bags with desiccant to be ready for LC/MS analysis by standard techniques. Statistical analysis was performed using one-way ANOVA in Prism using Dunnett's post-hoc test. All data are shown as mean values.
Food intake of fasted lean C57BL6N mice: acute administration
Male C57BL/6 mice (6-8 weeks old) were obtained from Taconic laboratories. Mice were placed as one mouse per cage in a 12-hour light/dark-cycled temperature-controlled chamber bedding with AlphaDri. Mice were exposed to water ad libitum and maintained on a normal diet (laboratory diet catalog: 5K 75). Animals were acclimated in BioDAQ cages (Research Diets, inc., New Brunswick, NJ) not less than 72 hours prior to starting the experiment.
Once acclimated in the BioDAQ cage, mice were divided into groups of ten animals based on their individual body weights and food intake over the previous 24 hours. At 4:00-5:00pm, animals were weighed and treated with vehicle (PBS, ph7.4) or test compound at a dose of 30nmol/kg (3nmol/mL) via subcutaneous administration. After a subsequent overnight fasting period (16-18 hours), the food weight of each cage was continuously recorded by the BioDAQ automated monitoring system for the next 48 hours. Debris was removed daily from the hopper and surrounding area of the cage using vacuum. Supplementing food when necessary. The percentage of mean cumulative food intake relative to vehicle over the 12-48 hour period post-dose was calculated and reported in table 4. Statistical analysis was performed using two-way ANOVA in Prism using Dunnett's post-hoc test. All data are shown as mean values.
Table 4: in vivo efficacy studies of thioether-cyclized amylin mimetic compounds
Not determined ND
*p<0.05;**p<0.01;***p<0.001;§p<0.0001
Example 9: PK study of Male C57BL6N mice
In a 12-hour light/dark-cycling temperature-controlled chamber, male C57BL/6N mice (6-8 weeks old, Taconic) were individually housed with AlphaDri bedding and were allowed to freely reach labdie 5K75 rodent diet and drinking water. Mice were grouped based on body weight fed (N ═ 3); the compounds were formulated in PBS (1nmol/mL) and administered subcutaneously at a dose of 10 nmol/kg. Whole blood samples (tail-cut; -50. mu.L) were collected at 4h, 24h, 72h, 96h and 7d time points into EDTA-coated Sarstedt containing a protease inhibitor cocktail (Roche complete protease inhibitor and Millipore DPPIV inhibitor; 2.5. mu.L)Tubes were placed on ice. The final blood draw (7d) is a terminal blood draw with a target volume of 500. mu.L (25. mu.L of protease inhibitor cocktail). The samples were then centrifuged (10,000rpm) for 10 minutes at 4 ℃; the plasma was then transferred to 96-well plates (. about.25. mu.L/well plasma) which were stored at-80 ℃ to be bioanalyzed.
Plasma samples were analyzed using an LC-MS/MS assay to quantify representative peptides. In this assay, analytes are extracted from plasma using immunoaffinity capture by anti-human IgGFc antibodies, followed by protease digestion (trypsin or pepsin) and reverse phase LC-MS/MS analysis. Multiple Reaction Monitoring (MRM) MS analysis was performed on an API5000 triple quadrupole mass spectrometer operating in positive electrospray mode. Peptides derived from the N-terminal region of the trypsin mimetic sequence were monitored as surrogate for the quantitative active conjugate, while peptides located on the Fc region of the mAb were monitored as surrogate for the total level of mAb. Standard curve and quality control samples were prepared by doping plasma with reference standards of amylin mimetic conjugates and treated simultaneously using the same protocol as the study samples. The data are shown in table 5.
Table 5: pharmacokinetic parameters of thioether-cyclized amylin mimetic Compounds in Male C57BL/6N mice
Estimation of finite time point samples taken during the cancellation phase
It will be appreciated by those skilled in the art that changes could be made to the embodiments described above without departing from the broad inventive concept thereof. It is understood, therefore, that this invention is not limited to the particular embodiments disclosed, but it is intended to cover modifications within the spirit and scope of the present invention, as defined by the present specification.
All documents cited herein are incorporated by reference.
