CN111686248B - Medicine for treating cancer - Google Patents
Medicine for treating cancer Download PDFInfo
- Publication number
- CN111686248B CN111686248B CN202010481023.4A CN202010481023A CN111686248B CN 111686248 B CN111686248 B CN 111686248B CN 202010481023 A CN202010481023 A CN 202010481023A CN 111686248 B CN111686248 B CN 111686248B
- Authority
- CN
- China
- Prior art keywords
- hsp70
- cells
- methylation
- arginine
- prmt1
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 44
- 201000011510 cancer Diseases 0.000 title claims abstract description 34
- 239000003814 drug Substances 0.000 title claims abstract description 24
- 229940079593 drug Drugs 0.000 title claims description 9
- 230000011987 methylation Effects 0.000 claims abstract description 42
- 238000007069 methylation reaction Methods 0.000 claims abstract description 42
- 101000839464 Leishmania braziliensis Heat shock 70 kDa protein Proteins 0.000 claims abstract description 13
- 101710178376 Heat shock 70 kDa protein Proteins 0.000 claims abstract description 8
- 108010004889 Heat-Shock Proteins Proteins 0.000 claims abstract description 8
- 102000002812 Heat-Shock Proteins Human genes 0.000 claims abstract description 8
- 101710163595 Chaperone protein DnaK Proteins 0.000 claims abstract 7
- 101710152018 Heat shock cognate 70 kDa protein Proteins 0.000 claims abstract 7
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 32
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 claims description 25
- 239000004475 Arginine Substances 0.000 claims description 24
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 claims description 24
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 23
- 229920001184 polypeptide Polymers 0.000 claims description 20
- 239000012634 fragment Substances 0.000 claims description 17
- 108010033276 Peptide Fragments Proteins 0.000 claims description 5
- 102000007079 Peptide Fragments Human genes 0.000 claims description 5
- 101000757216 Homo sapiens Protein arginine N-methyltransferase 1 Proteins 0.000 abstract description 56
- 102100022985 Protein arginine N-methyltransferase 1 Human genes 0.000 abstract description 54
- 230000014509 gene expression Effects 0.000 abstract description 29
- 238000011282 treatment Methods 0.000 abstract description 25
- 230000002018 overexpression Effects 0.000 abstract description 15
- 230000000694 effects Effects 0.000 abstract description 14
- 230000006907 apoptotic process Effects 0.000 abstract description 13
- 239000003112 inhibitor Substances 0.000 abstract description 11
- 101100216105 Caenorhabditis elegans prmt-1 gene Proteins 0.000 abstract description 10
- 230000027455 binding Effects 0.000 abstract description 10
- 230000001965 increasing effect Effects 0.000 abstract description 10
- 150000003384 small molecules Chemical class 0.000 abstract description 9
- 108020005176 AU Rich Elements Proteins 0.000 abstract description 6
- 230000006217 arginine-methylation Effects 0.000 abstract description 6
- 230000004083 survival effect Effects 0.000 abstract description 6
- 108010090931 Proto-Oncogene Proteins c-bcl-2 Proteins 0.000 abstract description 5
- 102000013535 Proto-Oncogene Proteins c-bcl-2 Human genes 0.000 abstract description 5
- 108091036066 Three prime untranslated region Proteins 0.000 abstract description 5
- 230000036210 malignancy Effects 0.000 abstract description 3
- 230000001404 mediated effect Effects 0.000 abstract description 3
- 230000004637 cellular stress Effects 0.000 abstract 1
- 230000002708 enhancing effect Effects 0.000 abstract 1
- 230000000079 pharmacotherapeutic effect Effects 0.000 abstract 1
- 238000004393 prognosis Methods 0.000 abstract 1
- 238000011160 research Methods 0.000 abstract 1
- 101001037759 Homo sapiens Heat shock 70 kDa protein 1A Proteins 0.000 description 131
- 210000004027 cell Anatomy 0.000 description 122
- 102100040352 Heat shock 70 kDa protein 1A Human genes 0.000 description 117
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 27
- 238000002474 experimental method Methods 0.000 description 26
- 229960005277 gemcitabine Drugs 0.000 description 26
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 25
- 101000971171 Homo sapiens Apoptosis regulator Bcl-2 Proteins 0.000 description 25
- 235000009697 arginine Nutrition 0.000 description 23
- 108020004999 messenger RNA Proteins 0.000 description 17
- 108090000623 proteins and genes Proteins 0.000 description 17
- 238000000034 method Methods 0.000 description 16
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 15
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 15
- 201000002528 pancreatic cancer Diseases 0.000 description 15
- 208000008443 pancreatic carcinoma Diseases 0.000 description 15
- 102000004169 proteins and genes Human genes 0.000 description 14
- 108020004414 DNA Proteins 0.000 description 13
- 239000013612 plasmid Substances 0.000 description 13
- 235000018102 proteins Nutrition 0.000 description 13
- 210000004881 tumor cell Anatomy 0.000 description 13
- 239000013598 vector Substances 0.000 description 12
- 201000008129 pancreatic ductal adenocarcinoma Diseases 0.000 description 11
- 238000003151 transfection method Methods 0.000 description 10
- 101000808011 Homo sapiens Vascular endothelial growth factor A Proteins 0.000 description 9
- 108020004459 Small interfering RNA Proteins 0.000 description 9
- 102100039037 Vascular endothelial growth factor A Human genes 0.000 description 9
- 230000009545 invasion Effects 0.000 description 9
- 230000005012 migration Effects 0.000 description 9
- 238000013508 migration Methods 0.000 description 9
- IZTQOLKUZKXIRV-YRVFCXMDSA-N sincalide Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](N)CC(O)=O)C1=CC=C(OS(O)(=O)=O)C=C1 IZTQOLKUZKXIRV-YRVFCXMDSA-N 0.000 description 9
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 8
- 241000699666 Mus <mouse, genus> Species 0.000 description 8
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 8
- 230000005764 inhibitory process Effects 0.000 description 8
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 7
- 230000010261 cell growth Effects 0.000 description 7
- 238000005516 engineering process Methods 0.000 description 7
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 7
- 238000001114 immunoprecipitation Methods 0.000 description 7
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 6
- 108020005345 3' Untranslated Regions Proteins 0.000 description 6
- 102000004389 Ribonucleoproteins Human genes 0.000 description 6
- 108010081734 Ribonucleoproteins Proteins 0.000 description 6
- MEFKEPWMEQBLKI-AIRLBKTGSA-N S-adenosyl-L-methioninate Chemical compound O[C@@H]1[C@H](O)[C@@H](C[S+](CC[C@H](N)C([O-])=O)C)O[C@H]1N1C2=NC=NC(N)=C2N=C1 MEFKEPWMEQBLKI-AIRLBKTGSA-N 0.000 description 6
- 229960001570 ademetionine Drugs 0.000 description 6
- 230000002441 reversible effect Effects 0.000 description 6
- 238000001890 transfection Methods 0.000 description 6
- 238000001262 western blot Methods 0.000 description 6
- 101800005151 Cholecystokinin-8 Proteins 0.000 description 5
- 102400000888 Cholecystokinin-8 Human genes 0.000 description 5
- 206010059866 Drug resistance Diseases 0.000 description 5
- 241000699670 Mus sp. Species 0.000 description 5
- 230000000903 blocking effect Effects 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 108010077435 glycyl-phenylalanyl-glycine Proteins 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 239000000203 mixture Substances 0.000 description 5
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 4
- 102000004039 Caspase-9 Human genes 0.000 description 4
- 108090000566 Caspase-9 Proteins 0.000 description 4
- 108010092160 Dactinomycin Proteins 0.000 description 4
- 108010006519 Molecular Chaperones Proteins 0.000 description 4
- 208000008900 Pancreatic Ductal Carcinoma Diseases 0.000 description 4
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 4
- 235000001014 amino acid Nutrition 0.000 description 4
- 150000001413 amino acids Chemical class 0.000 description 4
- 238000010609 cell counting kit-8 assay Methods 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 230000000875 corresponding effect Effects 0.000 description 4
- 238000012258 culturing Methods 0.000 description 4
- 229960000640 dactinomycin Drugs 0.000 description 4
- 230000002950 deficient Effects 0.000 description 4
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 4
- 229960005420 etoposide Drugs 0.000 description 4
- 239000013604 expression vector Substances 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 239000013641 positive control Substances 0.000 description 4
- 230000035755 proliferation Effects 0.000 description 4
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 230000035882 stress Effects 0.000 description 4
- 102100022900 Actin, cytoplasmic 1 Human genes 0.000 description 3
- 108010085238 Actins Proteins 0.000 description 3
- 206010052747 Adenocarcinoma pancreas Diseases 0.000 description 3
- NAXPHWZXEXNDIW-JTQLQIEISA-N Phe-Gly-Gly Chemical compound OC(=O)CNC(=O)CNC(=O)[C@@H](N)CC1=CC=CC=C1 NAXPHWZXEXNDIW-JTQLQIEISA-N 0.000 description 3
- 229940123896 Protein arginine methyltransferase inhibitor Drugs 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010087230 Sincalide Proteins 0.000 description 3
- 230000002424 anti-apoptotic effect Effects 0.000 description 3
- 150000001484 arginines Chemical class 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 235000020958 biotin Nutrition 0.000 description 3
