CN111394371B - Migratory locust V-ATPase-V1 structural domain gene and application of dsRNA thereof in pest control - Google Patents

Abstract

The invention discloses a migratory locust V-ATPase-V1 structural domain gene and application of dsRNA thereof in pest control, wherein the migratory locust V-ATPase-V1 structural domain gene comprises migratory locust V-ATPase-A, V-ATPase-B, V-ATPase-C, V-ATPase-D, V-ATPase-E, V-ATPase-F and V-ATPase-G genes, and the V-ATPase-A to V-ATPase-G genes are obtained from a migratory locust transcription group database by a bioinformatics method, and the full-length cDNA sequences of the genes are obtained after cloning and sequencing the genes respectively; based on the gene sequences, V-ATPase-A to V-ATPase-G gene fragments are respectively obtained by a PCR method, corresponding dsRNA is synthesized, and the synthesized dsRNA can be respectively injected into a locusta migratoria coelomis and then can specifically silence a target gene, so that the locusta migratoria is died due to the fact that growth and development of the locusta migratoria are blocked, and the lethality rate reaches 60.3% -93.7%. Due to the specificity and the high-efficiency lethality rate, the invention has important significance for pest control and provides a new way for pest control.

Description

Migratory locust V-ATPase-V1 structural domain gene and application of dsRNA thereof in pest control

Technical Field

The invention relates to the field of biotechnology and agricultural pest control, in particular to a migratory locust V-ATPase-V1 structural domain gene and application of dsRNA thereof in pest control.

Background

Locusta migratoria is an intercontinental agricultural pest mainly distributed in four continents of asia, europe, africa and australia. The method has the characteristics of outbreak, cluster and migration, and once the outbreak occurs, the method is wide in related range, violent in incoming situation and serious in disaster. At present, chemical insecticides are still used as main means in locust control work, and the use of a large amount of chemical insecticides not only easily causes insects to generate drug resistance, but also brings serious pollution to the ecological environment and threatens the health of human beings, so that the research and development of green novel pesticides have important significance for locust control work in China.

RNA interference (RNAi), a phenomenon of specific post-transcriptional gene silencing caused by double-stranded RNA molecules, has been ascending at the technology front since the acquisition of the nobel prize in 2006. RNAi is not only a powerful tool for studying gene function, but also has great potential in pest control. Pest control by RNAi has the following characteristics: 1) the insecticidal has specificity and no killing effect on non-target organisms; 2) RNA is easy to degrade in nature and has no residue; 3) is nontoxic and harmless to the environment and is relatively safe. Currently, the RNAi technology has been internationally referred to as fourth generation pesticide core technology. RNAi transgenic maize (MON87411) expressing dsRNA of the maize root leaf beetle Snf7 gene, developed by Monsanto, USA, has been approved by the United States Department of Agriculture (USDA) and the Environmental Protection Agency (EPA), and is about to be commercially used. Experiments show that the transgenic corn can effectively kill corn rootworm and has no obvious toxic effect on non-target organisms such as bees and the like. Screening and identifying genes which are crucial to the growth and development of pests are key links for developing novel pesticides by applying RNAi technology, because not all dsRNA can effectively silence the expression of target genes, nor all dsRNA can kill pests.

V-ATPase (Vacuolar-type ATPase), an H⁺The channel protein is widely present on membranes of various organelles such as endosomes, lysosomes and the like of prokaryotes and eukaryotes and plasma membranes of some special cells, regulates the pH of the internal and external environments of the cells and is important for maintaining normal life activities of organisms. The V-ATPase is a highly conserved complex enzyme, and is formed by assembling an extracellular V1 domain and a transmembrane V0 domain, wherein the V1 domain consists of a A, B, C, D, E, F, G, H large subunit and is responsible for the hydrolysis of ATP; the V0 domain consists of a, c, c ', d, e (c' is present in yeast cells), and functions as a proton transporter. At present, no relevant research aiming at the V-ATPase-V1 structural domain gene (V-ATPase-A, V-ATPase-B, V-ATPase-C, V-ATPase-D, V-ATPase-E, V-ATPase-F and V-ATPase-G) of locusta migratoria is found. The invention proves that 60.3% -93.7% of lethality occurs after dsRNA of the V-ATPase-V1 structural domain gene of the migratory locust is injected to 3-year-old nymphs respectively for the first time. Therefore, the V-ATPase-V1 structural domain gene can be used as a high lethal target gene for RNAi-based pest control technology.

Disclosure of Invention

Aiming at the current state of the prior art, the invention aims to provide a migratory locust V-ATPase-V1 structural domain gene, a gene fragment and application of dsRNA thereof in lethal migratory locust.