Exemplary amylin mimetic sequences or conjugates thereof of the present invention include:
SEQ ID NO:1
name: amylin (1-37)
The structure is as follows:
SEQ ID NO:2
name: pramlintide (1-37)
The structure is as follows:
SEQ ID NO:3
name: davallin peptide (1-32)
The structure is as follows:
SEQ ID NO:4
name: [ Ring- (N3-COCH)2-C7)]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:5
name: [ Ring- (N3-COCH)2-hC7),K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:6
name: [ Ring- (N3-COCH)2-hC7),β-A5]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:7
name: [ Ring- (N3-COCH)2-hC7),β-A5,K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:8
name: [ Ring- (N3-COCH)2-hC7),β-A5,K(Alloc)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:9
name: [ Ring- (N3-COCH)2-C7),β-A5,K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:10
name: [ Ring- (N3-COCH)2-C7),β-A5,K(Alloc)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:11
name: [ Ring- (N3-COCH)2-C7),Abu5,K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:12
name: [ Ring- (N3-COCH)2-hC7),Abu5,K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:13
name: [ Ring- (N3-COCH)2-hC7),(S)-β-Aib5,K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:14
name: [ Ring- (N3-COCH)2-hC7),(R)-β-Aib5,K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:15
name: [ Ring- (N3-COCH)2-hC7),β-hA5,K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:16
name: [ Ring- (N3-COCH)2-hC7),β-hP5,K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:17
name: [ Ring- (N3-COCH)2-hC7), { pyrrolidinyl- (3S) -carboxy }5, k (ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:18
name: [ Ring- (N3-COCH)2-hC7),{(1R,2R)-ACPC}5,K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:19
name: [ Ring- (N3-COCH)2-hC7),β-hT4,K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:20
name: [ Ring- (N3-COCH)2-C7),β-hT4,K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:21
name: [ Ring- (N3-COCH)2-hC7),β-hT6,K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:22
name: [ Ring- (N3-COCH)2-C7),β-hT6,K(Ac)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:23
name: [ Ring- (S2-COCH)2-hC7),β-A5,K(Ac)26]-pramlintide 2-37
The structure is as follows:
SEQ ID NO:24
name: [ Ring- (S2-COCH)2-C7),β-A5,K(Ac)26]-pramlintide 2-37
The structure is as follows:
SEQ ID NO:25
name: [ Ring- (N3-COCH)2-hC7),β-A5,K(Ac)25]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:26
name: [ Ring- (N3-COCH)2-hC7),β-A5,K(Ac)29]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:27
name: [ Ring- (N3-COCH)2-hC7),β-A5,K(Ac)34]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:28
name: [ Ring- (N3-COCH)2-hC7),β-A5]-Davallin peptide 3-32
The structure is as follows:
SEQ ID NO:29
name: [ Ring- (N3-COCH)2-hC7),β-A5,K(OEG2-Pal)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:30
name: [ Ring- (N3-COCH)2-hC7),β-A5,K(OEG2-γ-Glu-Pal)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:31
name: [ Ring- (N3-COCH)2-hC7),β-A5,α-MeL12,K(dPEG12-AcBr)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:32
name: [ Ring- (N3-COCH)2-hC7),β-A5,hR11,K(dPEG12-AcBr)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:33
name: [ Ring- (N3-COCH)2-hC7),β-A5,E10,K(dPEG12-AcBr)26]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:34
name: [ Ring- (N3-COCH)2-hC7),β-A5,α-MeL12,K(dPEG12-AcBr)25]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:35
name: [ Ring- (N3-COCH)2-hC7),β-A5,hR11,K(dPEG12-AcBr)25]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:36
name: [ Ring- (N3-COCH)2-hC7),β-A5,E10,K(dPEG12-AcBr)25]-pramlintide 3-37
The structure is as follows:
SEQ ID NO:37
name: [ Ring- (N3-COCH)2-hC7),β-A5,α-MeL12,K(dPEG12)26]-pramlintide 3-37mAb homodimer conjugates
The structure is as follows:
SEQ ID NO:38
name: [ Ring- (N3-COCH)2-hC7),β-A5,hR11,K(dPEG12)26]-pramlintide 3-37mAb homodimer conjugates