- 239000011616 biotin Substances 0.000 description 3
- 229960002685 biotin Drugs 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 229910002092 carbon dioxide Inorganic materials 0.000 description 3
- 230000004709 cell invasion Effects 0.000 description 3
- 230000003833 cell viability Effects 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- 239000012091 fetal bovine serum Substances 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 201000002094 pancreatic adenocarcinoma Diseases 0.000 description 3
- 238000001959 radiotherapy Methods 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 230000003442 weekly effect Effects 0.000 description 3
- 229920000936 Agarose Polymers 0.000 description 2
- HNXWVVHIGTZTBO-LKXGYXEUSA-N Asn-Ser-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O HNXWVVHIGTZTBO-LKXGYXEUSA-N 0.000 description 2
- UQBGYPFHWFZMCD-ZLUOBGJFSA-N Asp-Asn-Asn Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O UQBGYPFHWFZMCD-ZLUOBGJFSA-N 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 108091033409 CRISPR Proteins 0.000 description 2
- 238000010354 CRISPR gene editing Methods 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- 102100021451 Endoplasmic reticulum chaperone BiP Human genes 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- YRHZWVKUFWCEPW-GLLZPBPUSA-N Gln-Thr-Gln Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)N)N)O YRHZWVKUFWCEPW-GLLZPBPUSA-N 0.000 description 2
- IGOYNRWLWHWAQO-JTQLQIEISA-N Gly-Phe-Gly Chemical compound OC(=O)CNC(=O)[C@@H](NC(=O)CN)CC1=CC=CC=C1 IGOYNRWLWHWAQO-JTQLQIEISA-N 0.000 description 2
- MUGLKCQHTUFLGF-WPRPVWTQSA-N Gly-Val-Met Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)CN MUGLKCQHTUFLGF-WPRPVWTQSA-N 0.000 description 2
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 2
- 102100027421 Heat shock cognate 71 kDa protein Human genes 0.000 description 2
- KTNGVMMGIQWIDV-OSUNSFLBSA-N Ile-Pro-Thr Chemical compound CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(O)=O KTNGVMMGIQWIDV-OSUNSFLBSA-N 0.000 description 2
- YOKVEHGYYQEQOP-QWRGUYRKSA-N Leu-Leu-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O YOKVEHGYYQEQOP-QWRGUYRKSA-N 0.000 description 2
- RGUXWMDNCPMQFB-YUMQZZPRSA-N Leu-Ser-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O RGUXWMDNCPMQFB-YUMQZZPRSA-N 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- IHRFZLQEQVHXFA-RHYQMDGZSA-N Met-Thr-Lys Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCCCN IHRFZLQEQVHXFA-RHYQMDGZSA-N 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 102000005431 Molecular Chaperones Human genes 0.000 description 2
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 2
- 108010079364 N-glycylalanine Proteins 0.000 description 2
- 239000012124 Opti-MEM Substances 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- KDBHVPXBQADZKY-GUBZILKMSA-N Pro-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 KDBHVPXBQADZKY-GUBZILKMSA-N 0.000 description 2
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 2
- 108020004518 RNA Probes Proteins 0.000 description 2
- 239000003391 RNA probe Substances 0.000 description 2
- 230000004570 RNA-binding Effects 0.000 description 2
- 238000011530 RNeasy Mini Kit Methods 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 102100022760 Stress-70 protein, mitochondrial Human genes 0.000 description 2
- BSNZTJXVDOINSR-JXUBOQSCSA-N Thr-Ala-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O BSNZTJXVDOINSR-JXUBOQSCSA-N 0.000 description 2
- 102000004243 Tubulin Human genes 0.000 description 2
- 108090000704 Tubulin Proteins 0.000 description 2
- 239000002250 absorbent Substances 0.000 description 2
- 230000002745 absorbent Effects 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 239000001569 carbon dioxide Substances 0.000 description 2
- 239000006143 cell culture medium Substances 0.000 description 2
- 230000030833 cell death Effects 0.000 description 2
- 239000013592 cell lysate Substances 0.000 description 2
- 230000012292 cell migration Effects 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 230000003828 downregulation Effects 0.000 description 2
- 238000001378 electrochemiluminescence detection Methods 0.000 description 2
- 230000007946 glucose deprivation Effects 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 102000052786 human PRMT1 Human genes 0.000 description 2
- 238000005567 liquid scintillation counting Methods 0.000 description 2
- 239000012139 lysis buffer Substances 0.000 description 2
- 108010003700 lysyl aspartic acid Proteins 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 230000036542 oxidative stress Effects 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 2
- 108010093296 prolyl-prolyl-alanine Proteins 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 229950010131 puromycin Drugs 0.000 description 2
- 239000000523 sample Substances 0.000 description 2
- 238000005070 sampling Methods 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 230000008961 swelling Effects 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 230000029663 wound healing Effects 0.000 description 2
- 101150028074 2 gene Proteins 0.000 description 1
- HXUVTXPOZRFMOY-NSHDSACASA-N 2-[[(2s)-2-[[2-[(2-aminoacetyl)amino]acetyl]amino]-3-phenylpropanoyl]amino]acetic acid Chemical compound NCC(=O)NCC(=O)N[C@H](C(=O)NCC(O)=O)CC1=CC=CC=C1 HXUVTXPOZRFMOY-NSHDSACASA-N 0.000 description 1
- WOJJIRYPFAZEPF-YFKPBYRVSA-N 2-[[(2s)-2-[[2-[(2-azaniumylacetyl)amino]acetyl]amino]propanoyl]amino]acetate Chemical compound OC(=O)CNC(=O)[C@H](C)NC(=O)CNC(=O)CN WOJJIRYPFAZEPF-YFKPBYRVSA-N 0.000 description 1
- SHRCVZJKZJGIHQ-UHFFFAOYSA-N 2-chloro-n-[4-[4-[(2-chloroacetyl)amino]phenyl]sulfonylphenyl]acetamide Chemical compound C1=CC(NC(=O)CCl)=CC=C1S(=O)(=O)C1=CC=C(NC(=O)CCl)C=C1 SHRCVZJKZJGIHQ-UHFFFAOYSA-N 0.000 description 1
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 1
- VGPWRRFOPXVGOH-BYPYZUCNSA-N Ala-Gly-Gly Chemical compound C[C@H](N)C(=O)NCC(=O)NCC(O)=O VGPWRRFOPXVGOH-BYPYZUCNSA-N 0.000 description 1
- CNQAFFMNJIQYGX-DRZSPHRISA-N Ala-Phe-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CC1=CC=CC=C1 CNQAFFMNJIQYGX-DRZSPHRISA-N 0.000 description 1
- 102100026882 Alpha-synuclein Human genes 0.000 description 1
- 102000000412 Annexin Human genes 0.000 description 1
- 108050008874 Annexin Proteins 0.000 description 1
- DPLFNLDACGGBAK-KKUMJFAQSA-N Arg-Phe-Glu Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N DPLFNLDACGGBAK-KKUMJFAQSA-N 0.000 description 1
- 101150076489 B gene Proteins 0.000 description 1
- 238000011740 C57BL/6 mouse Methods 0.000 description 1
- 101100298998 Caenorhabditis elegans pbs-3 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 108700041152 Endoplasmic Reticulum Chaperone BiP Proteins 0.000 description 1
- 102100032863 General transcription factor IIH subunit 3 Human genes 0.000 description 1
- RJIVPOXLQFJRTG-LURJTMIESA-N Gly-Arg-Gly Chemical compound OC(=O)CNC(=O)[C@@H](NC(=O)CN)CCCN=C(N)N RJIVPOXLQFJRTG-LURJTMIESA-N 0.000 description 1
- HQRHFUYMGCHHJS-LURJTMIESA-N Gly-Gly-Arg Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CCCN=C(N)N HQRHFUYMGCHHJS-LURJTMIESA-N 0.000 description 1
- 108010036652 HSC70 Heat-Shock Proteins Proteins 0.000 description 1
- 101150112743 HSPA5 gene Proteins 0.000 description 1
- 102100025210 Histone-arginine methyltransferase CARM1 Human genes 0.000 description 1
- 108010033040 Histones Proteins 0.000 description 1
- 101000666405 Homo sapiens General transcription factor IIH subunit 1 Proteins 0.000 description 1
- 101000655398 Homo sapiens General transcription factor IIH subunit 2 Proteins 0.000 description 1
- 101000655391 Homo sapiens General transcription factor IIH subunit 3 Proteins 0.000 description 1
- 101000655406 Homo sapiens General transcription factor IIH subunit 4 Proteins 0.000 description 1
- 101000655402 Homo sapiens General transcription factor IIH subunit 5 Proteins 0.000 description 1
- 101100339687 Homo sapiens HSPA1A gene Proteins 0.000 description 1
- 101001080568 Homo sapiens Heat shock cognate 71 kDa protein Proteins 0.000 description 1
- 101000903318 Homo sapiens Stress-70 protein, mitochondrial Proteins 0.000 description 1
- UIEZQYNXCYHMQS-BJDJZHNGSA-N Ile-Lys-Ala Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)O)N UIEZQYNXCYHMQS-BJDJZHNGSA-N 0.000 description 1
- NZGTYCMLUGYMCV-XUXIUFHCSA-N Ile-Lys-Arg Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N NZGTYCMLUGYMCV-XUXIUFHCSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 101710164556 Luminal-binding protein Proteins 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 239000013614 RNA sample Substances 0.000 description 1
- 238000011529 RT qPCR Methods 0.000 description 1
- 101100216112 Rattus norvegicus Prmt1 gene Proteins 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 101710111177 Stress-70 protein, mitochondrial Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 101150063416 add gene Proteins 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 108090000185 alpha-Synuclein Proteins 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 230000005775 apoptotic pathway Effects 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 238000011717 athymic nude mouse Methods 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 239000012148 binding buffer Substances 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 230000005773 cancer-related death Effects 0.000 description 1
