CN111662938A - Application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compound to generate amide pyrazine compound - Google Patents

Application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compound to generate amide pyrazine compound Download PDF

Info

Publication number
CN111662938A
CN111662938A CN202010580723.9A CN202010580723A CN111662938A CN 111662938 A CN111662938 A CN 111662938A CN 202010580723 A CN202010580723 A CN 202010580723A CN 111662938 A CN111662938 A CN 111662938A
Authority
CN
China
Prior art keywords
cyanopyrazine
nitrile hydratase
ala
hydroxy
leu
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
CN202010580723.9A
Other languages
Chinese (zh)
Other versions
CN111662938B (en
Inventor
姚红
倪泉明
王伟文
黄晓飞
陈文斌
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Zhejiang Hengkang Pharmaceutical Co ltd
Original Assignee
Zhejiang Hengkang Pharmaceutical Co ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Zhejiang Hengkang Pharmaceutical Co ltd filed Critical Zhejiang Hengkang Pharmaceutical Co ltd
Priority to CN202110424332.2A priority Critical patent/CN113025671B/en
Priority to CN202110424889.6A priority patent/CN113106130B/en
Priority to CN202010580723.9A priority patent/CN111662938B/en
Publication of CN111662938A publication Critical patent/CN111662938A/en
Application granted granted Critical
Publication of CN111662938B publication Critical patent/CN111662938B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P17/00Preparation of heterocyclic carbon compounds with only O, N, S, Se or Te as ring hetero atoms
    • C12P17/10Nitrogen as only ring hetero atom
    • C12P17/12Nitrogen as only ring hetero atom containing a six-membered hetero ring
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/88Lyases (4.)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y402/00Carbon-oxygen lyases (4.2)
    • C12Y402/01Hydro-lyases (4.2.1)
    • C12Y402/01084Nitrile hydratase (4.2.1.84)
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Abstract

The invention provides application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compounds to generate amide pyrazine compounds, belonging to the technical field of biochemical engineering; the nitrile hydratase is derived from Agrobacterium tumefaciens (Agrobacterium tumefaciens), Staphylococcus aggregatus (Stappia aggregata IAM12614) or Sinorhizobium meliloti (Sinorhizobium meliloti). The invention takes the cyanopyrazine compound as a substrate, and takes isolated nitrile hydratase or cells expressing the nitrile hydratase as a catalyst to carry out hydration reaction, thereby obtaining the amide pyrazine compound. The invention has high conversion rate of the applied raw materials, no side reaction, easy separation and purification of the product and higher purity; compared with the traditional chemical catalysis process, the process is environment-friendly and simple and convenient to operate, and the yield exceeds 99%.