The structure is as follows:
SEQ ID NO:39
name: [ Ring- (N3-COCH)2-hC7),β-A5,E10,K(dPEG12)26]-pramlintide 3-37mAb homodimer conjugates
The structure is as follows:
SEQ ID NO:40
name:[ Ring- (N3-COCH)2-hC7),β-A5,α-MeL12,K(dPEG12)25]-pramlintide 3-37mAb homodimer conjugates
The structure is as follows:
SEQ ID NO:41
name: [ Ring- (N3-COCH)2-hC7),β-A5,hR11,K(dPEG12)25]-pramlintide 3-37mAb homodimer conjugates
The structure is as follows:
SEQ ID NO:42
name: [ Ring- (N3-COCH)2-hC7),β-A5,E10,K(dPEG12)25]-pramlintide 3-37mAb homodimer conjugates
The structure is as follows:
SEQ ID NO:43
name: MSCB97 VH (variable heavy chain)
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKYDGCYGELDFWGQGTLVTVSS
SEQ ID NO:44
Name: MSCB97 HC (heavy chain)
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKYDGCYGELDFWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
SEQ ID NO:45
Name: MSCB97 VL (light chain variable region)
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPLTFGQGTKVEIK
SEQ ID NO:46
Name: MSCB97 LC (light chain)
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPLTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
SEQ ID NO:47
Name: MSCB97 HCDR1
SYAMS
SEQ ID NO:48
Name: MSCB97 HCDR2
AISGSGGSTYYADSVKG
SEQ ID NO:49
Name: MSCB97 HCDR3
YDGCYGELDF
SEQ ID NO:50
Name: MSCB97 LCDR1
RASQSVSSYLA
SEQ ID NO:51
Name: MSCB97 LCDR2
DASNRAT
SEQ ID NO:52
Name: MSCB97 LCDR3
QQRSNWPLT
Claims (22)
1. A compound of formula I (SEQ ID NO:53)
Wherein
n is 1 or 2;
Z2is a direct bond, serine or glycine;
Z10Is Q or E;
Z11is R or K, wherein-amine of K is optionally substituted by-C (═ NH) NH2Substitution;
Z25Is P or K, wherein-amine of said K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 Substitution, wherein the mAb is optionally substituted by another thioether bondTo a second compound of formula I such that there are two identical compounds of formula I on the mAb;
Z26is I or K, wherein-amine of said K is optionally substituted with-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
x is ATZ10Z11Z12ANFZ16VHSSNNFGZ25Z26LPZ29TNVGZ34(SEQ ID NO:54) or VLGRLSQELHRLQTYPRTNTGS (SEQ ID NO: 55);
Z29is P or K, wherein-amine of said K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z34is S or K, wherein-amine of K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
and pharmaceutically acceptable salts thereof.
3. The compound of claim 1, wherein:
Z16is L;
Z25is P or K, wherein-amine of said K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 Substitution, wherein the mAbOptionally substituted onto a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z26is I or K, wherein-amine of said K is optionally substituted with-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z29is P or K, wherein-amine of said K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z34is S or K, wherein-amine of K is optionally substituted by-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is optionally substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
and pharmaceutically acceptable salts thereof.
5. A compound according to claim 3, wherein:
Z11is R or K, wherein-amine of K is-C (═ NH) NH2Substitution;
Z25is P or K, wherein-amine of said K is-C (═ O) CH3Or(ii) substitution, wherein the mAb is substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z26is I or K, wherein-amine of said K is-C (═ O) CH3、-C(O)CH2CH=CH2、 (ii) substitution, wherein the mAb is substituted to a second compound of formula I by another thioether bond such that there are two identical compounds of formula I on the mAb;
Z29is P or K, wherein-amine of said K is-C (═ O) CH3Substitution;
Z34is S or K, wherein-amine of said K is-C (═ O) CH3Substitution;
and pharmaceutically acceptable salts thereof.
9. The compound of claim 1, wherein the compound is selected from SEQ ID NOs 4-42, or a pharmaceutically acceptable salt thereof.