- 101150038500 cas9 gene Proteins 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 108010030886 coactivator-associated arginine methyltransferase 1 Proteins 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 238000011393 cytotoxic chemotherapy Methods 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 238000000354 decomposition reaction Methods 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 230000017858 demethylation Effects 0.000 description 1
- 238000010520 demethylation reaction Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 1
- 239000003684 drug solvent Substances 0.000 description 1
- YQGOJNYOYNNSMM-UHFFFAOYSA-N eosin Chemical compound [Na+].OC(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C(O)=C(Br)C=C21 YQGOJNYOYNNSMM-UHFFFAOYSA-N 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 229960005144 gemcitabine hydrochloride Drugs 0.000 description 1
- 238000012224 gene deletion Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 108010062266 glycyl-glycyl-argininal Proteins 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- ZRALSGWEFCBTJO-UHFFFAOYSA-N guanidine group Chemical group NC(=N)N ZRALSGWEFCBTJO-UHFFFAOYSA-N 0.000 description 1
- 102000051104 human HSPA1A Human genes 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 125000003588 lysine group Chemical class [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 230000017538 malonylation Effects 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 125000001570 methylene group Chemical group [H]C([H])([*:1])[*:2] 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000003032 molecular docking Methods 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 238000010899 nucleation Methods 0.000 description 1
- 238000011580 nude mouse model Methods 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- 238000001543 one-way ANOVA Methods 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 238000012809 post-inoculation Methods 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000000861 pro-apoptotic effect Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000009993 protective function Effects 0.000 description 1
- 230000012846 protein folding Effects 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 108010079850 retinoic acid receptor beta Proteins 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 239000003161 ribonuclease inhibitor Substances 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000006748 scratching Methods 0.000 description 1
- 230000002393 scratching effect Effects 0.000 description 1
- 238000007789 sealing Methods 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 229940054269 sodium pyruvate Drugs 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 238000011277 treatment modality Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 230000004565 tumor cell growth Effects 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- 150000003722 vitamin derivatives Chemical class 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000012130 whole-cell lysate Substances 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Organic Chemistry (AREA)
- Public Health (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Genetics & Genomics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- General Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Endocrinology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
The invention discloses a medicine for treating cancer. The invention finds that the expression of PRMT1 is obviously increased in cancer tissues relative to normal tissues, is directly related to the malignancy degree of tumors and worse prognosis, and researches on the PRMT 1-mediated methylation of HSP70 and the influence and the fundamental mechanism of the methylation on the treatment effect of cancer cells are carried out. The invention finds that the overexpression of PRMT1 increases the arginine methylation of HSP 70. Its methylation protects cancer cells from apoptosis caused by various cellular stress and treatment by enhancing binding of AU-rich elements in HSP70 and BCL-2mRNA 3' -UTR and increasing BCL-2mRNA stability, and correspondingly increasing BCL-2 protein expression. The pharmacotherapeutic antibody and the small molecule inhibitor provided by the invention can block the arginine methylation site of the heat shock protein, and can reduce the survival capability of cancer cells and increase the treatment effect.
Description
Technical Field
The invention relates to the technical field of medicaments, in particular to a medicament for treating cancer.
Background
In clinical practice, the inherent and acquired resistance or tolerance of malignancies to treatment modalities is a key challenge, resulting in existing treatment strategies with little impact on overall survival. Alterations in the balance of pro-apoptotic and anti-apoptotic signals within cancer cells are associated with therapeutic resistance, cancer progression and metastasis, which are major causes of cancer-related death.
70kDa heat shock protein (HSP70s) is an evolutionarily conserved family of proteins, ATP-dependent chaperones. HSP70 is encoded by the HSPA gene family, with 13 HSP70 family members in mammals. HSP70 is a major member of this family and plays a key role in promoting cell survival under a variety of stress conditions, including cytotoxic chemotherapy. HSP70 is a classical chaperone protein with highly conserved domains that facilitate protein folding. It is directly combined with several important proteins, and these proteins are involved in endogenous and exogenous apoptosis pathways, so that it can inhibit cell death and provide survival advantage for tumor cell. In addition to its typical function as a chaperone, HSP70 has RNA binding capability and can bind to and stabilize specific mRNA molecules containing AU-rich elements (AREs) in the 3 '-untranslated region (3' -UTR). HSP70 RNA binding activity is independent of its chaperone function.
The function of HSP70 is regulated by a variety of post-translational modifications, such as phosphorylation, acetylation, malonylation, ubiquitination, and methylation. For the first time, it was found that methylation of the HSP70 protein is the conserved K561 residue, and 3 methylation of this lysine residue alters the affinity for α -synuclein. Recently, it has been shown in the literature that CARM1/PRMT 4-mediated methylation of R469 affects the binding of HSP70 and TFIIH, and thus the activation of RAR beta 2 gene.
Disclosure of Invention
In order to overcome the defects in the prior art, the invention aims to provide a medicament for treating cancer.
The invention aims to provide a medicament for inhibiting the proliferation, invasion and migration of malignant tumors aiming at poor curative effect of the malignant tumors. The invention aims to provide a medicament containing an arginine methylated heat shock protein HSP70 antibody or a small molecule inhibitor aiming at the inherent or acquired resistance or tolerance of malignant tumor to a treatment mode, so as to inhibit the resistance or tolerance of malignant tumor to treatment and improve the curative effect.
The medicine provided by the invention can reduce the binding affinity of heat shock protein and BCL-2mRNA 3' -UTR, reduce the stability of BCL-2mRNA, reduce the amount of BCL-2 protein in tumor cells, improve the sensitivity of the tumor cells to chemotherapy or radiotherapy and ensure that the tumor cells are subjected to apoptosis.
The purpose of the invention is realized by at least one of the following technical solutions.
The invention provides a medicine for treating cancer, which comprises an antibody of arginine methylated heat shock protein HSP70, a polypeptide fragment of arginine methylated heat shock protein HSP70 or a small molecule inhibitor of arginine methylated heat shock protein HSP 70.
Further, the antibody of the arginine methylated heat shock protein HSP70 is an antibody blocking arginine methylated or unmethylated amino acid residues of the heat shock protein.
Further, the antibody of the arginine methylated heat shock protein HSP70 is an antibody blocking the 416 th and 447 th arginine residues of HSP 70.
Further, the small molecule inhibitor of the arginine methylated heat shock protein HSP70 is a small molecule inhibiting methylated or unmethylated arginine residues of heat shock proteins. The small molecule inhibitor is a natural or artificially designed small molecule
Further, the polypeptide fragment of the arginine methylated heat shock protein HSP70 is a polypeptide fragment containing the 416 th arginine residue of human HSP70, a polypeptide fragment containing the 447 th arginine residue of human HSP70 or a combination of the two.
The sequence of the polypeptide fragment of the 416 th arginine residue (R416) of the arginine methylated heat shock protein HSP70 is GGVMTALIKRNSTIPTKQTQ; the sequence of the polypeptide fragment of the 447 th arginine residue (R447) of the arginine methylated heat shock protein HSP70 is GVLIQVYEGERAMTKDNNLL. The combined polypeptide fragment has the sequence of GGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLL.
The heat shock protein HSP70 is a substrate of protein arginine methyltransferase 1(PRMT1), and PRMT1 catalyzes the methylation of heat shock protein HSP70 arginine. The sites of the PRMT1 catalyzing the methylation of the arginine of the heat shock protein HSP70 are arginine residues (R416 and R447) at positions 416 and 447.