Description

Application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compound to generate amide pyrazine compound
Technical Field
The invention relates to the technical field of biochemical engineering, in particular to application of nitrile hydratase in catalyzing hydration reaction of a cyanopyrazine compound to generate an amide pyrazine compound.
Background
The amide pyrazine (or pyrazinamide) is an important antituberculosis drug and has good curative effect on tuberculosis. In recent years, amide pyrazine has a good bactericidal effect on stubborn bacteria, so that the amide pyrazine is widely applied clinically; the amide pyrazine can be used as an intermediate for preparing various antibacterial and antiviral medicaments. For example, derivatives of amide pyrazines: 6-fluoro-3-hydroxy-2-amidopyrazine, also known as Favipiravir (also known as Avigan or favilavivir), is an antiviral drug developed by professor Baumuna Gongkang, department of medicine, Fuji film, and Fuji film under Fuji film chemical industry (Fuji film Fuji chemical), which is capable of fighting against a variety of RNA viruses. Favipiravir has the effect of reducing the activity of influenza virus, West Nile virus, yellow fever, foot and mouth disease virus and other various viruses; it has also been shown to inhibit activities such as enterovirus and rift valley heat; the drug also exhibits efficacy against rabies and has been used experimentally to treat patients infected with rabies virus. In 2020 and 2 months, Favipiravir is used for experimental treatment of 2019 coronavirus disease (COVID-19) in China, and in 3 and 17 days, the drug is found to be effective in treating infected patients in experiments performed by Wuhan and Shenzhen, and early reports indicate that the drug can be effective in treating the disease.
The preparation method of Favipiravir mainly comprises a chemical synthesis method and a biological catalysis method. In terms of chemical synthesis, patent document WO0010569 discloses a preparation method of 6-bromo-3-amino-2-pyrazinecarboxylic acid methyl ester by multi-step reaction; WO2010087117A1 discloses a process for preparing 3-hydroxy-2-pyrazinamide by bromination followed by a multi-step reaction. Patent document CN102603658A is prepared by using 6-bromo-3-amino-2-pyrazinamide as a raw material and performing four-step reactions of amino protection, halogen substitution, deprotection, and azidation. However, these known chemical synthetic preparation methods have the following disadvantages: the synthesis is complex, the process is complicated, and the conversion rate and the total yield are low.
The application of biological catalysis in organic synthesis process has great potential and has the advantages that chemical methods cannot replace the prior methods, such as: mild reaction conditions, environmental protection, low cost, no side reaction and the like. In the preparation of amide compounds, nitrile hydratase (NHase, e.c.4.2.1.84) is preferably used to catalyze the hydration reaction of nitrile compounds to produce amides. Among them, some nitrile hydratase-producing microorganisms have been used in the production of acrylamide, nicotinamide, 2-amino-2, 3-dimethylbutanamide, and the like: for example, patent document No. US007405064B2 discloses Comamonas testosteroni 5-MGAM-4D, patent No. ZL88106735 discloses Rhodococcus rhodochrous J-1, patent No. ZL103834600 discloses Pseudomonas putida, and these wild strains are all used in the production of acrylamide. However, nitrile hydratases used for pyrazinamide production are currently reported to be few. World patent document WO2006049618A1 reports that E.coli SW132 is used as an expression host, and nitrile hydratase derived from Comamonas testosteroni 5-MGAM-4D is cloned and expressed to produce 2-amide pyrazine, and recombinant E.coli SW132 cells are used for catalyzing and transforming 2-cyano pyrazine with the concentration of 0.5. M for 15min in a phosphate buffer system (pH7.0) at 23 ℃, and the transformation rate is 100%. Chinese patent CN101481713A discloses a method for producing 2-amide pyrazine by using 2-cyano pyrazine as a substrate and Serratia marcescens ZJB09104 expressing nitrile hydratase as a biocatalyst.
Although the gene resources of nitrile hydratase in various databases are abundant at present, the nitrile hydratase capable of catalyzing substrate cyanopyrazine to prepare amide pyrazine is few. More importantly, no document reports nitrile hydratase capable of catalyzing cyanopyrazine compounds to directly prepare amide pyrazine compounds (such as Favipiravir) at present.
Disclosure of Invention
The invention aims to provide application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compounds to generate amide pyrazine compounds.
In order to achieve the above object, the present invention provides the following technical solutions:
the invention provides application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compounds to generate amide pyrazine compounds; the nitrile hydratase is derived from Agrobacterium tumefaciens (Agrobacterium tumefaciens), Staphylococcus aggregatus (Stappia aggregata IAM12614) or Sinorhizobium meliloti (Sinorhizobium meliloti).
Preferably, the amino acid sequence of the alpha subunit of the nitrile hydratase derived from Agrobacterium tumefaciens (Agrobacterium tumefaciens) is shown as SEQ ID NO.1, and the amino acid sequence of the beta subunit is shown as SEQ ID NO. 2; the amino acid sequence of the alpha subunit of the nitrile hydratase derived from the Staphylococcus aggregatus (Stappia aggregata IAM12614) is shown as SEQ ID NO.3, and the amino acid sequence of the beta subunit is shown as SEQ ID NO. 4; the amino acid sequence of the alpha subunit of the nitrile hydratase derived from Sinorhizobium meliloti (Sinorhizobium meliloti) is shown as SEQ ID NO.5, and the amino acid sequence of the beta subunit is shown as SEQ ID NO. 6.
Preferably, the chemical formula of the cyanopyrazine compound is shown as formula I; the chemical formula of the amide pyrazine compound is shown as a formula II;
Figure BDA0002552223980000031
in formula I and formula II:
R1selected from H, CH3F, Cl, Br, or I;
R2selected from H, NH2Or OH.
Preferably, the cyanopyrazine-based compound includes 2-cyanopyrazine, 3-methyl-2-cyanopyrazine, 6-methyl-3-hydroxy-2-cyanopyrazine, 6-bromo-3-amino-2-cyanopyrazine, 6-fluoro-3-hydroxy-2-cyanopyrazine, 6-chloro-3-hydroxy-2-cyanopyrazine, 6-bromo-3-hydroxy-2-cyanopyrazine or 6-iodo-3-hydroxy-2-cyanopyrazine.
Preferably, the application comprises the following steps: taking a cyanopyrazine compound as a substrate, and carrying out hydration reaction in an aqueous solution by using isolated nitrile hydratase or cells for expressing the nitrile hydratase in vitro as a catalyst to obtain the amide pyrazine compound.
Preferably, the concentration of the substrate in water is 2-100 g/L; when the cells expressing nitrile hydratase in vitro are used as a catalyst, the adding amount of the catalyst is calculated by the wet weight of the cells after centrifugation at 12000rpm for 10min, and the adding amount of the cells is 1-20% of the weight of the reaction solution; when in vitro nitrile hydratase is used as a catalyst, the addition amount of in vitro nitrile hydratase is 10-10000U per liter of reaction liquid.
Preferably, the temperature of the hydration reaction is 10-50 ℃, and the pH value of the hydration reaction is 5-10.
Preferably, the temperature of the hydration reaction is 20-30 ℃; the pH value of the hydration reaction is 6-8.
The invention has the beneficial effects that: the invention provides application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compounds to generate amide pyrazine compounds; the nitrile hydratase is derived from Agrobacterium tumefaciens (Agrobacterium tumefaciens), Staphylococcus aggregatus (Stappia aggregata IAM12614) or Sinorhizobium meliloti (Sinorhizobium meliloti). According to the invention, the amide pyrazine compound can be obtained by taking the cyano pyrazine compound as a substrate and taking nitrile hydratase as a catalyst to carry out water reaction. The invention has high conversion rate of the applied raw materials, no side reaction, easy separation and purification of the product and higher purity; compared with the traditional chemical catalysis process, the process is environment-friendly and simple and convenient to operate, and the yield exceeds 99%.
Drawings
FIG. 1 is a reaction formula of nitrile hydratase of the invention catalyzing hydration reaction of cyanopyrazine compounds to form amidopyrazine compounds;
FIG. 2 is a HPLC analysis chart of 6-fluoro-3-hydroxy-2-cyanopyrazine converted by nitrile hydratase.
Detailed Description
The invention provides application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compounds to generate amide pyrazine compounds, wherein the reaction formula is shown in figure 1; the nitrile hydratase is derived from Agrobacterium tumefaciens (Agrobacterium tumefaciens), Staphylococcus aggregatus (Stappia aggregata IAM12614) or Medicago sativaRhizobium (Sinorhizobium meliloti), preferably from Staphylococcus aggregatus (Stappia aggregata IAM 12614. the nitrile hydratase of the invention is a cobalt-type nitrile hydratase consisting of α and β subunits, in the form of a dimer (αβ)2Exist in the form of (1). The nitrile hydratase of the invention has the activity of catalyzing the hydration reaction of the cyanopyrazine compound to generate the amide pyrazine compound.
In the present invention, the amino acid sequence of the α subunit of the nitrile hydratase derived from Agrobacterium tumefaciens (Agrobacterium tumefaciens) is shown as SEQ ID No.1 (GenBank accession No. CAD54074), specifically:
MSHDHDHTEPPTEIALRVKALESLLTEKGLVDPAALDELVDTYENRIGPRNGALVVAKAWTDPAYKQRLLTNATEAIAELGFSGVQGEDMLVVENSPTVHNMTVCTLCSCYPWPTLGLPPAWYKSAPYRSRVVIDPRGVLAEFGVSVPADKEVRVWDSSAELRYLVLPERPAGTEGWSEEQLVELVTRDSMIGTGFPKNPADLH;