10. A pharmaceutical composition comprising a compound according to any one of claims 1 to 9 and a pharmaceutically acceptable carrier.
11. A method for treating or preventing a disease or disorder in a subject in need thereof, wherein the disease or disorder is selected from the group consisting of: obesity, type I or type II diabetes, metabolic syndrome, insulin resistance, impaired glucose tolerance, hyperglycemia, hyperinsulinemia, hypertriglyceridemia, hypoglycemia due to Congenital Hyperinsulinemia (CHI), dyslipidemia, atherosclerosis, diabetic nephropathy, and other cardiovascular risk factors such as hypertension and cardiovascular risk factors associated with unmanaged cholesterol and/or lipid levels, osteoporosis, inflammation, non-alcoholic fatty liver disease (NAFLD), non-alcoholic steatohepatitis (NASH), kidney disease, and eczema, comprising administering to a subject in need thereof an effective amount of a pharmaceutical composition according to claim 10.
12. A method of reducing food intake in a subject in need thereof, the method comprising administering to a subject in need thereof an effective amount of the pharmaceutical composition of claim 10.
13. A method of modulating amylin receptor activity in a subject in need thereof comprising administering to a subject in need thereof an effective amount of the pharmaceutical composition of claim 10.
14. The method according to claim 13 wherein the amylin receptor comprises AMY1R, and/or AMY2R and/or AMY 3R.
15. The method according to claim 14 wherein the amylin receptor is AMY 1R.
16. The method according to claim 14 wherein the amylin receptor is AMY 3R.
17. The method of any one of claims 11 to 14, wherein the pharmaceutical composition is administered via injection.
18. The method of any one of claims 11-16, wherein the pharmaceutical composition is administered in combination with at least one antidiabetic agent.
19. The method of claim 18, wherein the anti-diabetic agent is a glucagon-like peptide-1 receptor modulator.
20. The method of claim 18, wherein the pharmaceutical composition is administered in combination with liraglutide.
21. A kit comprising the conjugate according to any one of claims 1 to 8, preferably further comprising liraglutide and a device for injection.
22. A process for preparing a pharmaceutical composition according to claim 10.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201862662492P | 2018-04-25 | 2018-04-25 | |
US62/662492 | 2018-04-25 | ||
PCT/IB2019/053194 WO2019207427A2 (en) | 2018-04-25 | 2019-04-17 | Thioether cyclic peptide amylin receptor modulators |
Publications (1)
Publication Number | Publication Date |
---|---|
CN112074289A true CN112074289A (en) | 2020-12-11 |
Family
ID=68293854
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201980027903.XA Pending CN112074289A (en) | 2018-04-25 | 2019-04-17 | Thioether cyclic peptide amylin receptor modulators |
Country Status (5)
Country | Link |
---|---|
EP (1) | EP3784265A4 (en) |
JP (1) | JP2021522231A (en) |
CN (1) | CN112074289A (en) |
CA (1) | CA3097812A1 (en) |
WO (1) | WO2019207427A2 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN114057862A (en) * | 2021-12-14 | 2022-02-18 | 安徽省国平药业有限公司 | Synthetic method of GLP-1(1-37) polypeptide |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP4281464A1 (en) | 2021-01-20 | 2023-11-29 | Viking Therapeutics, Inc. | Compositions and methods for the treatment of metabolic and liver disorders |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050197287A1 (en) * | 2004-03-04 | 2005-09-08 | Mack Christine M. | Methods for affecting body composition |
US20100222269A1 (en) * | 2007-09-11 | 2010-09-02 | Novo Nordisk A/S | Improved derivatives of amylin |