The medicine for treating cancer provided by the invention can inhibit methylation of arginine residues (R416 and R447) at 416 th and 447 th sites of the HSP70, reduce the binding affinity of the HSP70 and BCL-2mRNA 3' -UTR, reduce the stability of the BCL-2mRNA, inhibit the proliferation, migration and invasion of malignant tumor cells and promote the apoptosis of the malignant tumor cells. The medicine provided by the invention can be used for inhibiting the resistance or tolerance of tumors to chemotherapeutic drugs and improving the curative effect of tumor treatment methods. The tumor treatment method comprises a treatment method such as gemcitabine and the like and radiation treatment.
The medicine provided by the invention can treat malignant tumors such as pancreatic duct adenocarcinoma, gastric cancer and the like, and can also treat inflammatory diseases such as Crohn's disease, ulcerative colitis and the like.
The invention discovers for the first time that the combination of HSP70 and RNA is directly related to the treatment tolerance of cancer cells and depends on the methylation of protein arginine of HSP 70. The findings of the present invention further reveal that inhibition of the PRMT1-HSP70-BCL-2 signaling axis can decrease cancer cell viability and increase therapeutic efficacy. Thus, targeted inhibition of this signaling axis represents a new therapeutic strategy and protocol for malignancy.
Compared with the prior art, the invention has the following advantages and beneficial effects:
the drug provided by the invention has the advantages that the arginine methylation heat shock protein HSP70 antibody and the small molecule inhibitor are used for sealing the arginine methylation site of the heat shock protein, so that the apoptosis of malignant tumor cells is promoted, and the proliferation, migration and invasion of the malignant tumor cells are inhibited; secondly, the medicine provided by the invention comprises an arginine methylated heat shock protein HSP70 antibody and a small molecule inhibitor, can be combined with a tumor treatment method, improves the sensitivity of malignant tumor cells to chemotherapy and radiotherapy, and solves the resistance or tolerance of the malignant tumor cells to radiotherapy and chemotherapy.
Drawings
FIG. 1-A is a graph showing the results of volume change over time in a mouse pancreatic ductal adenocarcinoma (pancreatic cancer) transplant tumor model;
FIG. 1-B is a graph showing the results of mass change over time in a mouse model of pancreatic ductal adenocarcinoma (pancreatic cancer) transplantable tumor;
FIG. 1-C is a graph of the results of wound healing and invasion experiments with the knockdown of PRMT1 in MDA28 cells with high expression of protein arginine methyltransferase 1(PRMT1) and the overexpression of PRMT1 in PANC-1 cells with low expression of PRMT 1;
FIG. 1-D is a graph of the quantitative results of the calculated cell migration and invasion capacities of cells by means of Transwell experiments and counting, in which PRMT1 was knocked down in MDA28 cells highly expressed in protein arginine methyltransferase 1(PRMT 1);
FIG. 1-E is a graph of the quantitative results of the calculated cell migration and invasion capacities of cells overexpressing PRMT1 in PANC-1 cells with low expression of protein arginine methyltransferase 1(PRMT1) by Transwell experiments and counting;
FIG. 2-A is a graph showing the results of PRMT1 methylated HSP 70;
FIG. 2-B is a graph showing the results of verifying whether the arginine residue of HSP70 is a PRMT1 methylation site;
FIG. 3-A is a graph showing the effect of methylation of two arginine residues R416 and R447 of HSP70 on BCL-2mRNA expression levels;
FIG. 3-B is a graph showing the results of increased expression of BCL-2 by recombinant Wild Type (WT) in HSP 70-deficient cells;
FIG. 3-C is a graph of the results of HSP70 methylation affecting the stability of BCL-2 mRNA;
FIG. 3-D is a graph showing the results of a ribonucleoprotein immunoprecipitation (RNP-IP) experiment in HSP70 knock-out MiaPaCa-2 cells;
FIG. 3-E is a graph of the results of quantifying FIG. 3-D using imaging software;
FIG. 3-F is a graph showing the results of a ribonucleoprotein immunoprecipitation (RNP-IP) experiment in HSP70 knockout HEK-293 cells;
FIG. 3-G is a graph showing the results of direct binding of HSP70 to AREs of BCL-2 mRNA;
FIG. 4-A is a graph showing the results of methylation of HSP70 to protect pancreatic cancer cells against Etoposide;
FIG. 4-B is a graph showing that methylation of HSP70 protects pancreatic cancer cells against oxidative stress (H)2O2) A graph of results of (1);
FIG. 4-C is a graph showing the results of HSP70 methylation in counterintuitive deficiency in pancreatic cancer cells;
FIG. 4-D is a graph of the results of wild-type HSP70 protecting cells from apoptosis, while hypomethylated HSP70 did not protect against stress-induced apoptosis;
FIG. 4-E is a graph showing the results of wild-type HSP70 inhibiting apoptosis;
FIG. 5-A is a graph of the results of experiments in which arginine methylation at specific sites affected HSP70 function in gemcitabine resistance;
FIG. 5-B is a graph of cell growth curves treated with different concentrations of gemcitabine after transfection of wild type HSP70 with a MiaPaCa-2 cell clone (KO-16) of a wild type HSP70 Knockout (KO);
FIG. 5-C is a plot of cell growth curves treated with different concentrations of gemcitabine after transfection of wild type HSP70 with a MiaPaCa-2 cell clone of wild type HSP70 Knockout (KO);
FIG. 5-D is a graph showing the results of over-expression of PRMT1 in FG cells;
FIG. 5-E is a graph showing the results of siRNA knockdown of PRMT1 in FG cells;
FIG. 5-F is a graph of the results of treatment of MiaPaCa-2 cells with DB75(5 μm), gemcitabine (20 μm), or a combination of the two for 48 hours;
FIG. 6-A is a graph showing the effect of resistance of a polypeptide fragment comprising human HSP70 arginine residue 416, 447 or a combination thereof to MiaPaCa-2 cells;
FIG. 6-B is a graph showing the effect of antibodies specifically blocking the 416 th and 447 th arginine residues of human HSP70 on the resistance of MiaPaCa-2 cells.
Detailed Description
The following examples are presented to further illustrate the practice of the invention, but the practice and protection of the invention is not limited thereto. It is noted that the processes described below, if not specifically described in detail, are all realizable or understandable by those skilled in the art with reference to the prior art. The reagents or apparatus used are not indicated to the manufacturer, and are considered to be conventional products available by commercial purchase.
All human pancreatic adenocarcinoma cell lines, HPNE cells and HEK293T cells were purchased from American Type Culture Collection, unless otherwise specified. MDA28 and MDA48 pancreatic adenocarcinoma cell lines were donated by professor pyrograph of MD anderson cancer center, texas university, usa. The generation of FG human pancreatic adenocarcinoma cell lines has been reported (Vezeridis et al, PMID 2296181). All cell lines were incubated at 37 ℃ in 5% CO2The single-layer adherent is added with 10% fetal calf serum, sodium pyruvate, non-essential amino acid, l-glutamine, penicillin/streptomycin and vitamin solution.
anti-PRMT 1(2449S) antibody was purchased from Cell Signaling Technology; anti-PRMT 5(07-405) antibody was purchased from EMD Millipore; anti-HA (TA100012) and anti-Myc (TA150121) antibodies were purchased from OriGene Technologies. anti-HSP 70 antibody (ADI-SPA-810) was purchased from enzor biosciences. Anti-HSC70(sc-7298), Anti-GRP78(sc-376768), Anti-GRP75(sc-13967), Anti-GST (sc-138), Anti- β -actin (sc-47778) and Anti-BCL-2(sc-7382) antibodies were purchased from Santa Cruz Biotechnology (Santa Cruz Biotechnology). Anti- α -tubulin (MABT205) and Anti-asymmetric dimethylarginine antibody, ASYM24, were purchased from EMD Millipore Corporation. Anti-asymmetric demethylation of histone H4R3 antibody was purchased from Active Motif. Specific targeting siRNA from SANTA Cruz or siRNA of PRMT1 (SiPRMT1) sequence 5'-GCCAACAAGUUAGACCACG-3', synthesized by Sigma-Aldrich; the siRNA (SiHSP70) sequence of HSP70 is 5'-CGGUGGUGCAGUCGGACAUGA-3'. Real-time PCR and reverse transcription PCR primers are shown in Table 1. PRMT 1-specific inhibitors DB75 and TC-E5003 were purchased from Tocris Bioscience, Inc. Etoposide and H2O2Purchased from Sigma-Aldrich. Gemcitabine hydrochloride was purchased from United States Pharmacopeia (USP).
Female athymic nude mice and C57BL/6 mice were purchased from Jackson laboratories. Mice were used at 8 weeks of age. All animals were housed in a university animal facility approved by the state-of-the-art laboratory animal care assessment and certification agency under current regulations and standards.
The first embodiment is as follows: mouse pancreatic ductal adenocarcinoma (pancreatic cancer) transplantable tumor experiments.
In xenograft tumor model, mouse pancreatic ductal adenocarcinoma (pancreatic cancer) cells (1 × 10)6) Resuspended in 0.1mL of Hank's buffer without calcium and magnesium and injected subcutaneously into the flanks of nude mice. The length and width of the tumor were measured twice weekly with calipers. The PRMT1 inhibitor DB75 was injected i.p. into mice twice a week for 3 weeks. The low dose is 5mg/kg and the high dose is 20 mg/kg. The vehicle solution was used as a control. Tumor-bearing mice were euthanized at designated time points either near death or post-inoculation, and tumors were excised and weighed. Swelling and swelling treating medicineTumor volume (mm)3) The calculation formula is that the short diameter is 2 multiplied by the long diameter/2.
The experimental results are shown in FIG. 1-A and FIG. 1-B. FIG. 1-A, which depicts a mouse pancreatic ductal adenocarcinoma (pancreatic cancer) transplant tumor model, mice receiving low (5mg/kg) and high (20mg/kg) protein arginine methyltransferase inhibitor DB75 treatment twice weekly, after 21 days experiment, tumor volume changes, Ctrl in FIG. 1-A representing a control group; low indicates Low dose group; high indicates the High dose group. FIG. 1-B, which depicts a mouse pancreatic ductal adenocarcinoma (pancreatic cancer) transplant tumor model, mice transplanted tumor weight twice weekly after 21 days experiment completion receiving low (5mg/kg) and high (20mg/kg) protein arginine methyltransferase inhibitor DB75 treatment. The measurement results of the morphology, the tumor volume and the tumor weight of the transplanted tumor show that the PRMT1 inhibitor DB75 can inhibit the growth of the tumor of a mouse, and the inhibition effect is positively correlated with the DB75 concentration.
Example two: migration and invasion experiments of human pancreatic ductal carcinoma cells.
Day before transfection, 5X 105MDA28 and PANC-1 cells were seeded in 6-well plates in 1.5mL of cell culture medium containing 10% FBS. The number of cells used for initial seeding was chosen so that cell confluence reached 70-90% within 24 hours. Add 100pmol siRNA (or 2. mu.g DNA) to 250. mu.l Opti-MEM and mix gently; mix lipofectamin2000 reagent well, dilute 5 μ l lipofectamin2000 with 250 μ l Opti-MEM, mix gently, stand 5 minutes at room temperature; mixing the diluted siRNA \ DNA and lipofectamin 2000; gently mix and leave at room temperature for 20 minutes to allow formation of siRNA/lipofectamin (or DNA/lipofectamin) complexes. Add 500. mu.l siRNA/lipofectamine (or DNA/lipofectamine) complexes to the wells of the corresponding plates containing cells and medium and gently shake the plate back and forth. Transferring SiPRMT1 into MDA28 cells, using siCtrl as a control, transferring pHA-PRMT1 into PANC-1 cells, using pcDNA3.1 as a control, performing cell scratching the cells the next day after transfection, washing the cells with PBS 3 times, adding 1ml of cell culture medium (10% fetal bovine serum plus 90% DMEM culture medium plus 1% penicillin streptomycin); the cells were cultured at 37 ℃ in 5% carbon dioxide for 12 hours and photographed. Scratch widths were measured at 0 and 12 hours。
30ug of Martrigel gel was applied to the Transwell chamber and 20 million of each of the above transfected MDA28 cells and PANC-1 cells were added and placed in culture; after culturing for 48 hours under the condition of 37 ℃ and 5% carbon dioxide, the filter membrane is fixed by ethanol, hematoxylin and eosin are stained, and the number of cells passing through Martrigel is counted by photographing and observing. The magnification is 200 times.
The results are shown in FIGS. 1-C, 1-D and 1-E. FIG. 1-C depicts the knockdown of PRMT1 in MDA28 cells with high expression of protein arginine methyltransferase 1(PRMT1), the overexpression of PRMT1 in PANC-1 cells with low expression of PRMT1, and the ability of cell invasion observed by wound healing and invasion experiments. FIG. 1-D depicts the quantitative results of the calculated ability of cells to migrate and invade by means of Transwell experiments and counting the knockdown of PRMT1 in MDA28 cells highly expressed in protein arginine methyltransferase 1(PRMT 1). FIGS. 1-E depict the quantification of the ability of cells to migrate and invade calculated by Transwell experiments and counting of overexpression of PRMT1 in PANC-1 cells with low expression of the protein arginine methyltransferase 1(PRMT 1). After the expression of PRMT1 is knocked down by siRNA, the migration and invasion capacity of human pancreatic ductal carcinoma cell MDA28 with high expression of PRMT1 is inhibited; after PRMT1 is over-expressed in human pancreatic ductal carcinoma cells PANC-1 with low expression of PRMT1, the migration and invasion capabilities of the cells are enhanced, which indicates that PRMT1 has the capability of promoting the invasion and migration of tumor cells.
Example three: immunoprecipitation experiments
Using the transfection method described in example two, the PRMT overexpression plasmid was transfected in mouse pancreatic ductal carcinoma cells, pcDNA3.1 as a negative control, and 36 hours after transfection, the culture was decanted and the flask was inverted over absorbent paper to blot the absorbent paper dry of the culture. 1ml of 4 ℃ pre-cooled PBS (0.01M pH7.2-7.3) was added to each well of cells. Cells were lysed with the addition of protease inhibitor Pierce IP lysis buffer (Thermo Fisher Scientific). The cell lysates were incubated with HSP70 antibody overnight (12 hours) on a rotator at 4 ℃. Protein A/G + agarose (Santa Cruz) was then added and incubated for a further 2 hours at 4 ℃. Followed by 4 washes with PBST plus protease inhibitor, followed by 2 XSDS-PAGEBoiling for 5 minutes, the protein complex is released from the agarose. The protein concentration of whole cell lysates was determined by Coomassie blue emission, adjusted to the same protein concentration for each sample and loaded uniformly, and standard Western blotting procedures were performed to detect methylated HSP70 protein using ASYM24 antibody and total HSP70 protein using HSP70 antibody. Use of PierceTMThe Enhanced Chemiluminescence (ECL) system detects protein bands. Quantifying the Western blot result by ImageJ software; the expression level of beta-Actin is standardized. Under a single blot, its ratio to internal control is expressed as a fold change in its expression.
The results are shown in FIG. 2-A. FIG. 2-A depicts that PRMT1 can methylate HSP 70. The methylation level of HSP70 was detected with an antibody specific for methylated arginine (ASYM24), and when PRMT1 was overexpressed in pancreatic cancer cells, the result showed that the methylation level of HSP70 was increased. By immunoprecipitation experiments, it was first demonstrated that PRMT1 and HSP70 are able to form a complex, and further that the level of methylation of HSP70 in the PRMT1/HSP70 complex is elevated. Indicating that PRMT1 is able to catalyze methylation of HSP 70.
Example four: in vitro methylation experiments.
Peptide fragments of R416, R447 and R458 of 19 amino acids in length and corresponding methylation site mutant peptides R416A, R447A and R458A were synthesized for methylation experiments in vitro. A mature peptide containing three GAR repeats (R3) was used as a positive control. The synthetic peptide or recombinant protein was mixed with 2. mu.g of PRMT1 recombinant protein (Origene Technologies), 2. mu. Ci3H-labeled S-adenosylmethionine (SAM) (Perkin Elmer) was added to 20. mu.l of methylation buffer (50mM Tris. HCl, pH8.0,150mM NaCl,1mM EDTA) for incubation, and the reaction was incubated at 30 ℃ for 3H. The reaction was measured by Liquid Scintillation Counting (LSC). A small circular nitrocellulose membrane was dropped on 10. mu.l of the mixture, rinsed three times with methylation buffer, then the membrane was air dried, immersed in ScintiVerse II Cocktail (Thermo Fisher Scientific), placed in a glass scintillation vial, and measured with a liquid scintillation counter (Beckman Coulter). Decomposition Per Minute (DPM) of each peptide was calculated as final DPM ═ DPM (wild type) -DPM (mutant).
The results are shown in FIG. 2-B. FIG. 2-B depicts the arginine residue of HSP70 as a PRMT1 methylation site. The invention synthesizes peptide segments of R416, R447 and R458 with the length of 19 amino acids and corresponding methylation site mutation peptides of R416A, R447A and R458A, and the peptide segments are used for in vitro methylation experiments. A mature peptide containing three GAR repeats (R3) was used as a positive control. When 3H-labeled S-adenosylmethionine (SAM) is added as a methyl donor, PRMT1 can methylate the R416 and R447 sites instead of the R458 site.
Example five: structural analysis of PRMT1/HSP70 complex protein
Since the crystal structure of human PRMT1 does not exist at present, the invention firstly establishes a homologous model of human PRMT1 and methyl donor SAM in a complex based on the crystal structure of rat PRMT1, and the model has high sequence consistency with human PRMT 1. The initial structure of HSP70 peptides comprising R416, R447 and R458 was taken from the PDB structure 4PO 2. Flexible protein peptide docking was performed using Z-dock and Cluspro2.0 webserver, and the optimal pose was retained for further study. The target arginine residues R416 and R447 are apparently located deep in the pocket formed by PRMT1 protein Glu152, Tyr156, Glu161 residues and the ligand SAM, between chain β 4 and helix α D. The guanidine groups of the target arginines R416 and R447 form salt bridges with E152 and E161, respectively. In addition, the aromatic group of Tyr156 is parallel to the methylene group of the target arginine. These interactions contribute to the stable binding of the targeted arginine residue to the enzyme site, which is consistent with the results of the in vitro methylation experiments of the present invention, suggesting that both sites are methylated by PRMT 1.
Example six: the regulation of BCL-2 expression by methylation of arginine sites at R416 and R447 sites of HSP70 was demonstrated.
siHSP70, pHSP70Mut and pHSP70WT were transferred into MDA28 cells by the transfection method described in example two, siCtrl and pCDAN3.1 were used as controls, and then culture was continued for 36-48 hours, and according to the standard sampling and Western Blotting method described in example three, HSP70 antibody was used to detect the expression level of HSP70 protein, BCL-2 antibody was used to detect the expression level of BCL-2 protein, and β -Actin was used as an internal reference.
pHSP70Mut and pHSP70WT were transferred into HSP70 knock-out cell clones KO-16, KO-19, KO-31 and KO-37 cells, respectively, by the transfection method described in example two, pCDAN3.1 was used as a control, and then treated with gemcitabine (20. mu.M) for further culturing for 36 to 48 hours, and HSP70 protein expression level was measured using HSP70 antibody, BCL-2 protein expression level was measured using BCL-2 antibody, and Tubulin was used as an internal reference, according to the standard sampling and Western Blotting method described in example three.
The results are shown in FIG. 3-A and FIG. 3-B. FIG. 3-A depicts the effect of methylation of two arginine residues R416 and R447 of HSP70 on BCL-2mRNA expression levels. FIG. 3-B further depicts that recombinant Wild Type (WT), but not R416A and R447A double mutant HSP70(Mut), increased BCL-2 expression in HSP 70-deficient cells. HSP70 effect of methylation of two arginine residues R416 and R447 on BCL-2mRNA expression levels. First, by altering HSP70 expression in MDA28 cells, it was found that down-regulation of HSP70 by siHSP70 significantly reduced BCL-2 expression, while wild-type HSP70(WT) increased BCL-2 protein levels (fig. 3-a). Further, recombinant Wild Type (WT), but not R416A and R447A double mutant HSP70(Mut), increased BCL-2 expression in HSP 70-deficient cells (fig. 3-B).
Example seven: mRNA half-life experiments.
By the transfection method described in example two, the wild-type HSP70 expression vector HSP70WT and the two HSP70 arginine residues R416A and R447A mutant expression vectors were transferred into mouse pancreatic cancer cells, cultured for 36 hours, and treated with actinomycin-d (ActD) for 4 hours to avoid initiating the ActD-based apoptosis program. Total RNA was extracted using RNeasy Mini Kit (QIAGEN) at 0, 0.5, 1, 2, 3 and 4 hours after ActD treatment. The above RNA samples were analyzed for BCL-2 and GAPDH mRNA expression using the multiplex qRT-PCR method described above, with an average of three replicates for each data point. + -. SD. Transcript levels were normalized to GAPDH levels. Nonlinear regression was performed using GraphPad Prism6 software to calculate the first order decay constant (k) and corresponding mRNA half-life to give ln2/k mRNA half-life (t 1/2).
The results are shown in FIG. 3-C. FIG. 3-C depicts whether HSP70 methylation affects the stability of BCL-2 mRNA. BCL-2mRNA decayed slowly in wild-type HSP70 transfected cells with a half-life of 5.07 ± 0.36 hours, whereas BCL-2 transcripts decayed faster in mutant HSP70 transfected cells (t1/2 ═ 3.02 ± 0.29 hours). Indicating that HSP70 methylation affects the stability of BCL-2 mRNA.
Example eight: ribonucleoprotein immunoprecipitation (RNP-RIP).
Wild-type and mutant Myc-tagged HSP70 plasmids and Myc control plasmids were transfected into HSP70 knockout Mia PaCa-2 cells, respectively, by the transfection methods described in example seven. After 36 hours of incubation, ribonucleoprotein complexes comprising Myc-HSP70 were purified from cell lysates using anti-Myc antibody-conjugated magnetic beads. The magnetic beads were washed with lysis buffer to which an RNase inhibitor was added, and then RNA molecules in the complex were extracted using RNeasy Mini Kit (QIAGEN). Using SuperScriptTMIV First-Strand Synthesis System (Invitrogen), mRNA was reverse transcribed into cDNA. The PCR product was amplified by 30 cycles of PCR reaction, separated on 2% agarose gel, stained by EB, and photographed under UV light. BCL-2, VEGFA and GAPDH are detected in a sample as internal references, the sequences of primer pairs are shown in a table 1, and the sequences of peptide fragments are shown in a table 2.
TABLE 1 primers
Primer name | Sequence (5 '-3') |
BCL-2 3′-UTR primer 1forward | CTGGTGGGAGCTTGCATCAC |
BCL-2 3′-UTR primer 1reverse | TCTTAAACAGCCTGCAGCTTTG |
BCL-2 3′-UTR primer 2forward | CGCAGAACCTGCCTGTGTCC |
BCL-2 3′-UTR primer 2reverse | |
VEGFA | |
3′-UTR primer forward | |
VEGFA | |
3′-UTR primer reverse | GGGTCTCGATTGGATGGCAG |
GAPDH mRNA primer forward | CTCTGCTCCTCCTGTTCGACAG |
GSPDH mRNA primer reverse | CAATACGACCAAATCCGTTGACT |
TABLE 2 peptide fragments
The results are shown in FIG. 3-D, FIG. 3-E and FIG. 3-F. FIG. 3-D depicts ribonucleoprotein immunoprecipitation (RNP-IP) experiments in HSP70 knock-out MiaPaCa-2 cells. FIG. 3-E depicts the results of quantifying FIG. 3-D using imaging software. FIG. 3-F depicts the results of ribonucleoprotein immunoprecipitation (RNP-IP) experiments in HSP70 knock-out HEK-293 cells. Wherein lanes 2, 6, 10 of FIG. 3D show BCL-2 primer pair 1 product, lanes 3, 11 show BCL-2 primer pair 2 product, lanes 4, 8, 12 show VEGFA primer pair product, and lanes 5, 9, 13 show GAPDH primer pair product. The first lane is a100 bp DNA ladder. Wild-type HSP70 binds more BCL-2mRNA than mutant HSP70, given the same amount of mRNA and protein input. VEGFA mRNA is also more abundant in wild type than mutant HSP70, where VEGFA mRNA serves as a positive control because HSP70 has been previously reported to bind VEGFA mRNA.
Example nine: electrophoretic migration transfer experiment
To describe the direct binding of HSP70 to AREs of BCL-2mRNA, electrophoretic migration transfer experiments were performed using purified wild-type and mutant HSP70 proteins and biotin-labeled RNA probes.
Specifically, the binding of Myc-Hsp70 protein to an RNA substrate was qualitatively assessed using the LightShiftTM chemiluminescent RNA EMSA kit (Thermo Fisher Scientific) according to the manufacturer's instructions. Briefly, biotin-labeled BCL-23 ' -UTR RNA fragments or UA-enriched positive control fragments (5'-gugauuauuuauuauuuauuuauuauuuauuuauuuag-3') were incubated with recombinant proteins in binding buffer at 25 ℃ for 30 minutes. The reaction was then subjected to 5% polyacrylamide gel electrophoresis and then transferred to a positively charged nylon membrane. After cross-linking the RNA to the membrane, biotin-labeled RNA was detected by streptavidin-horseradish peroxidase (HRP) coupling and chemiluminescence.
The results are shown in FIGS. 3-G. FIG. 3-G depicts the direct binding of HSP70 to AREs of BCL-2 mRNA. Wild type HSP70 has higher binding affinity to the ARE-containing RNA probe than mutant HSP 70.
Example ten: effect of drug concentration on cell survival.
Gene-specific knockout cell lines were generated using the Crisp/cas9 system. The first 100bp coding sequence of the human HSPA1A/B gene was analyzed by using an online CRISPR design tool (http:// CRISPR. mit. edu /) for leader design. The targeting sequence of HSPA1A/B is 5'-atggccaaagccgcggcgat-3' in the forward direction and 5'-atcgccgcggctttggccat-3' in the reverse direction. Random leader sequences not directed against any known human genes were used as controls, forward 5'-ccgccccgagttcaaggtggagcg-3', reverse 5'-cgctccaccttgaactcggggcgg-3'. The forward and reverse oligonucleotides were annealed to each other, inserted into the vector pSpCas9(BB) -2A-Puro (Addgene #62988), and digested with BbsI restriction enzyme. The recombinant plasmid was transfected into MIAPaCa-2 cells, and the cells were treated with puromycin (1. mu.g/ml) for 48-72 hours. After puromycin selection, single cell clones were seeded onto 96-well plates using flow cytometry. After culturing for 10-14 days, specific gene deletion of each cell was detected by Western blot and genomic DNA sequencing. Two HSP70 knock-out cell clones (KO-16 and KO-20) were obtained.
Using the cell transfection method of example two, pcDNA3.1, SHP70 wild-type overexpression vectors pHSP70WT, R416A and R447A double mutant HSP70 overexpression vector pHSP70Mut were transformed into HSP70 knock-out cell clones KO-16 and KO-20, respectively. Cells were seeded in 96-well plates at 3000 cells per well 36 hours after transfection. Different dilution gradients of Etoposide or H2O2Addition to DMEM medium or glucose deprivation, 2% FBS addition, 48 hours of incubation followed by Cell Counting Kit-8(CCK-8, Dojindo Molecular Technologies) to determine Cell viability and IC50 for each drug was calculated using Prism GraphPad 6 software. The viability of the control group was determined as 100% and the concentration of each drug was determined 3 times.
The results are shown in FIG. 4-A, FIG. 4-B and FIG. 4-C. FIG. 4-A depicts HSP70 methylation conferring resistance to Etoposide on pancreatic cancer cells. FIG. 4-B depicts HSP70 methylation conferring resistance to oxidative stress (H) in pancreatic cancer cells2O2). FIG. 4-C depicts HSP70 methylation enables pancreatic cancer cells to counteract auxotrophy (glucose deprivation). Wild-type HSP70 has a significantly better protective function against various survival stresses than mutant HSP70
Example eleven: flow cytometry.
Using the ten cells of example, pcDNA3.1, SHP70 wild-type overexpression vectors pHSP70WT, R416A and R447A double mutant HSP70 overexpression vector pHSP70Mut were transferred into HSP70 knock-out cell clones KO-16 and KO-20, respectively, the cells were treated with 20. mu.M gemcitabine, the cells transfected with pcDNA3.1 were treated with solvent as a blank, and the cells were treated for 24 hours, and then apoptotic cells were analyzed by Annexin v/PI staining and flow cytometry.
The results are shown in FIG. 4-D. Fig. 4-D depicts that wild-type HSP70 protects cells from apoptosis, while hypomethylated HSP70 has no protective effect on stress-induced apoptosis. After 20 μ M gemcitabine treatment, wild type HSP70 had a stronger anti-apoptotic capacity than the 416A and R447A double mutant HSP70 and pcdna3.1 control group.
Example twelve: apoptosis detection
The ten cells of the example, namely the wild type overexpression vectors pHSP70WT, R416A and R447A of SHP70, the double mutant HSP70 overexpression vector pHSP70Mut transfected with pcDNA3.1 and SHP70 were transferred into HSP70 knock-out cell clones KO-16 and KO-20, respectively, the cells were treated with 20. mu.M gemcitabine, the cells transfected with pcDNA3.1 were treated with a solvent as a blank, and after 24 hours of treatment, cleavage of caspase-9 was detected by the Western blot method described in the third example. Caspase-9 antibody (1: 1000 dilution) was used.
The results are shown in FIGS. 4-E. The results in FIG. 4-E depict Caspase-9 lysis in cells over-expressed by wild-type and R-A mutant HSP70 after treatment with solvent (negative control) and gemcitabine, as detected by WersternBlot, demonstrating that wild-type HSP70 inhibits apoptosis and R-A mutant HSP70 attenuates this protection. After 20 μ M gemcitabine treatment, caspase-9, a marker of apoptosis, was less cleaved in cells expressing wild-type HSP70, and further wild-type HSP70 had stronger anti-apoptotic ability than 416A and R447A double mutant HSP70 and pcdna3.1 control group.
Example thirteen: cell growth experiments
KO-20, KO-41, 8902 were cloned from HSP70 knock-out (KO) Mia PaCa-2 cells by transfecting a wild-type HSP70 expression vector (HSP70-wt), HSP70 single mutant (R416A) or double mutant (HSP70-Mut) expression vector, respectively, by the three transfection methods described in the examples, and inoculating cells into 96-well plates, 3000 cells per well, culturing for 3-4 days under normal culture conditions, and measuring relative cell growth daily using the CCK-8 method described in example four (expressed as "OD" value).
Using the transfection method described in example three, 2 HSP70 knockout cell clones (KO-16 and KO-20) were transfected with pcDNA3.0 control plasmid or wild-type HSP70 expression plasmid (HSP70WT), respectively. And the cells were seeded in 96-well plates at 3000 cells per well, gemcitabine-containing medium was added to each well, a concentration gradient (specific concentration gradient) was set, and after 24 or 48 hours of treatment, three more wells per treatment were set, and the cell inhibition rate was measured using the CCK8 method described in example four.
HSP70 knockout Mia PaCa-2 cells were transfected with Wild Type (WT), single methylation site mutants (R416A or R447A) or 416 and 447 double site mutant (Mut) HSP70 plasmids using the transfection method described in example three. Cell growth inhibition by gemcitabine was determined by determining cell viability using the CCK8 method described in example four. sgCtrl served as control group. P values were determined by one-way anova.
PRMT1 overexpression vectors pPRMT1 and siPRMT1 were transfected into FG cells using the transfection method described in example three, allowed to overexpress or knock out again in FG cells, and the cells were seeded into 96-well plates, 3000 cells per well, gemcitabine-containing medium per empty, concentration gradients (specific concentration gradients) were set, three replicate wells per treatment were set 24 or 48 hours after treatment, and the cell inhibition rate was determined using the CCK8 method described in example four.
MiaPaCa-2 cells were seeded into 96-well plates at 3000 cells per well, cultured overnight (12 hours) normally, and after the cells were attached, treated with DB75 (5. mu.M), gemcitabine (20. mu.M), or a combination of both for 48 hours, and the number of viable cells was determined by the CCK-8 method described in example four.
The results of the experiment are shown in FIG. 5-A, FIG. 5-B, FIG. 5-C, FIG. 5-D, FIG. 5-E and FIG. 5-F: arginine methylation at specific sites affected HSP70 function in gemcitabine resistance. The present invention transfects two single arginine-alanine mutants, R416A and R447A, and a double mutant (Mut) into HSP 70-deficient cells. Wild-type HSP70 slightly promoted cell growth (fig. 5-a), and also restored levels of drug resistance similar to the parent MiaPaCa-2 cell (fig. 5-B), whereas single mutants of R416A and R447A were only able to rescue about half of the drug resistance level, and the double-mutated protein was not able to rescue drug resistance (fig. 5-C). Because these two arginine residues are the methylation sites of PRMT1, the present invention manipulates the expression of PRMT1 in FG cells and assesses its resistance to gemcitabine. As expected, overexpression of PRMT1 increased gemcitabine resistance, while down-regulation of PRMT1 decreased gemcitabine resistance in FG cells (fig. 5-D, fig. 5-E). The PRMT 1-specific inhibitor DB75 also sensitised pancreatic cancer cells to gemcitabine-induced cell death (fig. 5-F), Veh in fig. 5-F representing drug solvent; DB75 represents the protein arginine methyltransferase inhibitor DB 75; GEM represents gemcitabine. These results indicate that PRMT 1-mediated methylation of HSP70 arginines 416 and 447 is critical for drug resistance in cancer cells.
Example fourteen: the polypeptide and the antibody inhibit the drug resistance of tumor cells.
Synthesizing a peptide segment containing 20 amino acids of human HSP70 arginine 416 and 447 residues and a peptide segment containing 50 amino acids of arginine 416 and 447 residues.
Polyclonal antibodies against HSP70 arginine 416 and 447 residues were prepared using the synthetic peptide fragments described above for future use.
The MiaPaCa-2 cells are inoculated into a 96-well plate, 5000 cells per well are added under the cell culture condition in the second example, when the cells are adhered to the wall, the polypeptide or the antibody is respectively added into the cells, the final concentration of the polypeptide and the antibody is 10 mu mol, gemcitabine with the final concentration of 20 mu M is added after 24 hours of treatment, the culture is continued, and the cell growth condition is detected by using CCK 8.
The results are shown in FIG. 6-A, and the inhibition of gemcitabine by CCK8 was calculated by examining cell proliferation of MiaPaCa-2 cells 48 hours after gemcitabine treatment (20. mu.M), and the polypeptides R416, R447 and the polypeptide R416+ R447 were all able to increase the proliferation of tumor cells by gemcitabine. The same effect was observed with antibodies directed against HSP70 arginine 416 and 447 residues, and the results are shown in FIG. 6-B, where Mock is a blank control, ab-R416 is an antibody blocking the R416 arginine residue, ab-R447 is an antibody blocking the R447 arginine residue, cell proliferation was examined by the CCK8 method to generate growth curves showing that ab-R416 and ab-R447 have increased gemcitabine inhibition of tumor cell growth.
The above examples are only preferred embodiments of the present invention, which are intended to be illustrative and not limiting, and those skilled in the art should understand that they can make various changes, substitutions and alterations without departing from the spirit and scope of the invention.
Sequence listing
<110> university of southern China's science
<120> a medicine for treating cancer
<160> 16
<170> SIPOSequenceListing 1.0
<210> 1
<211> 20
<212> DNA
<213> BCL-2
<400> 1
<210> 2
<211> 22
<212> DNA
<213> BCL-2
<400> 2
tcttaaacag cctgcagctt tg 22
<210> 3
<211> 20
<212> DNA
<213> BCL-2
<400> 3
<210> 4
<211> 21
<212> DNA
<213> BCL-2
<400> 4
cattgcctct cctcacgttc c 21
<210> 5
<211> 22
<212> DNA
<213> VEGFA
<400> 5
tctacctcca ccatgccaag tg 22
<210> 6
<211> 20
<212> DNA
<213> VEGFA
<400> 6
<210> 7
<211> 22
<212> DNA
<213> GAPDH
<400> 7
ctctgctcct cctgttcgac ag 22
<210> 8
<211> 23
<212> DNA
<213> GAPDH
<400> 8
caatacgacc aaatccgttg act 23
<210> 9
<211> 19
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 9
Gly Gly Arg Gly Gly Phe Gly Gly Arg Gly Gly Phe Gly Gly Arg Gly
1 5 10 15
Gly Phe Gly
<210> 10
<211> 19
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 10
Gly Gly Ala Gly Gly Phe Gly Gly Ala Gly Gly Phe Gly Gly Ala Gly
1 5 10 15
Gly Phe Gly
<210> 11
<211> 19
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 11
Gly Val Met Thr Ala Leu Ile Lys Arg Asn Ser Thr Ile Pro Thr Lys
1 5 10 15
Gln Thr Gln
<210> 12
<211> 19
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 12
Gly Val Met Thr Ala Leu Ile Lys Ala Asn Ser Thr Ile Pro Thr Lys
1 5 10 15
Gln Thr Gln
<210> 13
<211> 20
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 13
Val Leu Ile Gln Val Tyr Glu Gly Glu Arg Ala Met Thr Lys Asp Asn
1 5 10 15
Asn Leu Leu Gly
20
<210> 14
<211> 20
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 14
Val Leu Ile Gln Val Tyr Glu Gly Glu Ala Ala Met Thr Lys Asp Asn
1 5 10 15
Asn Leu Leu Gly
20
<210> 15
<211> 20
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 15
Met Thr Lys Asp Asn Asn Leu Leu Gly Arg Phe Glu Leu Ser Gly Ile
1 5 10 15
Pro Pro Ala Pro
20
<210> 16
<211> 20
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 16
Met Thr Lys Asp Asn Asn Leu Leu Gly Ala Phe Glu Leu Ser Gly Ile
1 5 10 15
Pro Pro Ala Pro
20
Claims (4)
1. A medicament for treating cancer, which comprises a polypeptide fragment of an arginine methylated heat shock protein HSP70, wherein the polypeptide fragment is a polypeptide fragment containing an arginine residue at 416 th position of HSP70, a polypeptide fragment containing an arginine residue at 447 th position of HSP70 or a polypeptide fragment of a combination of the two, and the medicament inhibits methylation of arginine at 416 th and/or 447 th positions of HSP 70.
2. The drug for treating cancer as claimed in claim 1, wherein the peptide fragment of arginine residue 416 of the arginine methylated heat shock protein HSP70 has the sequence GGVMTALIKRNSTIPTKQTQ.
3. The drug for treating cancer as claimed in claim 1, wherein the sequence of the polypeptide fragment of arginine residue 447 in the protein HSP70 is GVLIQVYEGERAMTKDNNLL.
4. The drug for treating cancer according to claim 1, wherein the sequence of the combined polypeptide fragment is GGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLL.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202010481023.4A CN111686248B (en) | 2020-05-30 | 2020-05-30 | Medicine for treating cancer |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202010481023.4A CN111686248B (en) | 2020-05-30 | 2020-05-30 | Medicine for treating cancer |
Publications (2)
Publication Number | Publication Date |
---|---|
CN111686248A CN111686248A (en) | 2020-09-22 |
CN111686248B true CN111686248B (en) | 2022-03-25 |
Family
ID=72478645
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202010481023.4A Active CN111686248B (en) | 2020-05-30 | 2020-05-30 | Medicine for treating cancer |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN111686248B (en) |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN112481273B (en) * | 2020-12-29 | 2023-11-24 | 南通大学附属医院 | Colorectal cancer inhibiting gene and verification method for high DNA methylation of promoter region of colorectal cancer inhibiting gene |
CN113755495B (en) * | 2021-09-22 | 2022-09-06 | 陈天睿 | Use of gene editing technology in the treatment of cancer |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2012222192A1 (en) * | 2011-02-23 | 2013-10-17 | Mdsure Ltd | Compositions and methods for personal tumor profiling treatment |
CN108642177A (en) * | 2018-04-25 | 2018-10-12 | 华南理工大学 | A kind of method, kit and the application of detection excrement LAD1 gene methylations |
-
2020
- 2020-05-30 CN CN202010481023.4A patent/CN111686248B/en active Active
Also Published As
Publication number | Publication date |
---|---|
CN111686248A (en) | 2020-09-22 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Cioce et al. | UV-induced fragmentation of Cajal bodies | |
Paul et al. | Expanded CUG repeats dysregulate RNA splicing by altering the stoichiometry of the muscleblind 1 complex | |
Li et al. | MUC1-C drives stemness in progression of colitis to colorectal cancer | |
Franke et al. | The tumor suppressor SASH1 interacts with the signal adaptor CRKL to inhibit epithelial–mesenchymal transition and metastasis in colorectal cancer | |
US20100256073A1 (en) | Therapeutic agent comprising lipocalin 2 against cancer metastasis, and methods of early diagnosis and inhibition of cancer metastasis using lipocalin 2 | |
CN111686248B (en) | Medicine for treating cancer | |
WO2011096756A2 (en) | Pharmaceutical composition for inhibiting abnormal proliferation of cells | |
Xia et al. | Berberine suppresses bladder cancer cell proliferation by inhibiting JAK1-STAT3 signaling via upregulation of miR-17-5p | |
Huang et al. | LncRNA PVT1 knockdown affects proliferation and apoptosis of uveal melanoma cells by inhibiting EZH2. | |
Hu et al. | BTG2 overexpression increases the radiosensitivity of breast cancer cells in vitro and in vivo | |
Chen et al. | ZFP36 binds with PRC1 to inhibit tumor growth and increase 5-Fu chemosensitivity of hepatocellular carcinoma | |
Rechichi et al. | TSPO over-expression increases motility, transmigration and proliferation properties of C6 rat glioma cells | |
Kuzmanov et al. | FBXO25 promotes cutaneous squamous cell carcinoma growth and metastasis through cyclin D1 | |
Ichikawa et al. | Novel PRMT5-mediated arginine methylations of HSP90A are essential for maintenance of HSP90A function in NDRG2low ATL and various cancer cells | |
Shi et al. | miR-142-3p improves paclitaxel sensitivity in resistant breast cancer by inhibiting autophagy through the GNB2-AKT-mTOR pathway | |
Mesclon et al. | Decreased ATF4 expression as a mechanism of acquired resistance to long-term amino acid limitation in cancer cells | |
Jones et al. | CPEB1 regulates β‐catenin mRNA translation and cell migration in astrocytes | |
CN113209303B (en) | WWP1 degradation oncoprotein MUC1 inhibition tumor through lysosome approach and application thereof | |
Dong et al. | EGCG‐LYS Fibrils‐Mediated CircMAP2K2 Silencing Decreases the Proliferation and Metastasis Ability of Gastric Cancer Cells in Vitro and in Vivo | |
Jin et al. | Radiation resistance of the lung adenocarcinoma is related to the AKT-Onzin-POU5F1 axis | |
US9730954B2 (en) | miRNAs as novel therapeutic adjuvants and biomarkers for the prognosis and treatment of drug resistant breast cancers | |
Kong et al. | Isoform-specific disruption of the TP73 gene reveals a critical role for TAp73γ in tumorigenesis via leptin | |
Li et al. | Sp1 inhibition-mediated upregulation of VEGF 165 b induced by rh-endostatin enhances antiangiogenic and anticancer effect of rh-endostatin in A549 | |
CN110563830B (en) | ANXA 1-derived polypeptide and application thereof | |
Yao et al. | SECTM1 promotes the development of glioblastoma and mesenchymal transition by regulating the TGFβ1/Smad signaling pathway |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant | ||
TR01 | Transfer of patent right | ||
TR01 | Transfer of patent right |
Effective date of registration: 20240721 Address after: No. 333 Taodu Road, Luojian Village, Dingshu Town, Yixing City, Jiangsu Province, China 214221 Patentee after: Kaidi Biopharmaceutical (Jiangsu) Co.,Ltd. Country or region after: China Address before: 510640 No. five, 381 mountain road, Guangzhou, Guangdong, Tianhe District Patentee before: SOUTH CHINA University OF TECHNOLOGY Country or region before: China |