the amino acid sequence of the beta subunit is shown as SEQ ID NO.2 (GenBank accession number CAD54075), and specifically comprises the following components:
MNGVHDLGGMHGLGPIAPPADEPVFAHQWERRIFALFVPLFGGGHFNVDQFRHAIERMDPAHYLQGTYYEHWLHAFETLLIEGGAISRAELDARIKQIGGAQIMAVVTRDMIEPIVRTGASARVAADVAARFKVGDTVRAKNINPTTHTRLPRYVRGRVGTIEIDHGVFVTPDTVAHGKGEHPQHVYCVRFAAVELWGSDVSGTDNVRIDLWDDYLEKA。
in the present invention, the amino acid sequence of the α subunit of the nitrile hydratase derived from Staphylococcus aggregatus (Stappia aggregata IAM12614) is shown in SEQ ID NO.3 (GenBank accession EAV46030), specifically:
MSAHDHDHPHDHDHSELSEIELRVRALETLLTEKGYIDPPALDELIETYETKIGPRNGALVVAKAWTDPDYRERLMKDATAAIAELGFTGRQGEHMVAVENTDDIHNMVVCTLCSCYPWTVLGLPPVWYKSAPYRSRAVRDPRGVLAEFKVELPDDTEIRVWDSTAEIRYLVIPKRPAGTDGWSEERLADLVTRNSMIGTGLALDPSSLEDAA;
the amino acid sequence of the beta subunit is shown as SEQ ID NO.4(GenBank accession number EAV46029), and specifically comprises the following components:
MNGAQDLGGQMGFGPIELEENEPNFHAKWEERAFAVTLAMGATGSWTLDASRFARESLPPVTYLSSSYYEIWTRGLEKLLLSNGLVTEEELKEGRKLKEAKPIKRVLSADAVAGVLAKGSSVDREEHQPARFRTGDRVKTRRMNPEHHTRLPRYARDAVGTIEAIHGVHVFPDTNAHGEGEQPAWLYGVLFKGTDIWGPDSDPKLTLRIDLWEPYLDLAR。
in the present invention, the amino acid sequence of the α subunit of nitrile hydratase derived from Sinorhizobium meliloti (Sinorhizobium meliloti) is shown in SEQ ID No.5 (NCBI accession No. WP _015007805.1), specifically:
MSEHHHGHGDDHGHHHDNHLTDMEARVKALETVLTEKGLIDPAAIDAIVDAYETKVGPRNGARVVAKAWSDPGFADWLKRDATAAIASLGFTGRQGEHMRAVFNTSETHNLIVCTLCSCYPWAVLGLPPVWYKAPPYRSRAVIDPRGVLAEFGLELSAEKKGTVRNSVRWAMMMKRRESSHGYRERTSGPAPGWT;
the amino acid sequence of the beta subunit is shown as SEQ ID NO.6 (NCBI accession number WP _010969705.1), and specifically comprises the following steps:
MNGPHDLGGQHGMGPIAPERNEPIFHAEWEKRALGITLSCGAFGAWTLDESRHARESLAPATYLSASYYEIWTRALETLLKRHGFVTQAELDAGHMLDKGREPKRVLTADMVAGVLAKGGPCDRPVEAPPRFAAGDSVRTKNFNPESHTRLPRYARARTGMVEAVQGSFVFPDDNAHGKGENPQWLYMVVFDAGEIWGEGADPTLTVSIDAWESYLEHA。
in the invention, the chemical formula of the cyanopyrazine compound is preferably as shown in formula I; the chemical formula of the amide pyrazine compound is preferably as shown in formula II;
Figure BDA0002552223980000061
in formula I and formula II:
R1preferably selected from H, CH3F, Cl, Br, or I;
R2preferably selected from H, NH2Or OH.
In the present invention, the cyanopyrazine-based compound preferably includes 2-cyanopyrazine, 3-methyl-2-cyanopyrazine, 6-methyl-3-hydroxy-2-cyanopyrazine, 6-bromo-3-amino-2-cyanopyrazine, 6-fluoro-3-hydroxy-2-cyanopyrazine, 6-chloro-3-hydroxy-2-cyanopyrazine, 6-bromo-3-hydroxy-2-cyanopyrazine or 6-iodo-3-hydroxy-2-cyanopyrazine, more preferably 6-fluoro-3-hydroxy-2-cyanopyrazine. The nitrile hydratase p-cyanopyrazine derivative, especially 6-fluoro-3-hydroxy-2-cyanopyrazine, has high catalytic activity.
In the present invention, nitrile hydratase catalyzes the hydration reaction of 2-cyanopyrazine to 2-amidopyrazine, catalyzes the hydration reaction of 3-methyl-2-amidopyrazine to 3-methyl-2-amidopyrazine, catalyzes the hydration reaction of 6-methyl-2-amidopyrazine to 6-methyl-2-amidopyrazine, catalyzes the hydration reaction of 6-bromo-3-amino-2-amidopyrazine to 6-bromo-3-amino-2-amidopyrazine, catalyzes the hydration reaction of 6-fluoro-3-hydroxy-2-amidopyrazine to 6-fluoro-3-hydroxy-2-amidopyrazine, catalyzes the hydration reaction of 6-chloro-3-hydroxy-2-amidopyrazine to 6-chloro-3-hydroxy-2-amidopyrazine, and, The 6-bromo-3-hydroxy-2-cyanopyrazine is catalyzed to generate the 6-bromo-3-hydroxy-2-amidopyrazine, and the 6-iodo-3-hydroxy-2-cyanopyrazine is catalyzed to generate the 6-iodo-3-hydroxy-2-amidopyrazine.
In the present invention, the application preferably comprises the steps of: taking a cyanopyrazine compound as a substrate, and carrying out hydration reaction in an aqueous solution by using isolated nitrile hydratase or cells for expressing the nitrile hydratase in vitro as a catalyst to obtain the amide pyrazine compound.
In the invention, the concentration of the substrate in water is preferably 2-4 g/L, more preferably 3 g/L; when the cells expressing nitrile hydratase in vitro are used as the catalyst, the amount of the catalyst is preferably 1-20%, more preferably 5-15%, and most preferably 10% of the weight of the reaction solution, based on the wet weight of the cells after centrifugation at 12000rpm for 10 min; when in vitro nitrile hydratase is used as a catalyst, the addition amount of in vitro nitrile hydratase is preferably 10-10000U per liter of reaction liquid, more preferably 100-5000U, and most preferably 500-1000U; the reaction solution consists of a substrate and water.
In the invention, the temperature of the hydration reaction is preferably 10-50 ℃, more preferably 20-30 ℃, and the pH value of the hydration reaction is preferably 5-10, more preferably 6-8, and most preferably 7.
In the present invention, the method for producing the nitrile hydratase in vitro-expressing cell (genetically engineered bacterium) comprises: constructing a gene for expressing nitrile hydratase into a target plasmid vector, and introducing the gene into an expression host bacterium to obtain a cell for expressing nitrile hydratase in vitro; the target plasmid vector is preferably pET-30a (+), pET-21a (+), pET-22b (+), pET-28a (+), pETDuet-1 or pACYCDuet-1, but is not limited to the vectors, and is preferably pET-28a (+), and the restriction sites are preferably EcoRI/BamHI and HindIII; the expression host bacterium is preferably E.coli, more preferably E.coli BL21(DE 3). The present invention is not particularly limited with respect to the specific method for constructing the gene expressing nitrile hydratase into a target plasmid vector and introducing the gene into an expression host bacterium, and may be carried out by a conventional method in the art.
In the present invention, the nucleotide (gene) sequence (GenBank accession No. AJ511276.1) of the nitrile hydratase derived from the Agrobacterium tumefaciens (Agrobacterium tumefaciens) is shown in SEQ ID No.7, specifically:
atgtcacatgatcatgatcataccgaaccgccgactgagatcgcgctgcgtgtcaaggccctggagtccctgcttacggaaaagggacttgtcgatcccgctgcactcgatgagctcgttgacacgtacgagaacaggatcggaccccgcaacggggcgcttgttgtcgcaaaagcctggacggatcctgcctacaaacaacgcttgctgaccaacgctacggaggcaatcgccgagctcggcttttccggtgttcagggcgaggacatgctggtggtggaaaattcgcccaccgtgcataacatgaccgtctgcacgctttgctcctgctacccctggccgaccctcgggctgccgccggcgtggtacaaatccgcgccctatcgttcccgcgtcgtcatcgatccgcgcggcgtccttgccgaattcggcgtcagcgttcccgccgacaaggaagtccgtgtttgggacagcagcgccgagcttcgctacctggtcctgccagaacgcccggcgggaacggagggctggagcgaagagcagcttgtcgaactcgtgacacgcgattcgatgatcgggaccggctttcccaaaaacccggccgatcttcactaactccaatccaagaaggggaatgagcatgaatggagtacatgatctcggcggaatgcacgggcttggcccgatcgcgccgcctgccgacgagccggtgttcgcccaccagtgggagcggcgcatttttgcgctgttcgttccgttgttcgggggcgggcatttcaatgtcgaccagttccgccacgctatcgagcggatggatccggcgcattatcttcaagggacctactacgagcactggctgcatgcgttcgaaacccttctgatagagggtggtgcaatctcgcgagcggaactcgacgcccggatcaaacagatcggaggggcacagataatggccgtcgtcaccagagatatgatcgagccgattgtcaggaccggcgcctccgctcgcgtcgctgcagacgtcgccgcgagattcaaagtgggcgacacggtccgcgccaaaaatatcaatccgacgacccatacgcggttgccgcgctacgtccgcggcagggtcggaacaatcgagatcgatcacggcgtcttcgtgacgcctgataccgttgcccatggcaagggcgagcatccgcagcatgtctattgcgtgcggttcgccgcagtcgagctttggggttcggatgtttccggcaccgataatgtccgcatcgacttgtgggatgactatctggagaaggcataa。
in the present invention, the nucleotide (gene) sequence (GenBank accession No. AAUW01000001.1) of the nitrile hydratase derived from the staphylococcus aggregatus (Stappia aggregata IAM12614) is shown in SEQ ID No.8, specifically:
atgtccgctcacgaccacgatcatccccacgatcacgaccattccgaattgagcgagatcgagctgcgtgtgcgcgccctggaaacgctgctgacggaaaaggggtacatcgatcctcctgccctggatgaactcatcgagacctacgagacaaaaatcggcccccggaacggcgctctggtggtggcaaaggcctggacggatccggactatcgggaacggctgatgaaagacgcaacggcggccattgccgaacttggtttcaccggccggcagggcgaacacatggtagcggtcgagaataccgacgacattcacaacatggtcgtctgcacgctgtgctcctgttatccatggacagtgctgggcctgccgccggtctggtacaagtctgcgccctaccgctccagagccgtacgcgacccgcgcggcgttctggctgagttcaaggtagaactgcccgatgacaccgagatccgcgtttgggattcgacggcagaaatccggtatctggtgatcccgaaacgtcctgccggaaccgatggctggagcgaagagcgcctcgccgatctggtcacccgcaacagcatgatcggaacgggccttgccctcgatccttcctccctggaggacgcagcatgaacggtgcacaggatctgggcggacagatgggctttggccccattgaactggaagaaaacgagccgaactttcacgccaaatgggaagaacgcgcctttgccgtgacattggccatgggcgcgaccggatcctggacgctggatgcctcgcgctttgcccgcgaatccttgccgccggtcacctacctctcttccagctattacgagatctggacccgcgggcttgaaaaactcctgctctccaacggtctggtcacggaagaagagctgaaggaaggacgcaaacttaaagaggccaagccgatcaagcgtgtgctctcggcggacgctgtcgccggggtcctggcgaagggatcgtcggtcgaccgtgaagagcatcagcctgccaggttccgcaccggtgacagggttaagacacggcgcatgaaccccgaacatcacacccgcctgccccgttacgcccgcgatgccgtcggcacgatcgaggccattcacggcgttcacgtgtttccggacaccaatgcccacggcgaaggcgaacagcctgcctggctctatggcgtcctcttcaagggcactgacatctgggggccggacagcgatcccaagcttaccctgcgcatcgatctctgggagccatatcttgaccttgcccgctga。
in the present invention, the nucleotide (gene) sequence (NCBI accession No. NC — 018700.1) of the nitrile hydratase derived from Sinorhizobium meliloti (Sinorhizobium meliloti) is represented by SEQ ID No.9, which is specifically:
atgtccgaacatcatcatgggcatggcgacgatcacggccatcaccacgacaaccacctgaccgacatggaagcccgggtaaaggcgttggagacggtgctgacggaaaagggtttgatcgatcctgcggcgatcgacgcgatcgtcgacgcgtacgagacgaaggtgggaccgcgaaacggcgcacgcgtcgtcgccaaggcctggagcgatccgggttttgccgattggctgaaacgcgacgcgaccgcggcgatcgccagcctcggctttaccgggcgccagggcgagcacatgcgtgcggtgttcaacacgtccgagacgcacaacctcatcgtctgtacgctgtgctcctgctatccctgggcagtgctggggctgccgccggtctggtacaaggcgccgccctatcgttcgcgcgccgtcatcgatccccgcggcgtgcttgccgaattcgggctcgagctgtcggctgaaaagaaggggactgtcaggaattctgtgcggtgggccatgatgatgaaaaggagagaatcatcacatggctatcgagaaagaacttctggaccagctcctggctggacgtgaatgaacggtccgcatgatctcggcggccagcatggcatgggcccgatcgctccggaacgcaatgagcccattttccatgcagagtgggagaagcgggcgctcggcatcacgctttcctgtggcgctttcggtgcctggacgctggacgaaagccggcacgcgcgcgaaagcctggccccggcgacctatctctccgcgagctattatgaaatctggactcgagccctggaaacgcttctcaagcgccatggcttcgtgacgcaggccgagctcgatgccggccatatgctcgacaaggggcgggagccgaaacgggtgctcacagcggacatggtggccggcgtgctcgccaagggcgggccatgcgaccggccggtcgaagcgccgccgcgctttgccgccggcgacagtgtgcgtacgaagaacttcaatccggagagccacacgcgcctgccgcgctacgcccgcgcccggacaggcatggtggaggccgtgcagggcagcttcgtcttcccggacgacaacgcccacggcaagggcgagaacccgcaatggctctacatggtggtcttcgatgccggcgagatctggggtgagggcgcggacccgacgcttaccgtctccatcgatgcctgggagagctatcttgaacacgcttag。