WO2013059336A1 (en) * | 2011-10-18 | 2013-04-25 | Amylin Pharmaceuticals, Llc | Amylin-calcitonin chimeric peptides conjugated to duration enchancing moieties |
CN103826655A (en) * | 2011-05-25 | 2014-05-28 | 安米林药品有限责任公司 | Amylin peptides and derivatives and uses thereof |
WO2015040182A2 (en) * | 2013-09-19 | 2015-03-26 | Zealand Pharma A/S | Amylin analogues |
Family Cites Families (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7101853B2 (en) * | 1997-05-06 | 2006-09-05 | Amylin Pharmaceuticals, Inc. | Method for treating or preventing gastritis using amylin or amylin agonists |
JP5252435B2 (en) * | 2006-03-15 | 2013-07-31 | ノボ・ノルデイスク・エー/エス | Amylin derivatives |
US8957021B2 (en) * | 2009-02-03 | 2015-02-17 | Amunix Operating Inc. | Glucose-regulating polypeptides and methods of making and using same |
WO2011050008A2 (en) * | 2009-10-19 | 2011-04-28 | Amylin Pharmaceuticals, Inc. | Combination therapy comprising administration of an amylinomimetic and a pyy peptidomimetic for effecting weight loss and for treating obesity and related metabolic conditions and disorders |
WO2011084808A2 (en) * | 2009-12-21 | 2011-07-14 | Amunix Operating Inc. | Bifunctional polypeptide compositions and methods for treatment of metabolic and cardiovascular diseases |
US9683018B2 (en) * | 2013-07-25 | 2017-06-20 | Novartis Ag | Disulfide cyclic polypeptides for the treatment of heart failure |
RU2736637C9 (en) * | 2014-07-17 | 2021-02-08 | Протагонист Терепьютикс, Инк. | Peptidic interleukin-23 receptor inhibitors for oral administration and use thereof for treating inflammatory intestinal diseases |
AU2016343775B2 (en) * | 2015-10-28 | 2021-07-29 | Tufts Medical Center | Novel polypeptides with improved proteolytic stability, and methods of preparing and using same |
-
2019
- 2019-04-17 CA CA3097812A patent/CA3097812A1/en active Pending
- 2019-04-17 CN CN201980027903.XA patent/CN112074289A/en active Pending
- 2019-04-17 EP EP19791705.7A patent/EP3784265A4/en not_active Withdrawn
- 2019-04-17 JP JP2020558904A patent/JP2021522231A/en active Pending
- 2019-04-17 WO PCT/IB2019/053194 patent/WO2019207427A2/en unknown
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050197287A1 (en) * | 2004-03-04 | 2005-09-08 | Mack Christine M. | Methods for affecting body composition |
US20100222269A1 (en) * | 2007-09-11 | 2010-09-02 | Novo Nordisk A/S | Improved derivatives of amylin |
CN103826655A (en) * | 2011-05-25 | 2014-05-28 | 安米林药品有限责任公司 | Amylin peptides and derivatives and uses thereof |
WO2013059336A1 (en) * | 2011-10-18 | 2013-04-25 | Amylin Pharmaceuticals, Llc | Amylin-calcitonin chimeric peptides conjugated to duration enchancing moieties |
WO2015040182A2 (en) * | 2013-09-19 | 2015-03-26 | Zealand Pharma A/S | Amylin analogues |
Non-Patent Citations (1)
Title |
---|
阮园: "胰淀素类似物普兰克林治疗糖尿病的研究进展", 国外医学内科学分册, vol. 32, no. 12, pages 507 - 509 * |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN114057862A (en) * | 2021-12-14 | 2022-02-18 | 安徽省国平药业有限公司 | Synthetic method of GLP-1(1-37) polypeptide |
Also Published As
Publication number | Publication date |
---|---|
WO2019207427A2 (en) | 2019-10-31 |
CA3097812A1 (en) | 2019-10-31 |
WO2019207427A3 (en) | 2020-01-02 |
EP3784265A2 (en) | 2021-03-03 |
EP3784265A4 (en) | 2022-06-22 |
JP2021522231A (en) | 2021-08-30 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
JP7387431B2 (en) | Antibody-binding cyclic peptide tyrosine tyrosine compounds as modulators of neuropeptide Y receptors | |
CN112074289A (en) | Thioether cyclic peptide amylin receptor modulators | |
EA044997B1 (en) | ANTIBODY CONJUGATE BONDED TO A CYCLIC PEPTIDE, PHARMACEUTICAL COMPOSITION AND KIT CONTAINING THE CONJUGATE, METHODS FOR THEIR PREPARATION AND APPLICATION |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination |