CN111643661A - Novel immunologic adjuvant, compound and application thereof - Google Patents
Novel immunologic adjuvant, compound and application thereof Download PDFInfo
- Publication number
- CN111643661A CN111643661A CN202010516693.5A CN202010516693A CN111643661A CN 111643661 A CN111643661 A CN 111643661A CN 202010516693 A CN202010516693 A CN 202010516693A CN 111643661 A CN111643661 A CN 111643661A
- Authority
- CN
- China
- Prior art keywords
- adjuvant
- novel
- compound
- immunoadjuvant
- vaccine
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 239000000568 immunological adjuvant Substances 0.000 title claims abstract description 22
- 150000001875 compounds Chemical class 0.000 title claims abstract description 16
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 claims abstract description 8
- 229960005486 vaccine Drugs 0.000 claims description 12
- 230000001571 immunoadjuvant effect Effects 0.000 claims description 8
- 125000003545 alkoxy group Chemical group 0.000 claims description 6
- 125000000217 alkyl group Chemical group 0.000 claims description 6
- 210000002865 immune cell Anatomy 0.000 claims description 6
- 229940044616 toll-like receptor 7 agonist Drugs 0.000 claims description 6
- 230000000259 anti-tumor effect Effects 0.000 claims description 4
- 238000002360 preparation method Methods 0.000 claims description 4
- 239000012190 activator Substances 0.000 claims description 3
- 125000004432 carbon atom Chemical group C* 0.000 claims description 3
- 229940124622 immune-modulator drug Drugs 0.000 claims description 2
- 230000000091 immunopotentiator Effects 0.000 claims description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 claims 1
- 229910052760 oxygen Inorganic materials 0.000 claims 1
- 239000001301 oxygen Substances 0.000 claims 1
- 239000002671 adjuvant Substances 0.000 abstract description 22
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 abstract description 9
- 229910052782 aluminium Inorganic materials 0.000 abstract description 9
- 230000000694 effects Effects 0.000 abstract description 8
- 101000669402 Homo sapiens Toll-like receptor 7 Proteins 0.000 abstract description 5
- 102100039390 Toll-like receptor 7 Human genes 0.000 abstract description 5
- 239000003446 ligand Substances 0.000 abstract description 2
- 230000005931 immune cell recruitment Effects 0.000 abstract 1
- 210000004027 cell Anatomy 0.000 description 16
- 108090000765 processed proteins & peptides Proteins 0.000 description 13
- 206010028980 Neoplasm Diseases 0.000 description 11
- 239000008055 phosphate buffer solution Substances 0.000 description 6
- 230000004913 activation Effects 0.000 description 5
- 229940037003 alum Drugs 0.000 description 5
- 239000000427 antigen Substances 0.000 description 5
- 102000036639 antigens Human genes 0.000 description 5
- 108091007433 antigens Proteins 0.000 description 5
- 235000015112 vegetable and seed oil Nutrition 0.000 description 5
- 239000008158 vegetable oil Substances 0.000 description 5
- 241000699670 Mus sp. Species 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 229940023041 peptide vaccine Drugs 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 239000012636 effector Substances 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 230000002147 killing effect Effects 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 239000012646 vaccine adjuvant Substances 0.000 description 3
- 206010067484 Adverse reaction Diseases 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 102000001002 Frizzled-7 Human genes 0.000 description 2
- 102100039676 Frizzled-7 Human genes 0.000 description 2
- 108050007985 Frizzled-7 Proteins 0.000 description 2
- 101000885797 Homo sapiens Frizzled-7 Proteins 0.000 description 2
- 230000006838 adverse reaction Effects 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 239000008367 deionised water Substances 0.000 description 2
- 229910021641 deionized water Inorganic materials 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 238000000034 method Methods 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 125000004430 oxygen atom Chemical group O* 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 150000003384 small molecules Chemical class 0.000 description 2
- PPASLZSBLFJQEF-RKJRWTFHSA-M sodium ascorbate Substances [Na+].OC[C@@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RKJRWTFHSA-M 0.000 description 2
- 229960005055 sodium ascorbate Drugs 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 229940021747 therapeutic vaccine Drugs 0.000 description 2
- 229940124931 vaccine adjuvant Drugs 0.000 description 2
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 108010060825 Toll-Like Receptor 7 Proteins 0.000 description 1
- 102000008236 Toll-Like Receptor 7 Human genes 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- DIZPMCHEQGEION-UHFFFAOYSA-H aluminium sulfate (anhydrous) Chemical compound [Al+3].[Al+3].[O-]S([O-])(=O)=O.[O-]S([O-])(=O)=O.[O-]S([O-])(=O)=O DIZPMCHEQGEION-UHFFFAOYSA-H 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 238000010009 beating Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 238000007664 blowing Methods 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 229940028617 conventional vaccine Drugs 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 229960002751 imiquimod Drugs 0.000 description 1
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000002434 immunopotentiative effect Effects 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- GNHOJBNSNUXZQA-UHFFFAOYSA-J potassium aluminium sulfate dodecahydrate Chemical compound O.O.O.O.O.O.O.O.O.O.O.O.[Al+3].[K+].[O-]S([O-])(=O)=O.[O-]S([O-])(=O)=O GNHOJBNSNUXZQA-UHFFFAOYSA-J 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000007790 scraping Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 230000003393 splenic effect Effects 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 238000001308 synthesis method Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000011282 treatment Methods 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07F—ACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
- C07F9/00—Compounds containing elements of Groups 5 or 15 of the Periodic Table
- C07F9/02—Phosphorus compounds
- C07F9/547—Heterocyclic compounds, e.g. containing phosphorus as a ring hetero atom
- C07F9/6561—Heterocyclic compounds, e.g. containing phosphorus as a ring hetero atom containing systems of two or more relevant hetero rings condensed among themselves or condensed with a common carbocyclic ring or ring system, with or without other non-condensed hetero rings
- C07F9/65616—Heterocyclic compounds, e.g. containing phosphorus as a ring hetero atom containing systems of two or more relevant hetero rings condensed among themselves or condensed with a common carbocyclic ring or ring system, with or without other non-condensed hetero rings containing the ring system having three or more than three double bonds between ring members or between ring members and non-ring members, e.g. purine or analogs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55505—Inorganic adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
The invention provides a novel immunologic adjuvant, a compound and application thereof, wherein the immunologic adjuvant is composed of a general formula I. The immune adjuvant forms a tight ligand by using the micromolecule TLR7 stimulant with immune enhancement effect and aluminum hydroxide, and can superpose immune cell activation effect on the basis of keeping the characteristics of the aluminum adjuvant.
Description
Technical Field
The invention relates to the field of immunization and vaccine adjuvants, in particular to a novel immunologic adjuvant, a novel compound and application thereof.
Background
Conventional vaccine adjuvants include inorganic aluminum adjuvants including aluminum hydroxide, aluminum sulfate, aluminum potassium sulfate dodecahydrate (alum), aluminum phosphate, etc., vegetable oil adjuvants, Freund's incomplete adjuvants, complete Freund's adjuvants, etc.; the vegetable oil adjuvant comprises peanut oil emulsion adjuvant, mineral oil, vegetable oil, etc.
The vegetable oil adjuvant and the Freund's adjuvant have adverse reactions such as local stimulation and the like. One of the important roles of traditional aluminum adjuvants in vaccines is to physically adsorb antigen, locally retain and stabilize vaccine components to sufficiently attract immune presenting cells for antigen presenting treatment. The aluminum adjuvant has the advantages of good safety, capability of fixing antigen at an immune position and the like, but the aluminum adjuvant has no activation enhancing effect on immune cells.
Disclosure of Invention
The invention aims to solve the technical problems that the inorganic aluminum series adjuvant lacks the activation and enhancement effect on immune cells and the vegetable oil adjuvant and Freund's adjuvant have adverse reactions such as local stimulation and the like, and provides a novel immunologic adjuvant, a novel compound and application thereof.
The technical scheme for solving the technical problems is to provide a novel immunologic adjuvant, wherein the immunologic adjuvant is composed of a general formula I:
the general formula I consists of phosphorylated micromolecular TLR7 agonist and aluminum hydroxide, wherein n is an integer and is more than or equal to 1 and less than or equal to 100; l is one of a linear alkyl chain and a linear alkoxy chain.
Preferably, L is a linear alkyl chain between 2 and 20 carbon atoms long.
Preferably, L is a linear alkoxy chain with a number of oxygen atoms between 2 and 20.
Preferably, 45. ltoreq. n.ltoreq.55.
Preferably, the structural formula of the immunoadjuvant is:
embodiments of the present invention also provide a compound, which has a structural formula:
the invention also provides an application of the compound in preparing an immunologic adjuvant, wherein the immunologic adjuvant is used as an anti-tumor immune activator.
The invention also provides application of the compound in preparing immunomodulatory drugs, vaccines, immune cell activators or immunopotentiators.
The novel immunologic adjuvant, the compound and the application thereof form a tight ligand through the micromolecule TLR7 excitant with the immunopotentiation effect and aluminum hydroxide, and can superpose the activation effect of immune cells on the basis of keeping the characteristics of the aluminum adjuvant.
Drawings
FIG. 1 is a schematic representation of TLR7 pathway-inducing activity of compounds T-I and T-II;
FIG. 2 is a schematic representation of the tumor-inhibiting effect of the 54 peptide vaccine (Vac);
FIG. 3 is a graph showing the effect of targeted killing by CTLs on each group.
Detailed Description
In order to make the objects, technical solutions and advantages of the present invention more apparent, the present invention is described in further detail below with reference to the accompanying drawings and embodiments. It should be understood that the specific embodiments described herein are merely illustrative of the invention and are not intended to limit the invention. The experimental procedures in the following examples are conventional unless otherwise specified. The test materials used in the following examples were purchased from a conventional biochemical reagent store unless otherwise specified.
The novel immunological adjuvant AlumT provided by the embodiment of the invention comprises a compound shown in the following general formula I:
wherein L represents a connecting chain. The general formula I consists of a phosphorylated small molecule TLR7 agonist and aluminum hydroxide, wherein the molecular number of the aluminum hydroxide, namely n, is an integer between 1 and 100, preferably an integer between 45 and 55, and most preferably an integer between 50 and 53.
L represents one of a linear alkyl chain or a linear alkoxy chain. In one embodiment of the invention, L is preferably a linear alkyl chain between 2 and 20 carbon atoms long. L may also be a linear alkoxy chain with a number of oxygen atoms between 2 and 20 (PEG chain).
In one embodiment of the invention, a representative of the novel immunological adjuvant, AlumT, consists of the following AlumT-I:
in another embodiment of the invention, a representative of the novel immunological adjuvant, AlumT, consists of the following AlumT-II:
the TLR7 agonist compounds T-I and T-II in AlumT-I and AlumT-II can be synthesized by the following methods:
T-I Synthesis
Namely, 100mg of K-1, 76mg of K-2, 5mg of L-sodium ascorbate and 5mg of CuSO are firstly added4Dissolve in 100. mu.L water + 400. mu.L of LDMSO, react at room temperature for 5h, and monitor the reaction by LC-MS. After the reaction was completed, purification was performed by HPLC to obtain 50mg of T-I white solid, the yield was 29.7%. ESI-MS: M/z 715.36[ M + H ]]+。
Synthesis of T-II
The synthesis method of T-II has the same steps as the synthesis of T-I, namely 100mg of K-1, 76mg of K-3, 5mg of L-sodium ascorbate and 5mg of CuSO are firstly synthesized4Dissolve in 100. mu.L water + 400. mu.L DMSO, react at room temperature for 5h, and monitor the reaction by LC-MS. After the reaction is finished, purifying by HPLC to obtain a pure product of T-II, ESI-MS, M/z is 708.5[ M + H ]]+。
TLR7 of Compounds T-I and T-II activation assays (HEK-Blue) were performed in the following mannerTMDetection)：
Taking HEK-Blue in logarithmic growth phaseTMhTLR7 cells (purchased from InvivoGen), growth medium (Gibco, C11995500BT, Invivo Gen, ant-nr) was discarded, appropriate amounts of 37 ℃ PBS (Hyclone, SH30256.01) were gently rinsed 2 times and PBS was discarded. Adding 2-5mL of PBS (phosphate buffer solution) at 37 ℃, incubating for 1-2 min, scraping cells by using a cell scraper, and then gently blowing and beating the cells to disperse the cells into single cell suspension. Counting the cells and calculating the cell concentration using a hemocytometer using HEK-BlueTMDecpetion solution (from Invivo Gen) adjusted the cell suspension to 2.5×104Cell plating was performed on 96 well cell culture plates per 180. mu.L well. HEK-Blue was stimulated as designed by addition of concentrations of T-I and T-II (0.2. mu.M, 0.6. mu.M, 1.8. mu.M, 5.5. mu.M, 16.6. mu.M, 50. mu.M)TMhTLR7 cells, Imiquimod, were positive controls. 3 multiple wells were set for each concentration. Incubating for 6-16 h at 37 ℃ under the condition of 5% carbon dioxide. After the incubation, the absorbance was read at 650nm using a full-wavelength microplate reader (BioTek-Epoch). As shown in fig. 1, the relative induction OD values are relative induction OD values at different concentration values (experimental group mean OD value-negative control group mean OD value)/negative control group mean OD value.
As can be seen from FIG. 1, T-I and T-II significantly activate the TLR7 receptor pathway, belonging to TLR7 agonists.
Example 1 AlumT-I preparation:
10mg (14. mu. mol) of T-I was added to 2.5mL of purified deionized water, and 14. mu.L of a solution containing 0.56mg NaOH was added to form a clear solution. Then, 2mL of Alhydrogel (Invivogen, containing 9.0-11.0mg/mL of aluminum), 1mL of histidine buffer (100mM, pH6.5) and 4.5mL of deionized water were added. The resulting mixture was slowly stirred at room temperature for 1 hour to obtain AlumT-I adjuvant (about 10 mL). Standing at room temperature at 20-25 deg.C for storage. Wherein the mass ratio of T-I to aluminum is 1:2, and the molar ratio is 1: 53. Example 2 preparation of 54 peptide vaccine (Vac) Using peptide 54 peptide of FZD7 protein as antigen
Frizzled7(FZD7) is an antigenic marker of tumor stem cells [ "Frizzled 7as an emeringtarget for cancer therapy". Cell signal.2012apr; 24 (846-51. doi:10.1016/j.cellsig.2011.12.009. "Frizzled-7 as a potential therapeutic target in a colorganic cancer". Neopalasia.2008Jul; 697-705] selecting the main peptide segment 54 as antigen to prepare therapeutic vaccine:
APVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEIC (54 peptide) 10mg is added into 10mL of AlumT-I adjuvant, and the mixture is gently shaken at room temperature to obtain 54 peptide vaccine (Vac).
Example 3 immune anti-tumor experiments with 54 peptide vaccine (Vac vaccine, i.e. 54 peptide + AlumT-I) as therapeutic vaccine
Selecting 4-6 homologous CT26.WT cellsWeek-old BALB/c mice were injected subcutaneously in their backs with 2.0 × 105And C, when the diameter of the tumor reaches 4-5 mm, the CT26.WT cells randomly divide the tumor-bearing mice into a PBS group, an Alum group (aluminum hydroxide group), Alum +54 peptide, T-I +54 peptide and a Vac group (vaccine group, AlumT-I +54 peptide), wherein each group is 10. Both the group injections and the vaccine injections were started, and the Alum group contained Al (1mg/Alhydrogel 100. mu.L), the Alum +54 peptide group (containing Al 1mg/Alhydrogel 100. mu.L plus 54 peptide 100. mu.g), the T-I +54 peptide (containing T-I100. mu.g plus 54 peptide 100. mu.g plus PBS 100. mu.L), and the Vac group (vaccine group, AlumT-I100. mu.L plus 54 peptide 100. mu.g). The injection volume of each group is 100 μ L, and the vaccine is injected on the 8 th, 12 th, 15 th, 19 th and 22 th days after the tumor implantation, 5 times in total, and subcutaneous injection is performed around the tumor. Tumor size volumes were measured periodically for each group of mice. Counting the growth size of each group of tumors on day 36 to calculate the tumor inhibition rate; spleen lymphocytes from each group of mice were extracted for use. The specific effect is shown in fig. 2, and the results shown in fig. 2 indicate that the inhibition rate reaches 90% on day 25, i.e., the Vac vaccine has extremely significant anti-tumor effect.
EXAMPLE 4 tumor cell killing assay (CTL) of effector cells in vitro
On day 25, 3 mean tumor-bearing mice were treated from each group, splenic lymphoid effector cells (using lymphocyte separation medium (Dakewe, Beijing China) and CT26 cells were co-cultured at 50:1 for 4 hours. the killing of effector cells against target cells (CT26) was detected by the LDH method using a non-radioactive cytotoxicity detection kit (Promega, Madison, USA) according to the kit product instructions, and the results are shown in FIG. 3. As can be seen in FIG. 3, the Vac vaccine group had significantly improved targeted killing effects.
Although small molecule TLR7 agonists can act as vaccine adjuvants themselves, their non-specific mobility profile in vivo diminishes the local specificity required as a vaccine. The AlumT adjuvant disclosed by the invention not only maintains the advantages of an aluminum adjuvant, but also overcomes the defect that TLR7 is used as an adjuvant, and superposes the activation effect on immune cells, so that a more beneficial effect is generated.
The above description is only for the preferred embodiment of the present invention, but the scope of the present invention is not limited thereto, and any changes or substitutions that can be easily conceived by those skilled in the art within the technical scope of the present invention are included in the scope of the present invention. Therefore, the protection scope of the present invention shall be subject to the protection scope of the claims.
Claims (8)
1. A novel immunoadjuvant, characterized in that it consists of general formula I:
the general formula I consists of phosphorylated micromolecular TLR7 agonist and aluminum hydroxide, wherein n is an integer and is more than or equal to 1 and less than or equal to 100; l is one of a linear alkyl chain and a linear alkoxy chain.
2. The novel immunoadjuvant of claim 1, wherein L is a linear alkyl chain between 2 and 20 carbon atoms long.
3. The novel immunoadjuvant of claim 1, wherein L is a linear alkoxy chain having an oxygen number of 2 to 20.
4. The novel immunoadjuvant of claim 1, wherein 45. ltoreq. n.ltoreq.55.
5. The novel immunoadjuvant of claim 1, wherein the formula of the immunoadjuvant is:
6. a compound having the formula:
7. use of a compound according to claim 6 for the preparation of an immunoadjuvant for use as an anti-tumour immunoactivator.
8. Use of a compound of claim 6 for the preparation of an immunomodulatory drug, a vaccine, an immune cell activator, or an immunopotentiator.
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202010516693.5A CN111643661A (en) | 2020-06-08 | 2020-06-08 | Novel immunologic adjuvant, compound and application thereof |
| CN202110582373.4A CN113230397B (en) | 2020-06-08 | 2021-05-26 | Novel immunoadjuvants, compounds and uses thereof |
| PCT/CN2021/097816 WO2021249250A1 (en) | 2020-06-08 | 2021-06-02 | Novel immunologic adjuvant, compound and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202010516693.5A CN111643661A (en) | 2020-06-08 | 2020-06-08 | Novel immunologic adjuvant, compound and application thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN111643661A true CN111643661A (en) | 2020-09-11 |
Family
ID=72343508
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202010516693.5A Pending CN111643661A (en) | 2020-06-08 | 2020-06-08 | Novel immunologic adjuvant, compound and application thereof |
| CN202110582373.4A Active CN113230397B (en) | 2020-06-08 | 2021-05-26 | Novel immunoadjuvants, compounds and uses thereof |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202110582373.4A Active CN113230397B (en) | 2020-06-08 | 2021-05-26 | Novel immunoadjuvants, compounds and uses thereof |
Country Status (2)
| Country | Link |
|---|---|
| CN (2) | CN111643661A (en) |
| WO (1) | WO2021249250A1 (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113230397A (en) * | 2020-06-08 | 2021-08-10 | 王竹林 | Novel immunologic adjuvant, compound and application thereof |
| CN113663067A (en) * | 2021-02-22 | 2021-11-19 | 深圳市康居正医药科技有限公司 | Immune activation type antibody and application thereof |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PL2038290T3 (en) * | 2006-07-07 | 2014-03-31 | Gilead Sciences Inc | Modulators of toll-like receptor 7 |
| US20120177681A1 (en) * | 2010-09-01 | 2012-07-12 | Manmohan Singh | Formulation of immunopotentiators |
| KR20140026392A (en) * | 2011-03-02 | 2014-03-05 | 노파르티스 아게 | Combination vaccines with lower doses of antigen and/or adjuvant |
| US8728486B2 (en) * | 2011-05-18 | 2014-05-20 | University Of Kansas | Toll-like receptor-7 and -8 modulatory 1H imidazoquinoline derived compounds |
| US20150030630A1 (en) * | 2012-03-07 | 2015-01-29 | Novartis Ag | Adjuvanted formulations of rabies virus immunogens |
| CN104800843B (en) * | 2015-04-02 | 2017-07-04 | 中国农业科学院兰州兽医研究所 | A kind of medicament and application for arch insect infection prevention |
| US10688170B2 (en) * | 2017-06-10 | 2020-06-23 | Inventprise, Llc | Multivalent conjugate vaccines with bivalent or multivalent conjugate polysaccharides that provide improved immunogenicity and avidity |
| AU2018283973A1 (en) * | 2017-06-11 | 2020-01-16 | Molecular Express, Inc. | Methods and compositions for substance use disorder vaccine formulations and uses thereof |
| CN108379591B (en) * | 2018-04-03 | 2022-03-29 | 深圳大学 | Synthesis of immune agonist targeting compound and application thereof |
| CN111643661A (en) * | 2020-06-08 | 2020-09-11 | 王竹林 | Novel immunologic adjuvant, compound and application thereof |
-
2020
- 2020-06-08 CN CN202010516693.5A patent/CN111643661A/en active Pending
-
2021
- 2021-05-26 CN CN202110582373.4A patent/CN113230397B/en active Active
- 2021-06-02 WO PCT/CN2021/097816 patent/WO2021249250A1/en active Application Filing
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113230397A (en) * | 2020-06-08 | 2021-08-10 | 王竹林 | Novel immunologic adjuvant, compound and application thereof |
| WO2021249250A1 (en) * | 2020-06-08 | 2021-12-16 | 王竹林 | Novel immunologic adjuvant, compound and application thereof |
| CN113230397B (en) * | 2020-06-08 | 2024-07-26 | 王竹林 | Novel immunoadjuvants, compounds and uses thereof |
| CN113663067A (en) * | 2021-02-22 | 2021-11-19 | 深圳市康居正医药科技有限公司 | Immune activation type antibody and application thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CN113230397B (en) | 2024-07-26 |
| WO2021249250A1 (en) | 2021-12-16 |
| CN113230397A (en) | 2021-08-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9765114B2 (en) | Method for cancer immunotherapy | |
| Lindahl et al. | Cluster of genes in Escherichia coli for ribosomal proteins, ribosomal RNA, and RNA polymerase subunits. | |
| US20080207497A1 (en) | Cytotoxic t-lymphocyte-inducing immunogens for prevention, treatment, and diagnosis of cancer | |
| US20180066017A1 (en) | Class i mhc phosphopeptides for cancer immunotherapy and diagnosis | |
| CN113230397B (en) | Novel immunoadjuvants, compounds and uses thereof | |
| PL201881B1 (en) | Compositions and methods for wt1 specific immunotherapy | |
| JP2004154138A (en) | Immunogenic peptide | |
| US10711005B2 (en) | Compound I and compound II as well as preparation methods therefor and application thereof | |
| CN105658673A (en) | Novel four-CTL epitope-joined peptide | |
| EP1715042B1 (en) | EPITOPE/PEPTIDE RECOGNIZED BY HLA-A2402-RESTRICTED Ep-CAM-SPECIFIC CTL AND USE OF THE SAME | |
| US20120128706A1 (en) | Immune adjuvant comprising atp | |
| JP5227028B2 (en) | Formulation for immunotherapy having neutralizing ability of interleukin-2 | |
| WO2014070663A1 (en) | Compositions and methods for diagnosis and treatment of malignant gliomas | |
| Lewis et al. | Induction of fibrogenesis by lung antibody-treated macrophages. | |
| EP0135788A1 (en) | Muramyldipeptide active ester derivatives | |
| WO2018058489A1 (en) | Cacna1h-derived tumour antigen polypeptide and use thereof | |
| WO2018058490A1 (en) | Col14a1-derived tumour antigen polypeptide and use thereof | |
| CN118085058B (en) | OBSCN novel epitope peptide and application thereof | |
| TAKASU | Interferon-α: an effective adjuvant for peptide-based cytotoxic T-cell vaccines | |
| CN105777873A (en) | His-Vx3-eGFP protein-nano aluminum covalent coupling ubiquitinated protein containing carbon-nitrogen bonds as well as extraction method and application thereof | |
| CN107530411B (en) | Immune inducer | |
| JP2009065835A (en) | HLA-A2 restricted antigen peptide and use thereof | |
| JP2008173120A (en) | Novel cancer antigen polypeptide | |
| Barrou | Cancer vaccines |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WD01 | Invention patent application deemed withdrawn after publication | ||
| WD01 | Invention patent application deemed withdrawn after publication |
Application publication date: 20200911 |