in the specific implementation process of the invention, a nitrile hydratase gene sequence is synthesized by the whole gene of Shanghai biological engineering technology GmbH, and is constructed on a plasmid vector pET-28a (+), and the restriction enzyme sites are EcoRI/BamHI and HindIII; then the constructed plasmid is introduced into an expression host E.coli BL21(DE3) strain to obtain a genetically engineered bacterium E.coli BL21(DE3)/pET-28a (+) -NHx.
After the genetically engineered bacterium E.coliBL21(DE3)/pET-28a (+) -NHx is obtained, the E.coliBL21(DE3)/pET-28a (+) -NHx is inoculated into a liquid culture medium and cultured until the density OD600 value of the thallus reaches 0.8-1.0, and a culture solution of the genetically engineered bacterium is obtained; the liquid culture medium takes water as a solvent and comprises the following components: 10g/L of peptone, 5g/L of yeast extract and 10g/L of NaCl; the pH value of the liquid culture medium is preferably 7.0; the culture temperature is preferably 35-40 ℃, and the culture rotation speed is preferably 180-220 rpm.
The genetically engineered bacterium E.coliBL21(DE3)/pET-28a (+) -NHx can efficiently express nitrile hydratase protein under the conventional IPTG induction condition; the final concentration of IPTG is preferably 0.5 mM.
In the catalytic reaction system of the invention, the catalyst is used in the form of crude enzyme liquid after the cells of the genetically engineered bacteria are crushed, engineering bacteria resting cells expressing recombinase, purified pure enzyme or immobilized enzyme.
In the present invention, the medium for the hydration reaction is preferably pure water or an aqueous solution to which a buffer salt is added; the buffer salt is preferably Tris-HCl; the concentration of Tris-HCl is preferably 50 mM.
The technical solution of the present invention will be clearly and completely described below with reference to the embodiments of the present invention. It is to be understood that the described embodiments are merely exemplary of the invention, and not restrictive of the full scope of the invention. All other embodiments, which can be derived by a person skilled in the art from the embodiments given herein without making any creative effort, shall fall within the protection scope of the present invention.
The materials and methods in the examples were:
the experimental methods in the present invention are conventional methods unless otherwise specified, and can be specifically referred to the molecular cloning experimental guidelines compiled by J. SammBruk et al.
The restriction enzyme DNA ligase and other tool enzymes used in the embodiment of the invention are all purchased from TaKaRa, Takara Bio engineering (Dalian) Co., Ltd; the genome extraction kit, the plasmid extraction kit and the DNA recovery and purification kit are purchased from Axygen Hangzhou limited company; coli DH5 α, E.coli BL21(DE3), plasmids pET-30a (+), pET-21a (+), pET-22b (+) and the like were purchased from Novagen; DNAmarker, FastPFuDNA polymerase, low molecular weight standard protein and agarose electrophoresis reagent are purchased from Beijing all-style gold biotechnology limited; the gene synthesis and sequence sequencing work is completed by Shanghai Bioengineering technology, Inc. The method of using the above reagent is referred to the commercial specification. The raw materials of the cyanopyrazines are all purchased from Zhejiang Hengkang pharmaceutical industry, Inc. (China).
Example 1
First, acquisition of nitrile hydratase Gene
The reported amino acid sequences of the cobalt-type nitrile hydratase are collected, and the nitrile hydratase is subjected to multiple sequence alignment by the method of ClustalW2 (http:// www.ebi.ac.uk/Tools/msa/ClustalW2) to determine the conserved regions in the sequences. And taking the amino acid sequence of the conserved region as a molecular probe for subsequent search of nitrile hydratase genes in a gene information database. A conserved amino acid sequence-CTLCSC-in the alpha subunit of the reported nitrile hydratase is selected as a molecular probe by aligning the amino acid sequences, and the GenBank bioinformatic data (https:// www.ncbi.nlm.nih.gov/GenBank /) is searched for homologous sequences using the BasiclocalAlignmentSearchTool (http:// blast.ncbi.nlm.nih.gov). Genes reported and annotated as nitrile hydratase after whole genome sequencing were selected. The amino acid sequences of the searched nitrile hydratases are respectively collected, multi-sequence alignment is carried out by a ClustalW2 method, the amino acid sequences with the similarity of more than 95 percent are removed, and the specific information of the obtained nitrile hydratases is shown in Table 1.
TABLE 1 nitrile hydratase enzyme library information
Figure BDA0002552223980000111
Figure BDA0002552223980000121
Second, construction of a Strain expressing nitrile hydratase Gene
The nitrile hydratase gene sequence is submitted to a gene synthesis company for complete gene synthesis, and is constructed on a plasmid vector pET-28a (+), and the restriction enzyme cutting sites are EcoRI/BamHI and HindIII; and then introducing the constructed plasmid into an expression host E.coliBL21(DE3) strain, namely the genetic engineering strain E.coliBL21(DE3)/pET-28a (+) -NHx.
If the nitrile hydratase gene is constructed on other expression plasmids, a plasmid pET-28a (+) can be extracted, the target gene fragment and the target empty plasmid which are purified and recovered after double enzyme digestion are respectively subjected to double enzyme digestion by using corresponding restriction enzymes, and the enzyme digestion conditions and the system are shown in Table 2; then, the target gene fragment was ligated to the target plasmid using T4DNA ligase, and the ligation system is shown in Table 3.
TABLE 2 double restriction systems and conditions
Figure BDA0002552223980000131
TABLE 3 construction of ligation System of recombinant expression plasmids
Figure BDA0002552223980000132
III, recombinant expression of nitrile hydratase
The engineering bacteria which are successfully constructed are inoculated in 5mL of liquid culture medium, and shake culture is carried out for 10h at 200rpm in a shaking table at 37 ℃. Inoculating the cultured culture solution into a fresh liquid culture medium according to the inoculation amount of 10%. Shaking and culturing in a shaker at 37 ℃ at 200rpm for 2-3 h, cooling to 18 ℃ when the OD600 value of the thallus density reaches 0.8, and adding IPTG until the final concentration is 0.5 mM. The flask was then transferred to a shaker at 18 ℃ and incubated for a further 16h at 200 rpm.
Fourthly, enzyme activity determination of recombinant nitrile hydratase
The enzyme activity of the recombinant nitrile hydratase is detected by taking 6-fluoro-3-hydroxy-2-cyanopyrazine as a substrate, and specific operation steps and a detection method are as follows in consideration of different optimal pH values and temperatures of the recombinant nitrile hydratase.
The activity of the recombinant nitrile hydratase is determined by a total reaction system of 5.0mL, a phosphate buffer solution (100mM, pH7.0), a substrate of 5mM, and an appropriate amount of engineering bacteria cells for expressing nitrile hydratase, shaking the reaction at 25 ℃ for 60min, sampling 500. mu.L, immediately adding 500. mu.L of pure acetonitrile to terminate the reaction, centrifuging the reaction mixture for 5min at 12,000 000 × g to remove cells and enzyme proteins, determining 6-fluoro-3-hydroxy-2-amide pyrazine generated in the reaction system by high performance liquid chromatography, using a C18 column (5. mu.m, 4.6 × 250mM, Agilent) as a mobile phase of 10mMKH2PO4Buffer solution: acetonitrile 8:2(v/v) and flow rate 0.5 mL/min. And detecting by using a UV detector, wherein the detection wavelength is 225 nm. The analysis spectrum is shown in figure 2, and the 6-fluoro-3-hydroxy-2-amide pyrazine and the 6-fluoro-3-hydroxy-2-cyano pyrazine are sequentially arranged according to the order of the peak appearance time, and the retention time is 11.2min and 16.5min respectively. Definition of enzyme activity: at 25 ℃, the enzyme amount which can convert the substrate (6-fluoro-3-hydroxy-2-cyanopyrazine) into 1 mu mol of the product (6-fluoro-3-hydroxy-2-amidopyrazine) is 1U in 1 min.The activity of all the recombinant nitrile hydratases was measured, and the results are shown in Table 4. As can be seen from Table 4, only three nitrile hydratases (NH16, NH25, NH27) derived from Agrobacterium tumefaciens (Agrobacterium tumefaciens), Staphylococcus aggregatus (Stappia aggregata IAM12614) and Sinorhizobium meliloti (Sinorhizobium meliloti) have corresponding catalytic activities.
TABLE 4 determination of nitrile hydratase Activity
Figure BDA0002552223980000141
Figure BDA0002552223980000151
Example 2 Gene engineering bacteria catalyze 2-cyanopyrazine to produce 2-amide pyrazine
25ml of the fermentation broth of the engineered bacterium E.coliBL21(DE3)/pET-28a (+) -NH16 constructed in example 1 was centrifuged at 12000rpm for 10min to collect the cells, and then 250ml of a 50mM Tris-HCl (pH8.0) buffer was used to resuspend the collected cells, and the enzyme activity of the resuspended enzyme solution was 10U/ml. 1.0g of 2-cyanopyrazine was added to the resuspended solution, and hydration reaction was carried out at 20 ℃ for 24 hours. And then detecting the contents of the 2-cyanopyrazine, the 2-amidopyrazine and the 2-carboxypyrazine in the reaction system by using a liquid chromatography. The conversion rate of the substrate is more than 99 percent, the yield of the 2-amide pyrazine is more than 92 percent, and the generation of the 2-carboxyl pyrazine is not found in the reaction system.
Example 3 genetically engineered bacteria catalyze the formation of 3-methyl-2-amidopyrazine from 3-methyl-2-cyanopyrazine
The cells were collected by centrifugation at 12000rpm for 10min using 25ml of a fermentation broth of the engineered bacterium E.coliBL21(DE3)/pET-28a (+) -NH27 constructed in example 1, and then resuspended in 250ml of 50mM Tris-HCl (pH 6.0). 0.5g of 3-methyl-2-cyanopyrazine was added to the resuspended solution, and hydration reaction was carried out at 30 ℃ for 120 hours. And then detecting the content of the 3-methyl-2-cyano pyrazine and the 3-methyl-2-amide pyrazine in the reaction system by using a high performance liquid chromatography. The substrate conversion rate is more than 99 percent, and the yield of the 3-methyl-2-amide pyrazine is more than 89 percent.
Example 4 genetically engineered bacteria catalyze the formation of 6-methyl-2-aminopyrazine from 6-methyl-2-cyanopyrazine
The cells were collected by centrifugation at 12000rpm for 10min using 25ml of a fermentation broth of the engineered bacterium E.coliBL21(DE3)/pET-28a (+) -NH25 constructed in example 1, and then resuspended in 10ml of 50mM Tris-HCl (pH7.5) buffer. 1.0g of 6-methyl-2-cyanopyrazine was added to the resuspended solution, and hydration reaction was carried out at 25 ℃ for 12 hours. And then detecting the contents of the 6-methyl-2-cyanopyrazine and the 6-methyl-2-amide pyrazine in the reaction system by using a high performance liquid chromatography. The substrate conversion rate is more than 99%, and the yield of 6-methyl-2 amide pyrazine is more than 99%.
Example 5 genetically engineered bacteria catalyze the formation of 6-methyl-3-hydroxy-2-pyrazinamide from 6-methyl-3-hydroxy-2-pyrazinamide
The cells were collected by centrifugation at 12000rpm for 10min using 25ml of a fermentation broth of the engineered bacterium E.coliBL21(DE3)/pET-28a (+) -NH25 constructed in example 1, and then resuspended in 250ml of 50mM Tris-HCl (pH 8.0). 0.6g of 6-methyl-3-hydroxy-2-cyanopyrazine was added to the resuspended solution, and hydration reaction was carried out at 30 ℃ for 26 hours. And then detecting the contents of the 6-methyl-3-hydroxy-2-cyanopyrazine and the 6-methyl-3-hydroxy-2-amide pyrazine in the reaction system by using a high performance liquid chromatography. The substrate conversion rate is more than 99 percent, and the yield of the 6-methyl-3-hydroxy-2-amide pyrazine is more than 99 percent.
Example 6 genetically engineered bacteria catalyze the formation of 6-bromo-3-amino-2-amidopyrazine from 6-bromo-3-amino-2-amidopyrazine
The cells were collected by centrifugation at 12000rpm for 10min using 25ml of a fermentation broth of the engineered bacterium E.coliBL21(DE3)/pET-30a (+) -NH25 constructed in example 1, and then resuspended in 25ml of 50mM Tris-HCl (pH 7.0). 0.5g of 6-bromo-3-amino-2-cyanopyrazine was added to the resuspended solution, and hydration reaction was carried out at 35 ℃ for 48 hours. And then detecting the contents of the 6-bromo-3-amino-2-cyanopyrazine and the 6-bromo-3-amino-2-amidopyrazine in the reaction system by using a high performance liquid chromatography. The conversion rate of the substrate is more than 99 percent, and the yield of the 6-bromo-3-amino-2-amide pyrazine is more than 99 percent.
Example 7 genetic engineering bacteria catalyze 6-fluoro-3-hydroxy-2-cyanopyrazine to form 6-fluoro-3-hydroxy-2-amidopyrazine
The cells were collected by centrifugation at 12000rpm for 10min using 25ml of a fermentation broth of the engineered bacterium E.coliBL21(DE3)/pET-21a (+) -NH25 constructed in example 1, and then resuspended in 250ml of 50mM Tris-HCl (pH 7.0). 0.75g of 6-fluoro-3-hydroxy-2-cyanopyrazine was added to the resuspended solution, and hydration reaction was carried out at 25 ℃ for 18 hours. And then detecting the contents of the 6-fluoro-3-hydroxy-2-cyanopyrazine and the 6-fluoro-3-hydroxy-2-amidopyrazine in the reaction system by using a high performance liquid chromatography. The substrate conversion rate is more than 99 percent, and the yield of the 6-fluoro-3-hydroxy-2-amide pyrazine is more than 99 percent.
Example 8 genetic engineering bacteria catalyze 6-chloro-3-hydroxy-2-cyanopyrazine to 6-chloro-3-hydroxy-2-amide pyrazine
25ml of the fermentation broth of the engineered bacterium E.coliBL21(DE3)/pET-22b (+) -NH25 constructed in example 1 was centrifuged at 12000rpm for 10min to collect the cells, 250ml of a 50mM Tris-HCl (pH7.0) buffer solution was used to resuspend and sonicate the collected cells to obtain an in vitro crude enzyme solution of in vitro nitrile hydratase NH25, and the enzyme activity of the nitrile hydratase was measured to be 1035.16U/L. 0.75g of 6-chloro-3-hydroxy-2-cyanopyrazine was added to the crude enzyme solution, and hydration reaction was carried out at 40 ℃ for 23 hours. And then detecting the contents of the 6-chloro-3-hydroxy-2-cyanopyrazine and the 6-chloro-3-hydroxy-2-amidopyrazine in the reaction system by using a high performance liquid chromatography. The substrate conversion rate is more than 99 percent, and the yield of the 6-chloro-3-hydroxy-2-amide pyrazine is more than 99 percent.
Example 9 Gene engineering bacteria catalyzed 6-bromo-3-hydroxy-2-cyanopyrazine to 6-bromo-3-hydroxy-2-amidopyrazine
The cells were collected by centrifugation at 12000rpm for 10min using 25ml of the fermentation broth of the engineered bacterium E.coliBL21(DE3)/pETDuet-NH25 constructed in example 1, and then resuspended in 10ml of 50mM Tris-HCl (pH 7.0). 0.75g of 6-bromo-3-hydroxy-2-cyanopyrazine was added to the resuspended solution, and hydration reaction was carried out at 20 ℃ for 54 hours. And then detecting the contents of the 6-bromo-3-hydroxy-2-cyanopyrazine and the 6-bromo-3-hydroxy-2-amidopyrazine in the reaction system by using a high performance liquid chromatography. The conversion rate of the substrate is more than 99 percent, and the yield of the 6-bromo-3-hydroxy-2-amide pyrazine is more than 99 percent.
Example 10 genetic engineering bacteria catalyze 6-iodo-3-hydroxy-2-cyanopyrazine to form 6-iodo-3-hydroxy-2-amidopyrazinyl
25ml of the fermentation broth of the engineered bacterium E.coliBL21(DE3)/pACYCDuet-NH25 constructed in example 1 was centrifuged at 12000rpm for 10min to collect the cells, and then 250ml of 50mM Tris-HCl (pH7.0) buffer was used to resuspend the collected cells. 0.75g of 6-iodo-3-hydroxy-2-cyanopyrazine was added to the resuspended solution, and hydration reaction was carried out at 20 ℃ for 103 hours. And then detecting the contents of the 6-iodo-3-hydroxy-2-cyanopyrazine and the 6-iodo-3-hydroxy-2-amidopyrazine in the reaction system by using a high performance liquid chromatography. The substrate conversion rate is more than 99 percent, and the yield of the 6-iodo-3-hydroxy-2-amide pyrazine is more than 99 percent.
Comparative example 1
The cells were collected by centrifugation at 12000rpm for 10min using 25ml of a fermentation broth of the engineered bacterium E.coliBL21(DE3)/pET-28a (+) -NH4 constructed in example 1, and then resuspended in 250ml of 50mM Tris-HCl (pH 7.0). 0.75g of 6-fluoro-3-hydroxy-2-cyanopyrazine was added to the resuspended solution, and hydration reaction was carried out at 25 ℃ for 120 hours. And then detecting the contents of the 6-fluoro-3-hydroxy-2-cyanopyrazine and the 6-fluoro-3-hydroxy-2-amidopyrazine in the reaction system by using a high performance liquid chromatography, wherein the generation of the product is not monitored.
The foregoing is only a preferred embodiment of the present invention, and it should be noted that, for those skilled in the art, various modifications and decorations can be made without departing from the principle of the present invention, and these modifications and decorations should also be regarded as the protection scope of the present invention.
Sequence listing
<110> Zhejiang Hengkang pharmaceutical industry Co., Ltd
Application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compound to generate amide pyrazine compound
<160>9
<170>SIPOSequenceListing 1.0
<210>1
<211>204
<212>PRT
<213> Agrobacterium tumefaciens (Agrobacterium tumefaciens)
<400>1
Met Ser His Asp His Asp His Thr Glu Pro Pro Thr Glu Ile Ala Leu
1 5 10 15
Arg Val Lys Ala Leu Glu Ser Leu Leu Thr Glu Lys Gly Leu Val Asp
20 25 30
Pro Ala Ala Leu Asp Glu Leu Val Asp Thr Tyr Glu Asn Arg Ile Gly
35 40 45
Pro Arg Asn Gly Ala Leu Val Val Ala Lys Ala Trp Thr Asp Pro Ala
50 55 60
Tyr Lys Gln Arg Leu Leu Thr Asn Ala Thr Glu Ala Ile Ala Glu Leu
65 70 75 80
Gly Phe Ser Gly Val Gln Gly Glu Asp Met Leu Val Val Glu Asn Ser
85 90 95
Pro Thr Val His Asn Met Thr Val Cys Thr Leu Cys Ser Cys Tyr Pro
100 105 110
Trp Pro Thr Leu Gly Leu Pro Pro Ala Trp Tyr Lys Ser Ala Pro Tyr
115 120 125
Arg Ser Arg Val Val Ile Asp Pro Arg Gly Val Leu Ala Glu Phe Gly
130 135 140
Val Ser Val Pro Ala Asp Lys Glu Val Arg Val Trp Asp Ser Ser Ala
145 150 155 160
Glu Leu Arg Tyr Leu Val Leu Pro Glu Arg Pro Ala Gly Thr Glu Gly
165 170 175
Trp Ser Glu Glu Gln Leu Val Glu Leu Val Thr Arg Asp Ser Met Ile
180 185 190
Gly Thr Gly Phe Pro Lys Asn Pro Ala Asp Leu His
195 200
<210>2
<211>219
<212>PRT
<213> Agrobacterium tumefaciens (Agrobacterium tumefaciens)
<400>2
Met Asn Gly Val His Asp Leu Gly Gly Met His Gly Leu Gly Pro Ile
1 5 10 15
Ala Pro Pro Ala Asp Glu Pro Val Phe Ala His Gln Trp Glu Arg Arg
20 25 30
Ile Phe Ala Leu Phe Val Pro Leu Phe Gly Gly Gly His Phe Asn Val
35 40 45
Asp Gln Phe Arg His Ala Ile Glu Arg Met Asp Pro Ala His Tyr Leu
50 55 60
Gln Gly Thr Tyr Tyr Glu His Trp Leu His Ala Phe Glu Thr Leu Leu
65 70 75 80
Ile Glu Gly Gly Ala Ile Ser Arg Ala Glu Leu Asp Ala Arg Ile Lys
85 90 95
Gln Ile Gly Gly Ala Gln Ile Met Ala Val Val Thr Arg Asp Met Ile
100 105 110
Glu Pro Ile Val Arg Thr Gly Ala Ser Ala Arg Val Ala Ala Asp Val
115 120 125
Ala Ala Arg Phe Lys Val Gly Asp Thr Val Arg Ala Lys Asn Ile Asn
130 135 140
Pro Thr Thr His Thr Arg Leu Pro Arg Tyr Val Arg Gly Arg Val Gly
145 150 155 160
Thr Ile Glu Ile Asp His Gly Val Phe Val Thr Pro Asp Thr Val Ala
165 170 175
His Gly Lys Gly Glu His Pro Gln His Val Tyr Cys Val Arg Phe Ala
180 185 190
Ala Val Glu Leu Trp Gly Ser Asp Val Ser Gly Thr Asp Asn Val Arg
195 200 205
Ile Asp Leu Trp Asp Asp Tyr Leu Glu Lys Ala
210 215
<210>3
<211>213
<212>PRT
<213> Staphylococcus aggregative (Stappia aggregatataI AM12614)
<400>3
Met Ser Ala His Asp His Asp His Pro His Asp His Asp His Ser Glu
1 5 10 15
Leu Ser Glu Ile Glu Leu Arg Val Arg Ala Leu Glu Thr Leu Leu Thr
20 25 30
Glu Lys Gly Tyr Ile Asp Pro Pro Ala Leu Asp Glu Leu Ile Glu Thr
35 40 45
Tyr Glu Thr Lys Ile Gly Pro Arg Asn Gly Ala Leu Val Val Ala Lys
50 55 60
Ala Trp Thr Asp Pro Asp Tyr Arg Glu Arg Leu Met Lys Asp AlaThr
65 70 75 80
Ala Ala Ile Ala Glu Leu Gly Phe Thr Gly Arg Gln Gly Glu His Met
85 90 95
Val Ala Val Glu Asn Thr Asp Asp Ile His Asn Met Val Val Cys Thr
100 105 110
Leu Cys Ser Cys Tyr Pro Trp Thr Val Leu Gly Leu Pro Pro Val Trp
115 120 125
Tyr Lys Ser Ala Pro Tyr Arg Ser Arg Ala Val Arg Asp Pro Arg Gly
130 135 140
Val Leu Ala Glu Phe Lys Val Glu Leu Pro Asp Asp Thr Glu Ile Arg
145 150 155 160
Val Trp Asp Ser Thr Ala Glu Ile Arg Tyr Leu Val Ile Pro Lys Arg
165 170 175
Pro Ala Gly Thr Asp Gly Trp Ser Glu Glu Arg Leu Ala Asp Leu Val
180 185 190
Thr Arg Asn Ser Met Ile Gly Thr Gly Leu Ala Leu Asp Pro Ser Ser
195 200 205
Leu Glu Asp Ala Ala
210
<210>4
<211>220
<212>PRT
<213> Staphylococcus aggregative (Stappia aggregatataI AM12614)
<400>4
Met Asn Gly Ala Gln Asp Leu Gly Gly Gln Met Gly Phe Gly Pro Ile
1 5 10 15
Glu Leu Glu Glu Asn Glu Pro Asn Phe His Ala Lys Trp Glu Glu Arg
20 25 30
Ala Phe Ala Val Thr Leu Ala Met Gly Ala Thr Gly Ser Trp Thr Leu
35 40 45
Asp Ala Ser Arg Phe Ala Arg Glu Ser Leu Pro Pro Val Thr Tyr Leu
50 55 60
Ser Ser Ser Tyr Tyr Glu Ile Trp Thr Arg Gly Leu Glu Lys Leu Leu
65 70 75 80
Leu Ser Asn Gly Leu Val Thr Glu Glu Glu Leu Lys Glu Gly Arg Lys
85 90 95
Leu Lys Glu Ala Lys Pro Ile Lys Arg Val Leu Ser Ala Asp Ala Val
100 105 110
Ala Gly Val Leu Ala Lys Gly Ser Ser Val Asp Arg Glu Glu His Gln
115 120 125
Pro Ala Arg Phe Arg Thr Gly Asp Arg Val Lys Thr Arg Arg Met Asn
130 135 140
Pro Glu His His Thr Arg Leu Pro Arg Tyr Ala ArgAsp Ala Val Gly
145 150 155 160
Thr Ile Glu Ala Ile His Gly Val His Val Phe Pro Asp Thr Asn Ala
165 170 175
His Gly Glu Gly Glu Gln Pro Ala Trp Leu Tyr Gly Val Leu Phe Lys
180 185 190
Gly Thr Asp Ile Trp Gly Pro Asp Ser Asp Pro Lys Leu Thr Leu Arg
195 200 205
Ile Asp Leu Trp Glu Pro Tyr Leu Asp Leu Ala Arg
210 215 220
<210>5
<211>195
<212>PRT
<213> Sinorhizobium meliloti (Sinorhizobium meliloti)
<400>5
Met Ser Glu His His His Gly His Gly Asp Asp His Gly His His His
1 5 10 15
Asp Asn His Leu Thr Asp Met Glu Ala Arg Val Lys Ala Leu Glu Thr
20 25 30
Val Leu Thr Glu Lys Gly Leu Ile Asp Pro Ala Ala Ile Asp Ala Ile
35 40 45
Val Asp Ala Tyr Glu Thr Lys Val Gly Pro Arg Asn Gly Ala Arg Val
50 55 60
Val Ala Lys Ala Trp Ser Asp Pro Gly Phe Ala Asp Trp Leu Lys Arg
65 70 75 80
Asp Ala Thr Ala Ala Ile Ala Ser Leu Gly Phe Thr Gly Arg Gln Gly
85 90 95
Glu His Met Arg Ala Val Phe Asn Thr Ser Glu Thr His Asn Leu Ile
100 105 110
Val Cys Thr Leu Cys Ser Cys Tyr Pro Trp Ala Val Leu Gly Leu Pro
115 120 125
Pro Val Trp Tyr Lys Ala Pro Pro Tyr Arg Ser Arg Ala Val Ile Asp
130 135 140
Pro Arg Gly Val Leu Ala Glu Phe Gly Leu Glu Leu Ser Ala Glu Lys
145 150 155 160
Lys Gly Thr Val Arg Asn Ser Val Arg Trp Ala Met Met Met Lys Arg
165 170 175
Arg Glu Ser Ser His Gly Tyr Arg Glu Arg Thr Ser Gly Pro Ala Pro
180 185 190
Gly Trp Thr
195
<210>6
<211>219
<212>PRT
<213> Sinorhizobium meliloti (Sinorhizobium meliloti)
<400>6
Met Asn Gly Pro His Asp Leu Gly Gly Gln His Gly Met Gly Pro Ile
1 5 10 15
Ala Pro Glu Arg Asn Glu Pro Ile Phe His Ala Glu Trp Glu Lys Arg
20 25 30
Ala Leu Gly Ile Thr Leu Ser Cys Gly Ala Phe Gly Ala Trp Thr Leu
35 40 45
Asp Glu Ser Arg His Ala Arg Glu Ser Leu Ala Pro Ala Thr Tyr Leu
50 55 60
Ser Ala Ser Tyr Tyr Glu Ile Trp Thr Arg Ala Leu Glu Thr Leu Leu
65 70 75 80
Lys Arg His Gly Phe Val Thr Gln Ala Glu Leu Asp Ala Gly His Met
85 90 95
Leu Asp Lys Gly Arg Glu Pro Lys Arg Val Leu Thr Ala Asp Met Val
100 105 110
Ala Gly Val Leu Ala Lys Gly Gly Pro Cys Asp Arg Pro Val Glu Ala
115 120 125
Pro Pro Arg Phe Ala Ala Gly Asp Ser Val Arg Thr Lys Asn Phe Asn
130 135 140
Pro Glu Ser His Thr Arg Leu Pro Arg Tyr Ala Arg Ala Arg Thr Gly
145 150 155160
Met Val Glu Ala Val Gln Gly Ser Phe Val Phe Pro Asp Asp Asn Ala
165 170 175
His Gly Lys Gly Glu Asn Pro Gln Trp Leu Tyr Met Val Val Phe Asp
180 185 190
Ala Gly Glu Ile Trp Gly Glu Gly Ala Asp Pro Thr Leu Thr Val Ser
195 200 205
Ile Asp Ala Trp Glu Ser Tyr Leu Glu His Ala
210 215
<210>7
<211>1300
<212>DNA
<213> Agrobacterium tumefaciens (Agrobacterium tumefaciens)
<400>7
atgtcacatg atcatgatca taccgaaccg ccgactgaga tcgcgctgcg tgtcaaggcc 60
ctggagtccc tgcttacgga aaagggactt gtcgatcccg ctgcactcga tgagctcgtt 120
gacacgtacg agaacaggat cggaccccgc aacggggcgc ttgttgtcgc aaaagcctgg 180
acggatcctg cctacaaaca acgcttgctg accaacgcta cggaggcaat cgccgagctc 240
ggcttttccg gtgttcaggg cgaggacatg ctggtggtgg aaaattcgcc caccgtgcat 300
aacatgaccg tctgcacgct ttgctcctgc tacccctggc cgaccctcgg gctgccgccg 360
gcgtggtaca aatccgcgcc ctatcgttcc cgcgtcgtca tcgatccgcg cggcgtcctt 420
gccgaattcg gcgtcagcgt tcccgccgac aaggaagtcc gtgtttggga cagcagcgcc 480
gagcttcgct acctggtcct gccagaacgc ccggcgggaa cggagggctg gagcgaagag 540
cagcttgtcg aactcgtgac acgcgattcg atgatcggga ccggctttcc caaaaacccg 600
gccgatcttc actaactcca atccaagaag gggaatgagc atgaatggag tacatgatct 660
cggcggaatg cacgggcttg gcccgatcgc gccgcctgcc gacgagccgg tgttcgccca 720
ccagtgggag cggcgcattt ttgcgctgtt cgttccgttg ttcgggggcg ggcatttcaa 780
tgtcgaccag ttccgccacg ctatcgagcg gatggatccg gcgcattatc ttcaagggac 840
ctactacgag cactggctgc atgcgttcga aacccttctg atagagggtg gtgcaatctc 900
gcgagcggaa ctcgacgccc ggatcaaaca gatcggaggg gcacagataa tggccgtcgt 960
caccagagat atgatcgagc cgattgtcag gaccggcgcc tccgctcgcg tcgctgcaga 1020
cgtcgccgcg agattcaaag tgggcgacac ggtccgcgcc aaaaatatca atccgacgac 1080
ccatacgcgg ttgccgcgct acgtccgcgg cagggtcgga acaatcgaga tcgatcacgg 1140
cgtcttcgtg acgcctgata ccgttgccca tggcaagggc gagcatccgc agcatgtcta 1200
ttgcgtgcgg ttcgccgcag tcgagctttg gggttcggat gtttccggca ccgataatgt 1260
ccgcatcgac ttgtgggatg actatctgga gaaggcataa 1300
<210>8
<211>1301
<212>DNA
<213> Staphylococcus aggregatus (Stappia aggregata IAM12614)
<400>8
atgtccgctc acgaccacga tcatccccac gatcacgacc attccgaatt gagcgagatc 60
gagctgcgtg tgcgcgccct ggaaacgctg ctgacggaaa aggggtacat cgatcctcct 120
gccctggatg aactcatcga gacctacgag acaaaaatcg gcccccggaa cggcgctctg 180
gtggtggcaa aggcctggac ggatccggac tatcgggaac ggctgatgaa agacgcaacg 240
gcggccattg ccgaacttgg tttcaccggc cggcagggcg aacacatggt agcggtcgag 300
aataccgacg acattcacaa catggtcgtc tgcacgctgt gctcctgtta tccatggaca 360
gtgctgggcc tgccgccggt ctggtacaag tctgcgccct accgctccag agccgtacgc 420
gacccgcgcg gcgttctggc tgagttcaag gtagaactgc ccgatgacac cgagatccgc 480
gtttgggatt cgacggcaga aatccggtat ctggtgatcc cgaaacgtcc tgccggaacc 540
gatggctgga gcgaagagcg cctcgccgat ctggtcaccc gcaacagcat gatcggaacg 600
ggccttgccc tcgatccttc ctccctggag gacgcagcat gaacggtgca caggatctgg 660
gcggacagat gggctttggc cccattgaac tggaagaaaa cgagccgaac tttcacgcca 720
aatgggaaga acgcgccttt gccgtgacat tggccatggg cgcgaccgga tcctggacgc 780
tggatgcctc gcgctttgcc cgcgaatcct tgccgccggt cacctacctc tcttccagct 840
attacgagat ctggacccgc gggcttgaaa aactcctgct ctccaacggt ctggtcacgg 900
aagaagagct gaaggaagga cgcaaactta aagaggccaa gccgatcaag cgtgtgctct 960
cggcggacgc tgtcgccggg gtcctggcga agggatcgtc ggtcgaccgt gaagagcatc 1020
agcctgccag gttccgcacc ggtgacaggg ttaagacacg gcgcatgaac cccgaacatc 1080
acacccgcct gccccgttac gcccgcgatg ccgtcggcac gatcgaggcc attcacggcg 1140
ttcacgtgtt tccggacacc aatgcccacg gcgaaggcga acagcctgcc tggctctatg 1200
gcgtcctctt caagggcact gacatctggg ggccggacag cgatcccaag cttaccctgc 1260
gcatcgatct ctgggagcca tatcttgacc ttgcccgctg a 1301
<210>9
<211>1248
<212>DNA
<213> Sinorhizobium meliloti (Sinorhizobium meliloti)
<400>9
atgtccgaac atcatcatgg gcatggcgac gatcacggcc atcaccacga caaccacctg 60
accgacatgg aagcccgggt aaaggcgttg gagacggtgc tgacggaaaa gggtttgatc 120
gatcctgcgg cgatcgacgc gatcgtcgac gcgtacgaga cgaaggtggg accgcgaaac 180
ggcgcacgcg tcgtcgccaa ggcctggagc gatccgggtt ttgccgattg gctgaaacgc 240
gacgcgaccg cggcgatcgc cagcctcggc tttaccgggc gccagggcga gcacatgcgt 300
gcggtgttca acacgtccga gacgcacaac ctcatcgtct gtacgctgtg ctcctgctat 360
ccctgggcag tgctggggct gccgccggtc tggtacaagg cgccgcccta tcgttcgcgc 420
gccgtcatcg atccccgcgg cgtgcttgcc gaattcgggc tcgagctgtc ggctgaaaag 480
aaggggactg tcaggaattc tgtgcggtgg gccatgatga tgaaaaggag agaatcatca 540
catggctatc gagaaagaac ttctggacca gctcctggct ggacgtgaat gaacggtccg 600
catgatctcg gcggccagca tggcatgggc ccgatcgctc cggaacgcaa tgagcccatt 660
ttccatgcag agtgggagaa gcgggcgctc ggcatcacgc tttcctgtgg cgctttcggt 720
gcctggacgc tggacgaaag ccggcacgcg cgcgaaagcc tggccccggc gacctatctc 780
tccgcgagct attatgaaat ctggactcga gccctggaaa cgcttctcaa gcgccatggc 840
ttcgtgacgc aggccgagct cgatgccggc catatgctcg acaaggggcg ggagccgaaa 900
cgggtgctca cagcggacat ggtggccggc gtgctcgcca agggcgggcc atgcgaccgg 960
ccggtcgaag cgccgccgcg ctttgccgcc ggcgacagtg tgcgtacgaa gaacttcaat 1020
ccggagagcc acacgcgcct gccgcgctac gcccgcgccc ggacaggcat ggtggaggcc 1080
gtgcagggca gcttcgtctt cccggacgac aacgcccacg gcaagggcga gaacccgcaa 1140
tggctctaca tggtggtctt cgatgccggc gagatctggg gtgagggcgc ggacccgacg 1200
cttaccgtct ccatcgatgc ctgggagagc tatcttgaac acgcttag 1248

Claims (8)

1. The application of nitrile hydratase in catalyzing the hydration reaction of cyano-pyrazine compounds to generate amide pyrazine compounds; the nitrile hydratase is derived from Agrobacterium tumefaciens (Agrobacterium tumefaciens), Staphylococcus aggregatus (Stappiaggregata IAM12614) or Sinorhizobium meliloti (Sinorhizobium meliloti).
2. The use according to claim 1, wherein the amino acid sequence of the α subunit of nitrile hydratase derived from Agrobacterium tumefaciens (Agrobacterium tumefaciens) is represented by SEQ ID No.1, and the amino acid sequence of the β subunit is represented by SEQ ID No. 2; the amino acid sequence of the alpha subunit of the nitrile hydratase derived from the Staphylococcus aggregatus (Stappia aggregata IAM12614) is shown as SEQ ID NO.3, and the amino acid sequence of the beta subunit is shown as SEQ ID NO. 4; the amino acid sequence of the alpha subunit of the nitrile hydratase derived from Sinorhizobium meliloti (Sinorhizobium meliloti) is shown as SEQ ID NO.5, and the amino acid sequence of the beta subunit is shown as SEQ ID NO. 6.
3. The use according to claim 1, wherein the cyanopyrazine compound has the formula I; the chemical formula of the amide pyrazine compound is shown as a formula II;
Figure FDA0002552223970000011
in formula I and formula II:
R1selected from H, CH3F, Cl, Br, or I;
R2selected from H, NH2Or OH.
4. Use according to claim 3, wherein the cyanopyrazine-based compound comprises 2-cyanopyrazine, 3-methyl-2-cyanopyrazine, 6-methyl-3-hydroxy-2-cyanopyrazine, 6-bromo-3-amino-2-cyanopyrazine, 6-fluoro-3-hydroxy-2-cyanopyrazine, 6-chloro-3-hydroxy-2-cyanopyrazine, 6-bromo-3-hydroxy-2-cyanopyrazine or 6-iodo-3-hydroxy-2-cyanopyrazine.
5. The use according to any one of claims 1 to 4, characterized in that it comprises the following steps: taking a cyanopyrazine compound as a substrate, and carrying out hydration reaction in an aqueous solution by using isolated nitrile hydratase or cells for expressing the nitrile hydratase in vitro as a catalyst to obtain the amide pyrazine compound.
6. The use according to claim 5, wherein the concentration of the substrate in water is 2 to 100 g/L; when the cells expressing nitrile hydratase in vitro are used as a catalyst, the adding amount of the catalyst is calculated by the wet weight of the cells after centrifugation at 12000rpm for 10min, and the adding amount of the cells is 1-20% of the weight of the reaction solution; when in vitro nitrile hydratase is used as a catalyst, the addition amount of in vitro nitrile hydratase is 10-10000U per liter of reaction liquid.
7. The use according to claim 5, wherein the temperature of the hydration reaction is 10 to 50 ℃ and the pH of the hydration reaction is 5 to 10.
8. The use according to claim 5, wherein the temperature of the hydration reaction is 20 to 30 ℃; the pH value of the hydration reaction is 6-8.
CN202010580723.9A 2020-06-23 2020-06-23 Application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compound to generate amide pyrazine compound Active CN111662938B (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
CN202110424332.2A CN113025671B (en) 2020-06-23 2020-06-23 Application of nitrile hydratase derived from sinorhizobium meliloti in preparation of amide pyrazine compounds
CN202110424889.6A CN113106130B (en) 2020-06-23 2020-06-23 Application of nitrile hydratase derived from staphylococcus aggregatus in preparation of amide pyrazine compounds
CN202010580723.9A CN111662938B (en) 2020-06-23 2020-06-23 Application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compound to generate amide pyrazine compound

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN202010580723.9A CN111662938B (en) 2020-06-23 2020-06-23 Application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compound to generate amide pyrazine compound

Related Child Applications (2)

Application Number Title Priority Date Filing Date
CN202110424889.6A Division CN113106130B (en) 2020-06-23 2020-06-23 Application of nitrile hydratase derived from staphylococcus aggregatus in preparation of amide pyrazine compounds
CN202110424332.2A Division CN113025671B (en) 2020-06-23 2020-06-23 Application of nitrile hydratase derived from sinorhizobium meliloti in preparation of amide pyrazine compounds

Publications (2)

Publication Number Publication Date
CN111662938A true CN111662938A (en) 2020-09-15
CN111662938B CN111662938B (en) 2021-05-04

Family

ID=72388558

Family Applications (3)

Application Number Title Priority Date Filing Date
CN202010580723.9A Active CN111662938B (en) 2020-06-23 2020-06-23 Application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compound to generate amide pyrazine compound
CN202110424889.6A Active CN113106130B (en) 2020-06-23 2020-06-23 Application of nitrile hydratase derived from staphylococcus aggregatus in preparation of amide pyrazine compounds
CN202110424332.2A Active CN113025671B (en) 2020-06-23 2020-06-23 Application of nitrile hydratase derived from sinorhizobium meliloti in preparation of amide pyrazine compounds

Family Applications After (2)

Application Number Title Priority Date Filing Date
CN202110424889.6A Active CN113106130B (en) 2020-06-23 2020-06-23 Application of nitrile hydratase derived from staphylococcus aggregatus in preparation of amide pyrazine compounds
CN202110424332.2A Active CN113025671B (en) 2020-06-23 2020-06-23 Application of nitrile hydratase derived from sinorhizobium meliloti in preparation of amide pyrazine compounds

Country Status (1)

Country Link
CN (3) CN111662938B (en)

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0307926A2 (en) * 1987-09-18 1989-03-22 YAMADA, Hideaki Process for biological production of amides
CN1571843A (en) * 2001-03-02 2005-01-26 大赛璐化学工业株式会社 Nitrile hydratase and a method for producing amides
US20060024747A1 (en) * 2003-05-08 2006-02-02 Payne Mark S Nucleic acid fragments encoding nitrile hydratase and amidase enzymes from comamonas testosteroni 5-MGAM-4D and recombinant organisms expressing those enzymes useful for the production of amides and acids
CN1753990A (en) * 2003-02-27 2006-03-29 巴斯福股份公司 Modified nitrilases and their use in methods for the production of carboxylic acids
WO2006049618A1 (en) * 2004-11-01 2006-05-11 E. I. Du Pont De Nemours And Company Nitrile hydratase and amidase from comamonas testoteroni 5-mgam-4d
CN1871345A (en) * 2003-10-27 2006-11-29 隆萨股份公司 Immobilization of biocatalyst
WO2009009117A2 (en) * 2007-07-11 2009-01-15 Bioverdant, Inc. Chemoenzymatic processes for preparation of levetiracetam
CN101481713A (en) * 2008-12-30 2009-07-15 浙江工业大学 Method for producing aldinamide by biological catalysis of 2-cyano pyrazine and bacterial strain thereof
CN102285850A (en) * 2011-08-30 2011-12-21 复旦大学 Method for preparing amide from nitrile by hydration in presence of supported gold as catalyst
WO2015100432A2 (en) * 2013-12-24 2015-07-02 Symbiota, Inc. Method for propagating microorganisms within plant bioreactors and stably storing microorganisms within agricultural seeds

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110396494A (en) * 2019-08-01 2019-11-01 安徽瑞邦生物科技有限公司 A kind of preparation and application of low by-product pyridine carboxamide microbial

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0307926A2 (en) * 1987-09-18 1989-03-22 YAMADA, Hideaki Process for biological production of amides
CN1571843A (en) * 2001-03-02 2005-01-26 大赛璐化学工业株式会社 Nitrile hydratase and a method for producing amides
CN1753990A (en) * 2003-02-27 2006-03-29 巴斯福股份公司 Modified nitrilases and their use in methods for the production of carboxylic acids
US20060024747A1 (en) * 2003-05-08 2006-02-02 Payne Mark S Nucleic acid fragments encoding nitrile hydratase and amidase enzymes from comamonas testosteroni 5-MGAM-4D and recombinant organisms expressing those enzymes useful for the production of amides and acids
CN1871345A (en) * 2003-10-27 2006-11-29 隆萨股份公司 Immobilization of biocatalyst
WO2006049618A1 (en) * 2004-11-01 2006-05-11 E. I. Du Pont De Nemours And Company Nitrile hydratase and amidase from comamonas testoteroni 5-mgam-4d
WO2009009117A2 (en) * 2007-07-11 2009-01-15 Bioverdant, Inc. Chemoenzymatic processes for preparation of levetiracetam
CN101481713A (en) * 2008-12-30 2009-07-15 浙江工业大学 Method for producing aldinamide by biological catalysis of 2-cyano pyrazine and bacterial strain thereof
CN102285850A (en) * 2011-08-30 2011-12-21 复旦大学 Method for preparing amide from nitrile by hydration in presence of supported gold as catalyst
WO2015100432A2 (en) * 2013-12-24 2015-07-02 Symbiota, Inc. Method for propagating microorganisms within plant bioreactors and stably storing microorganisms within agricultural seeds

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
LOURENCO,P.M.L.等: ""nitrile hydratase alpha subunit [Agrobacterium tumefaciens],Accession:CAD54074.1"", 《GENBANK》 *
LOURENCO,P.M.L.等: ""nitrile hydratase beta subunit [Agrobacterium tumefaciens],Accession:CAD54075.1"", 《GENBANK》 *
李亚飞等: ""吡嗪酰胺的研究进展"", 《中国现代应用药学》 *

Also Published As

Publication number Publication date
CN113025671A (en) 2021-06-25
CN113106130B (en) 2023-03-14
CN113025671B (en) 2023-01-31
CN113106130A (en) 2021-07-13
CN111662938B (en) 2021-05-04

Similar Documents

Publication Publication Date Title
CN111172124B (en) Carbonyl reductase mutant and preparation thereofR) Application of (E) -4-chloro-3-hydroxy-butyrate
CN113249366B (en) L-threonine aldolase mutant, gene and application
CN112210549B (en) Nitrilase mutant protein and application thereof in catalytic synthesis of (R) -3-substituted-4-cyanobutyric acid compounds
CN108048416B (en) Improved ketoreductase mutant and preparation method and application thereof
CN107858340B (en) High-catalytic-activity D-fructose-6-phosphate aldolase A mutant, recombinant expression vector, genetically engineered bacterium and application thereof
CN110382705B (en) Preparation method of glutamine dipeptide, enzyme for preparing glutamine dipeptide and application
CN102277338A (en) Diketoreductase mutant and application thereof
CN114134134B (en) L-threonine aldolase mutant and application thereof in synthesis of L-syn-p-methylsulfonyl phenylserine
CN105441401A (en) Monoamine oxidase and application thereof in synthesis of chiral azabicyclic compounds
CN112852789B (en) Nitrilase mutant and application thereof
CN111662938B (en) Application of nitrile hydratase in catalyzing hydration reaction of cyanopyrazine compound to generate amide pyrazine compound
CN114891707B (en) Recombinant strain and method for producing bilirubin by whole cell catalysis thereof
CN113174377B (en) Carbonyl reductase, mutant and application of carbonyl reductase in preparation of diltiazem intermediate
CN105950595B (en) (-)-gamma-lactam enzyme, gene, mutant, carrier and its preparation and application
CN114934061A (en) Engineering bacteria and application thereof in producing D-pantolactone by full-cell catalysis of keto-pantolactone
CN109943583B (en) Method for preparing ribavirin by using genetically engineered bacteria
CN115433721A (en) Carbonyl reductase mutant and application thereof
CN114350630A (en) L-pantolactone dehydrogenase, mutant and application thereof
CN114277023A (en) Recombinant nitrile hydratase and application thereof in preparation of nicotinamide by coupling ion exchange resin
CN110004119B (en) -ketoester reductase mutant and application thereof in catalyzing and synthesizing (R) -alpha-lipoic acid precursor
CN113249348B (en) Carbonyl reductase, gene thereof, recombinant expression transformant containing the gene and use thereof
CN114196653B (en) Application of recombinase ester Est1260 in reducing Jie Nibo gold ester
CN116024184B (en) Aldehyde dehydrogenase mutant and application thereof in preparation of 5-hydroxymethyl-2-furancarboxylic acid
CN114574454B (en) Short-chain dehydrogenase, mutant and application thereof
CN106047826A (en) Aldehyde dehydrogenase, recombinant expression transformant thereof and application thereof in synthesis of statin precursor

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
GR01 Patent grant
GR01 Patent grant