The invention provides a locusta migratoria V-ATPase-V1 structural domain gene, which comprises the following genes:

the nucleotide sequence of the migratory locust V-ATPase-A gene is SEQ ID NO: 1, the length of the nucleotide is 1848 bp; the amino acid sequence is SEQ ID NO: 2, the sequence length is 615 amino acids;

the nucleotide sequence of the locust V-ATPase-B gene is SEQ ID NO: 6, the length of the nucleotide is 1503 bp; the amino acid sequence is SEQ ID NO: 7, the sequence length is 500 amino acids;

the nucleotide sequence of the migratory locust V-ATPase-C gene is SEQ ID NO: 11, the length of the nucleotide is 1158 bp; the amino acid sequence is SEQ ID NO: 12, the sequence length is 385 amino acids;

the nucleotide sequence of the migratory locust V-ATPase-D gene is SEQ ID NO: 16, the length of the nucleotide is 753 bp; the amino acid sequence is SEQ ID NO: 17, the sequence length is 250 amino acids;

the nucleotide sequence of the migratory locust V-ATPase-E gene is SEQ ID NO: 21, the length of the nucleotide is 684 bp; the amino acid sequence is SEQ ID NO: 22, the sequence length is 227 amino acids;

the nucleotide sequence of the migratory locust V-ATPase-F gene is SEQ ID NO: 26, the length of the nucleotide is 372 bp; the amino acid sequence is SEQ ID NO: 27, the sequence length is 123 amino acids;

the nucleotide sequence of the migratory locust V-ATPase-F gene is SEQ ID NO: 31, the length of the nucleotide is 357 bp; the amino acid sequence is SEQ ID NO: 32, the sequence length is 118 amino acids.

The invention provides a locusta migratoria V-ATPase-V1 structural domain gene fragment, which comprises the following gene fragments:

the nucleotide sequence of the V-ATPase-A gene fragment is SEQ ID NO: 3;

the nucleotide sequence of the V-ATPase-B gene fragment is SEQ ID NO: 8;

the nucleotide sequence of the V-ATPase-C gene fragment is SEQ ID NO: 13;

the nucleotide sequence of the V-ATPase-D gene fragment is SEQ ID NO: 18;

the nucleotide sequence of the V-ATPase-E gene fragment is SEQ ID NO: 23;

the nucleotide sequence of the V-ATPase-F gene fragment is SEQ ID NO: 28;

the nucleotide sequence of the V-ATPase-G gene fragment is SEQ ID NO: 33.

the dsRNA of the V-ATPase-V1 structural domain gene of migratory locust provided by the invention comprises the following dsRNA:

the locust migratory V-ATPase-A gene fragment SEQ ID NO: 3 a synthetic dsRNA;

the locust migratory V-ATPase-B gene fragment SEQ ID NO: 8 synthetic dsRNA;

the locust-migratory V-ATPase-C gene fragment SEQ ID NO: 13 synthetic dsRNA;

the locust migratory V-ATPase-D gene fragment SEQ ID NO: 18 synthetic dsRNA;

the locust migratory V-ATPase-E gene fragment SEQ ID NO: 23 synthetic dsRNA;

the locust migratory V-ATPase-F gene fragment SEQ ID NO: 28 synthetic dsRNA;

the locust migratory V-ATPase-G gene fragment SEQ ID NO: 33 synthetic dsRNA.

The invention provides an application of migratory locust V-ATPase-V1 structural domain gene dsRNA in pest control, based on migratory locust V-ATPase-A, V-ATPase-B, V-ATPase-C, V-ATPase-D, V-ATPase-E, V-ATPase-F and V-ATPase-G genes contained in a migratory locust V-ATPase-V1 structural domain, for each gene, an upstream primer and a downstream primer containing a T7 promoter aiming at the gene are designed through primer premier 5.0 software, and a DNA template with two ends being T7 promoters is obtained through PCR amplification. According to HiScribe^TM T7 High Yield RNA Synthesis Kit(NEW ENGLAND

Inc.) kit demonstrates in vitro transcription synthesis of the corresponding dsRNA. Each synthetic dsRNA was injected into the body cavity of a 3-year migratory locust via a microinjector. The results show that:

after the dsRNA is injected, the mRNA expression of the migratory locust V-ATPase-A gene is obviously reduced, and the migratory locust has growth and development resistance and leads to 79.7 percent of death.

After the dsRNA is injected, the mRNA expression of the migratory locust V-ATPase-B gene is obviously reduced, and the migratory locust has the defects of growth and development resistance and 85.7 percent of death.

After the dsRNA is injected, the mRNA expression of the V-ATPase-C gene of the migratory locust is obviously reduced, and the migratory locust has growth and development resistance and causes 69.8 percent of death.

After the dsRNA is injected, the mRNA expression of the migratory locust V-ATPase-D gene is obviously reduced, and the migratory locust has growth and development resistance and causes 90.4 percent of death.

After the dsRNA is injected, the mRNA expression of the migratory locust V-ATPase-E gene is obviously reduced, and the migratory locust has the defects of hindered growth and development and causes 93.7 percent of death.

After the dsRNA is injected, the mRNA expression of the migratory locust V-ATPase-F gene is obviously reduced, and the migratory locust has growth and development resistance and leads to 77.8 percent of death.

After the dsRNA is injected, the mRNA expression of the V-ATPase-G gene of the migratory locust is obviously reduced, and the migratory locust has growth and development resistance and causes 60.3 percent of death.

Wherein, in the synthesis of dsRNA of locusta migratoria V-ATPase-V1 structural domain gene, based on different genes, an upstream primer and a downstream primer are designed as follows:

the upstream primer and the downstream primer of the migratory locust V-ATPase-A gene are respectively as follows: SEQ ID NO: 4 and SEQ ID NO: 5;

the upstream primer and the downstream primer of the migratory locust V-ATPase-B gene are respectively as follows: SEQ ID NO: 9 and SEQ ID NO: 10;

the upstream primer and the downstream primer of the migratory locust V-ATPase-C gene are respectively as follows: SEQ ID NO: 14 and SEQ ID NO: 15;

the upstream primer and the downstream primer of the migratory locust V-ATPase-D gene are respectively as follows: SEQ ID NO: 19 and SEQ ID NO: 20;

the upstream primer and the downstream primer of the migratory locust V-ATPase-E gene are respectively as follows: SEQ ID NO: 24 and SEQ ID NO: 25;

the upstream primer and the downstream primer of the migratory locust V-ATPase-F gene are respectively as follows: SEQ ID NO: 29 and SEQ ID NO: 30, of a nitrogen-containing gas;

the upstream primer and the downstream primer of the migratory locust V-ATPase-G gene are respectively as follows: SEQ ID NO: 34 and SEQ ID NO: 35.

compared with the prior art, the invention has the following beneficial effects:

1. because of the specificity and high-efficiency lethality of dsRNA synthesized by the gene fragment of the V-ATPase-V1 domain of the migratory locust, the dsRNA has important practical significance for pest control and can provide a new way for pest control.

2. The dsRNA of the invention is easy to synthesize, is convenient to prepare into a spray type pesticide or bait, and has better popularization and application values.

Drawings

FIG. 1 shows the effect of dsRNA (dsLmV-ATPase-A) injection of V-ATPase-A gene on mRNA expression of V-ATPase-A gene after 3 rd migratory locust; dsGFP is used as a control, dsLmV-ATPase-A is used as a treatment group, and beta-actin is used as an internal reference gene. Wherein P < 0.001.

FIG. 2 is the effect of dsRNA (dsLmV-ATPase-A) injection of V-ATPase-A gene on growth and development of 3-year migratory locust; controls injected with dsGFP on the left, and controls injected with SEQ ID NO: 3 synthetic dsRNA, i.e., dsLmV-ATPase-A. Wherein, 1 is that the ridge line of the locusta migratoria at 3 th and 4 th instar slough of the treatment group is cracked and the back is arched and dies; 2, the locusta migratoria 3 th instar is dead 1 to 2 days after the locusta migratoria 4 th instar is treated; 3, the locusta migratoria 4 th instar slough dies 1-2 days before 5 th instar; 4, old epidermis can not be sloughed off to die when the migratory locust of 4 ages and 5 ages.

FIG. 3 is a graph showing the effect of dsRNA (dsLmV-ATPase-B) injection of V-ATPase-B gene on mRNA expression of V-ATPase-B gene after 3-year migratory locust. dsGFP is used as a control, dsLmV-ATPase-B is used as a treatment group, and beta-actin is used as an internal reference gene. Wherein P < 0.01.

FIG. 4 shows the effect of dsRNA injection of V-ATPase-B gene (dsLmV-ATPase-B) on growth and development of 3-year migratory locust. Controls injected with dsGFP on the left, and controls injected with SEQ ID NO: 8 synthetic dsRNA, i.e., dsLmV-ATPase-B. Wherein 1 is death of the locusta migratoria at 3 rd and 4 th ages in 1-2 days before; 2, when the locusta migratoria of the treatment group is 3 years old and is 4 years old, the compact inclusion of the old epidermis cannot be sloughed off and die; and 3, the locusta migratoria 3 th instar slough dies 1-2 days after 4 th instar.

FIG. 5 is a graph showing the effect of dsRNA (dsLmV-ATPase-C) injection of V-ATPase-C gene on mRNA expression of V-ATPase-C gene after 3-year migratory locust. dsGFP is used as a control, dsLmV-ATPase-C is used as a treatment group, and beta-actin is used as an internal reference gene. Wherein P < 0.001.

FIG. 6 shows the effect of dsRNA (dsLmV-ATPase-C) injection of V-ATPase-C gene on growth and development of 3-year migratory locust. Controls injected with dsGFP on the left, and controls injected with SEQ ID NO: 13 synthetic dsRNA, i.e., dsLmV-ATPase-C. Wherein, 1 is that the ridge line of the locusta migratoria at 3 th and 4 th instar slough of the treatment group is cracked and the back is arched and dies; 2, the locusta migratoria 3 th instar slough dies 1-2 days after 4 th instar.

FIG. 7 is a graph showing the effect on V-ATPase-D gene mRNA expression after injection of dsRNA of V-ATPase-D gene (dsLmV-ATPase-D) to 3-year migratory locust. dsGFP is used as a control, dsLmV-ATPase-C is used as a treatment group, and beta-actin is used as an internal reference gene. Wherein P < 0.01.

FIG. 8 shows the effect of dsRNA injection of V-ATPase-D gene (dsLmV-ATPase-D) on growth and development of 3-year migratory locust. Controls injected with dsGFP on the left, and controls injected with SEQ ID NO: 18 synthetic dsRNA, i.e., dsLmV-ATPase-D. Wherein 1 is death 1-2 days before 3-year ghost and 4-year ghost of migratory locust of the treatment group. 2, the old epidermis of the migratory locust of the treatment group can not be smoothly sloughed off for death when the migratory locust is 3 years old and is 4 years old. And 3, the locusta migratoria 3 th instar slough dies 1-2 days after 4 th instar.

FIG. 9 is a graph showing the effect of dsRNA (dsLmV-ATPase-E) injection of V-ATPase-E gene on V-ATPase-E gene mRNA expression after 3-year migratory locust. dsGFP is used as a control, dsLmV-ATPase-E is used as a treatment group, and beta-actin is used as an internal reference gene. Wherein P < 0.001.

FIG. 10 shows the effect of dsRNA injection of V-ATPase-E gene (dsLmV-ATPase-E) on growth and development of 3-year migratory locust. Controls injected with dsGFP on the left, and controls injected with SEQ ID NO: 23 synthetic dsRNA, i.e., dsLmV-ATPase-E. Wherein 1 is death of the locusta migratoria at 3 rd stage and 1-2 days before the ghost at 4 th stage; 2, the ridge line of the locusta migratoria 3-year slough of the treatment group at 4-year is cracked and the back is arched and dead.

FIG. 11 is a graph showing the effect of dsRNA (dsLmV-ATPase-F) injection of V-ATPase-F gene on mRNA expression of V-ATPase-F gene after 3-year migratory locust. dsGFP is used as a control, dsLmV-ATPase-F is used as a treatment group, and beta-actin is used as an internal reference gene. Wherein P < 0.01.

FIG. 12 is a graph showing the effect of dsRNA (dsLmV-ATPase-F) injection of V-ATPase-F gene on growth and development of 3-year migratory locust. Controls injected with dsGFP on the left, and controls injected with SEQ ID NO: 28 synthetic dsRNA, i.e., dsLmV-ATPase-F. Wherein 1 is that old epidermis can not be smoothly sloughed off and die when the locusta migratoria 3 th instar is sloughed for 4 th instar; 2, the locusta migratoria 3 th instar slough dies 1-2 days after 4 th instar.

FIG. 13 is a graph showing the effect on V-ATPase-G gene mRNA expression after injection of V-ATPase-G gene dsRNA (dsLmV-ATPase-G) to 3-year migratory locust. dsGFP is used as a control, dsLmV-ATPase-G is used as a treatment group, and beta-actin is used as an internal reference gene. Wherein P < 0.001.

FIG. 14 shows the effect of dsRNA (dsLmV-ATPase-G) injection of V-ATPase-G gene on growth and development of 3-year migratory locust. Controls injected with dsGFP on the left, and controls injected with SEQ ID NO: 33 synthetic dsRNA, i.e., dsLmV-ATPase-G. Wherein 1 is death 1-2 days before 3-year ghost and 4-year ghost of migratory locust of the treatment group. 2, the old epidermis of the migratory locust of the treatment group can not be smoothly sloughed off for death when the migratory locust is 3 years old and is 4 years old.

Detailed Description

The technical scheme of the invention is further explained by the specific embodiment in combination with the attached drawings. It should be understood by those skilled in the art that the specific embodiments are only for the understanding of the present invention and should not be construed as the specific limitations of the present invention.

The locusta migratoria V-ATPase-V1 structural domain gene comprises the following genes:

the nucleotide sequence of the migratory locust V-ATPase-A gene is SEQ ID NO: 1;

the nucleotide sequence of the migratory locust V-ATPase-B gene is SEQ ID NO: 6;

the nucleotide sequence of the migratory locust V-ATPase-C gene is SEQ ID NO: 11;

the nucleotide sequence of the migratory locust V-ATPase-D gene is SEQ ID NO: 16;

the nucleotide sequence of the migratory locust V-ATPase-E gene is SEQ ID NO: 21;

the nucleotide sequence of the migratory locust V-ATPase-F gene is SEQ ID NO: 26;

the nucleotide sequence of the migratory locust V-ATPase-G gene is SEQ ID NO: 31.

example 1: obtaining of each gene and gene fragment in V-ATPase-V1 structural domain of migratory locust

1) Acquisition of each gene in V-ATPase-V1 domain of migratory locust

The locusta migratoria V-ATPase-V1 structural domain genes comprise 7 genes of locusta migratoria V-ATPase-A, locusta migratoria V-ATPase-B, locusta migratoria V-ATPase-C, locusta migratoria V-ATPase-D, locusta migratoria V-ATPase-E, locusta migratoria V-ATPase-F and locusta migratoria V-ATPase-G.

On the basis of a transcriptome database of the migratory locust, searching migratory locust V-ATPase-A, migratory locust V-ATPase-B, migratory locust V-ATPase-C, migratory locust V-ATPase-D, migratory locust V-ATPase-E, migratory locust V-ATPase-F and migratory locust V-ATPase-G genes by adopting a bioinformatics method to obtain a migratory locust V-ATPase-A gene (LmV-ATPase-A) sequence, a migratory locust V-ATPase-B gene (LmV-ATPase-B) sequence, a migratory locust V-ATPase-C gene (LmV-ATPase-C) sequence, a migratory locust V-ATPase-D gene (LmV-ATPase-D) sequence, a migratory locust V-ATPase-E gene (LmV-ATPase-E) sequence and a migratory locust V-ATPase-D gene (LmV-ATPase-F) sequence, the sequence of the migratory locust V-ATPase-G gene (LmV-ATPase-G).

The primer premier 5.0 software was used to design respective upstream and downstream primers for verifying the respective sequences obtained above, the primers were synthesized by Biotechnology engineering (Shanghai) Ltd. Selecting 4 heads of 3-year migratory locust which is healthy in growth and is half male and female, quickly dissecting the body wall of the migratory locust under a body type microscope, and freezing the migratory locust in liquid nitrogen. RNA was extracted according to TaKaRa RNAi RNAioso Plus kit, the RNA was Reverse transcribed into first strand cDNA using Reverse Transcriptase M-MLV (RNase H-) reagent according to the instructions, the cDNA was used as a template in combination with designed upstream and downstream primers of each gene, and LmV-ATPase-A gene cDNA full length sequence, LmV-ATPase-B gene cDNA full length sequence, LmV-ATPase-C gene cDNA full length sequence, LmV-ATPase-D gene cDNA full length sequence, LmV-ATPase-E gene cDNA full length sequence, LmV-ATPase-F gene full length cDNA sequence, LmV-ATPase-G gene cDNA full length sequence were amplified by PCR. The obtained products are respectively purified, cloned and transformed into escherichia coli, and sent to a company Limited in Biotechnology engineering (Shanghai) for sequencing, and the results are as follows:

the V-ATPase-A gene sequence of locusta migratoria is SEQ ID NO: 1, the length of the nucleotide is 1848 bp;

the V-ATPase-B gene sequence of locusta migratoria is SEQ ID NO: 6, the length of the nucleotide is 1503 bp;

the V-ATPase-C gene sequence of locusta migratoria is SEQ ID NO: 11, the length of the nucleotide is 1158 bp;

the V-ATPase-D gene sequence of locusta migratoria is SEQ ID NO: 16, the length of the nucleotide is 753 bp;

the V-ATPase-E gene sequence of locusta migratoria is SEQ ID NO: 21, the length of the nucleotide is 684 bp;

the V-ATPase-F gene sequence of locusta migratoria is SEQ ID NO: 26, the length of the nucleotide is 372 bp;

the V-ATPase-G gene sequence of locusta migratoria is SEQ ID NO: 31, the nucleotide length is 357 bp.

2) Amino acid sequence analysis of each gene in V-ATPase-V1 domain of migratory locust

The nucleotide sequence of the obtained LmV-ATPase-A, LmV-ATPase-B, LmV-ATPase-C, LmV-ATPase-D, LmV-ATPase-E, LmV-ATPase-F, LmV-ATPase-G gene is translated through ExPasy online software, and the open reading frame coding, molecular weight and isoelectric point of each gene are predicted, and the results are as follows:

the open reading frame of the LmV-ATPase-A gene encodes 615 amino acids, the molecular weight is 58KDa, and the isoelectric point is 5.11;

the open reading frame of LmV-ATPase-B gene encodes 500 amino acids, the molecular weight is 55.6KDa, and the isoelectric point is 5.33;

the open reading frame of the LmV-ATPase-C gene codes 385 amino acids, the molecular weight is 44.4KDa, and the isoelectric point is 8.16;

the open reading frame of LmV-ATPase-D gene encodes 250 amino acids, the molecular weight is 28KDa, and the isoelectric point is 9.63;

the open reading frame of the LmV-ATPase-E gene codes 227 amino acids, the molecular weight is 28KDa, and the isoelectric point is 8.51;

the open reading frame of the LmV-ATPase-F gene codes 123 amino acids, the molecular weight is 13.8KDa, and the isoelectric point is 5.92;

the open reading frame of the LmV-ATPase-G gene codes 118 amino acids, the molecular weight is 14KDa, and the isoelectric point is 9.66.

3) Obtaining of each gene fragment in V-ATPase-V1 domain of migratory locust

According to SEQ ID NO: 1, and a primer premier 5.0 software is adopted to design a specific primer, wherein the sequence of an upstream primer is SEQ ID NO: 4, the sequence of the downstream primer is SEQ ID NO: 5, all primers were synthesized by Biotechnology engineering (Shanghai) Inc. The method comprises the following steps of: 1 as a template, carrying out PCR amplification to obtain a migratory locust V-ATPase-A gene fragment, purifying and cloning the obtained product, transforming the purified product into escherichia coli, and sending the escherichia coli to a company Limited in Biotechnology engineering (Shanghai) for sequencing, wherein the sequence of the escherichia coli is SEQ ID NO: 3.

according to SEQ ID NO: 6, designing a specific primer by using primer premier 5.0 software, wherein the sequence of an upstream primer is SEQ ID NO: 9, the sequence of the downstream primer is SEQ ID NO: all primers were synthesized by Biotechnology engineering (Shanghai) Inc. The method comprises the following steps of: 6 as a template, carrying out PCR amplification to obtain a migratory locust V-ATPase-B gene fragment, purifying and cloning the obtained product, transforming the purified product into escherichia coli, and sending the escherichia coli to a company Limited in Biotechnology engineering (Shanghai) for sequencing, wherein the sequence of the migratory locust V-ATPase-B gene fragment is SEQ ID NO: 8.

according to SEQ ID NO: 11, designing a specific primer by using primer premier 5.0 software, wherein the sequence of an upstream primer is SEQ ID NO: 14, the sequence of the downstream primer is SEQ ID NO: all primers were synthesized by Biotechnology engineering (Shanghai) Inc. The method comprises the following steps of: 11 as a template, carrying out PCR amplification to obtain a migratory locust V-ATPase-C gene fragment, purifying and cloning the obtained product, transforming the purified product into escherichia coli, and sending the escherichia coli to a company Limited in Biotechnology engineering (Shanghai) for sequencing, wherein the sequence of the migratory locust V-ATPase-C gene fragment is SEQ ID NO: 13.

according to SEQ ID NO: 16, and designing a specific primer by using primer premier 5.0 software, wherein the sequence of an upstream primer is SEQ ID NO: 19, the sequence of the downstream primer is SEQ ID NO: all primers were synthesized by Biotechnology engineering (Shanghai) Inc. The method comprises the following steps of: 16 as a template, carrying out PCR amplification to obtain a migratory locust V-ATPase-A gene fragment, purifying and cloning the obtained product, transforming the purified product into escherichia coli, and sending the escherichia coli to a company Limited in Biotechnology engineering (Shanghai) for sequencing, wherein the sequence of the escherichia coli is SEQ ID NO: 18.

according to SEQ ID NO: 21, designing a specific primer by using primer premier 5.0 software, wherein the sequence of an upstream primer is SEQ ID NO: 24, the sequence of the downstream primer is SEQ ID NO: 25, all primers were synthesized by Biotechnology engineering (Shanghai) Inc. The method comprises the following steps of: 21 as a template, carrying out PCR amplification to obtain a migratory locust V-ATPase-A gene fragment, purifying and cloning the obtained product, transforming the purified product into escherichia coli, and sending the escherichia coli to a company Limited in Biotechnology engineering (Shanghai) for sequencing, wherein the sequence of the migratory locust V-ATPase-A gene fragment is SEQ ID NO: 23.

according to SEQ ID NO: 26, designing a specific primer by using primer premier 5.0 software, wherein the sequence of an upstream primer is SEQ ID NO: 29, the sequence of the downstream primer is SEQ ID NO: 30, all primers were synthesized by Biotechnology engineering (Shanghai) Inc. The method comprises the following steps of: 26 as a template, carrying out PCR amplification to obtain a migratory locust V-ATPase-A gene fragment, purifying and cloning the obtained product, transforming the purified product into escherichia coli, and sending the escherichia coli to a company Limited in Biotechnology engineering (Shanghai) for sequencing, wherein the sequence of the migratory locust V-ATPase-A gene fragment is SEQ ID NO: 28.

according to SEQ ID NO: 31, and designing a specific primer by using primer premier 5.0 software, wherein the sequence of an upstream primer is SEQ ID NO: 34, the sequence of the downstream primer is SEQ ID NO: 35, all primers were synthesized by Biotechnology engineering (Shanghai) Inc. The method comprises the following steps of: 31 as a template, carrying out PCR amplification to obtain a migratory locust V-ATPase-A gene fragment, purifying and cloning the obtained product, transforming the purified product into escherichia coli, and sending the escherichia coli to a company Limited in Biotechnology engineering (Shanghai) for sequencing, wherein the sequence of the migratory locust V-ATPase-A gene fragment is SEQ ID NO: 33.

example 2: synthesis of dsRNA (double-stranded ribonucleic acid) specific to each gene in V-ATPase-V1 domain of migratory locust

The sequences were determined using the sequences of SEQ ID NOs: 3. SEQ ID NO: 8. SEQ ID NO: 13. SEQ ID NO: 18. SEQ ID NO: 23. SEQ ID NO: 28. SEQ ID NO: 33 as a template, purified with Gel Extraction Kit (OMEGA) Kit, and then HiScribe^TM T7 High Yield RNA Synthesis Kit(NEW ENGLAND

Inc.) kit demonstrates in vitro transcription synthesis of the corresponding dsRNA. Quantification was performed using NANODROP 2000(Thermo scientific) to achieve a final concentration of 2. mu.g/. mu.L. Storing in a super low-temperature refrigerator at-80 deg.C for use.

Example 3: experiments on lethal locusts migratoria through dsRNA of each gene in V-ATPase-V1 domain

1) Injection of dsRNA of each gene of V-ATPase-V1 structural domain of migratory locust

And selecting 72 th day-1 nymphs with healthy growth and consistent size for injection of LmV-ATPase-A gene dsRNA (dsLmV-ATPase-A). Synthetic dsLmV-ATPase-A3. mu.L (6. mu.g dsLmV-ATPase-A) was gently injected between the two and three abdominal segments of the nymph flank using a microsyringe. The same amount of dsGFP was injected into the control group at the same time. And (3) feeding the migratory locusts injected with the dsRNA in an artificial climate box (the illumination time is 14h:10h, the temperature is 30 +/-2 ℃, the humidity is 60 percent), and feeding fresh wheat seedlings and wheat bran every day.

The injection method and the injection amount of V-ATPase-B gene dsRNA (dsLmV-ATPase-B) are the same as those of V-ATPase-A gene dsRNA. The control group was injected with the same amount of dsGFP.

The injection method and the injection amount of V-ATPase-C gene dsRNA (dsLmV-ATPase-C) are the same as those of V-ATPase-A gene dsRNA. The control group was injected with the same amount of dsGFP.

The injection method and the injection amount of V-ATPase-D gene dsRNA (dsLmV-ATPase-D) are the same as those of V-ATPase-A gene dsRNA. The control group was injected with the same amount of dsGFP.

The injection method and the injection amount of V-ATPase-E gene dsRNA (dsLmV-ATPase-E) are the same as those of V-ATPase-A gene dsRNA. The control group was injected with the same amount of dsGFP.

The injection method and the injection amount of V-ATPase-F gene dsRNA (dsLmV-ATPase-F) are the same as those of V-ATPase-A gene dsRNA. The control group was injected with the same amount of dsGFP.

The injection method and the injection amount of V-ATPase-G gene dsRNA (dsLmV-ATPase-G) are the same as those of V-ATPase-A gene dsRNA. The control group was injected with the same amount of dsGFP.

2) Detection of silencing efficiency of each gene in V-ATPase-V1 structural domain of migratory locust

Collecting the nymphs at the time point of 24h from a control group injected with dsGFP and a treatment group injected with dsLmV-ATPase-A, dsLmV-ATPase-B, dsLmV-ATPase-C, dsLmV-ATPase-D, dsLmV-ATPase-E, dsLmV-ATPase-F and dsLmV-ATPase-G respectively to perform total RNA extraction, wherein each gene dsRNA group of the control and the V-ATPase-V1 domain is 3 biological repeats, each biological repeat is 3 worms tested and is reversely transcribed into first strand cDNA, and each target gene is detected by an RT-qPCR method (LmV-ATPase-A, LmV-ATPase-B, dsLmV-ATPase-C, ATPase-C,LmV-ATPase-D, LmV-ATPase-E, LmV-ATPase-F and LmV-ATPase-G) and an internal reference gene (beta-actin) to calculate the silencing efficiency. RT-qPCR reaction system and program reference

Green Realtime PCR Master Mix (TOYOBO) instructions. The results showed that the dsLmV-ATPase-A group injected test insect LmV-ATPase-A gene expression was significantly reduced compared to the control group<0.001 (FIG. 1), the dsLmV-ATPase-B group test insects LmV-ATPase-B gene expression was significantly reduced<0.01 (FIG. 3), the dsLmV-ATPase-C group injected test insects LmV-ATPase-C gene expression was significantly reduced<0.001 (FIG. 5), the dsLmV-ATPase-D group test insects LmV-ATPase-D gene expression was significantly reduced<0.001 (FIG. 7), the dsLmV-ATPase-E group injected test insects LmV-ATPase-E gene expression was significantly reduced<0.001 (FIG. 9), the dsLmV-ATPase-F group injected test insects LmV-ATPase-F gene expression was significantly reduced<0.001 (FIG. 11), dsLmV-ATPase-G group injected test insect LmV-ATPase-G gene expression was significantly reduced<0.001 (fig. 13).

3) Phenotypic observation of 3-year-old nymphs after injection of V-ATPase-V1 domain gene dsRNA

After 3-year nymphs inject dsLmV-ATPase-A, the control group insects successfully molt to 4 years on day 5, and the development state of the molted insects is good. Compared with a control group, the locusta migratoria after dsLmV-ATPase-A injection has the death rate of 79.7 percent and the phenotype is as follows: 1, treating group locusts of 3-year slough of 4-year old to cause ridge line cracking and back bowing and death; 2, the locusta migratoria 3 th instar slough dies 1-2 days after 4 th instar. 3, the locusta migratoria 4 th instar slough dies 1-2 days before 5 th instar; the old epidermis of the locusta migratoria 4 th instar can not be sloughed off and die at 5 th instar, and the result is shown in fig. 2.

After 3-year nymphs inject dsLmV-ATPase-B, the control group insects successfully molt to 4 years on day 5, and the development state of the molted insects is good. Compared with a control group, the locusta migratoria after dsLmV-ATPase-B injection has the mortality rate of 85.7 percent and the phenotype is as follows: 1 is death 1-2 days before 3-year ghost of locusta migratoria of the treatment group and 4-year ghost. 2, when the locusta migratoria 3 th instar is sloughed for 4 th instar, the old epidermic compact inclusion body can not be sloughed off and die. The result of death 1-2 days after the 3 rd ghost of locusta migratoria of the treatment group was shown in fig. 4.

After 3-year nymphs inject dsLmV-ATPase-C, the control group insects successfully molt to 4 years on day 5, and the development state of the molted insects is good. Compared with a control group, the locusta migratoria after dsLmV-ATPase-C injection has the death rate of 69.8 percent and the phenotype is as follows: 1, the ridge line is cracked and can not successfully molt and die when the locusta migratoria 3 th instar molting is 4 th instar; 2, the locusta migratoria 3-year ghost died 1-2 days after 4-year, and the results are shown in FIG. 6.

After 3-year nymphs inject dsLmV-ATPase-D, the control group insects successfully molt to 4 years on day 5, and the development state of the molted insects is good. Compared with a control group, the locusta migratoria after dsLmV-ATPase-D injection has the death rate of 90.4 percent and the phenotype is as follows: 1 is death 1-2 days before 3-year ghost of migratory locust and 4-year ghost. 2, the old epidermis of the migratory locust of the treatment group can not be smoothly sloughed off for death when the migratory locust is 3 years old and is 4 years old. The result of death 1-2 days after the 3 rd ghost of locusta migratoria of the treatment group was shown in fig. 8.

After 3-year nymphs inject dsLmV-ATPase-E, the control group insects successfully molt to 4 years on day 5, and the development state of the molted insects is good. Compared with a control group, the locusta migratoria after dsLmV-ATPase-E injection has the mortality rate of 93.5 percent and the phenotype is as follows: 1 is death 1-2 days before 3-year ghost of migratory locust and 4-year ghost. Fig. 2 shows the results of the treatment group locusta migratoria 3-year slough at 4-year old with dorsal fissure and dorsal arch and death.

After 3-year nymphs inject dsLmV-ATPase-F, the control group insects successfully molt to 4 years on day 5, and the development state of the molted insects is good. Compared with a control group, the locusta migratoria after dsLmV-ATPase-F injection has the mortality rate of 77.8 percent and the phenotype is as follows: 1, old epidermis can not be smoothly sloughed off and die when the locusta migratoria 3 th instar is sloughed for 4 th instar; 2, the locusta migratoria 3-year ghost died 1-2 days after 4-year, and the results are shown in FIG. 12.

After 3-year nymphs inject dsLmV-ATPase-G, the control group insects successfully molt to 4 years on day 5, and the development state of the molted insects is good. Compared with a control group, the locusta migratoria after dsLmV-ATPase-G injection has the mortality rate of 60.3 percent and the phenotype is as follows: 1 is death 1-2 days before 3-year ghost of migratory locust and 4-year ghost. FIG. 2 shows that the old epidermis of the locusta migratoria at 3 rd stage and 4 th stage did not smoothly slough off, and the results are shown in FIG. 14.

In conclusion, the V-ATPase-V1 structural domain gene fragments of the migratory locust comprise the gene fragments of V-ATPase-A, V-ATPase-B, V-ATPase-C, V-ATPase-D, V-ATPase-E, V-ATPase-F and V-ATPase-G, and the dsRNA synthesized by each gene fragment can silence target genes specifically after being injected into the body cavity of the migratory locust, so that the migratory locust is prevented from growing and developing and causes death, and the death rate reaches 60.3% -93.7%. Therefore, the dsRNA of the V-ATPase-V1 structural domain gene of the migratory locust is applied to the control of the migratory locust, and the specific implementation method is as follows: the dsRNA is prepared into a spraying pesticide, or the dsRNA is prepared into a bait, or the dsRNA is transferred into a migratory locust feeding plant body. Optionally, one or more dsRNA is/are prepared into a spraying pesticide or a bait, or the dsRNA is transferred into a feeding plant body of the migratory locust and is applied to the control of the migratory locust.

The above description is only for the specific embodiments of the present invention, but the scope of the present invention is not limited thereto, and any changes or substitutions that can be easily conceived by those skilled in the art within the technical scope of the present invention are included in the scope of the present invention. Therefore, the protection scope of the present invention shall be subject to the protection scope of the appended claims.

LmV-ATPase-A SEQ ID NO：1

atgacgagcacattgataaagacgtccgatgaggaccgggagtccaaattcggctttgtttttgccgtatctggacctgtggtgacagctgaacgaatggccggttctgctatgtacgaactggtgcgtgtcggttattatgaactggtcggagagatcatccggttggagggtgacatggcaacaatccaagtatacgaagacacctcaggtgtgacagtaggcgatcccgtgctgcgcacaggcaagccgctgtccgtggaactgggacccggaatcatgggcagcatcttcgacggtatccagcgaccgctgaaggatatcaatgaactgtcaaatagtatctacatcccgaaaggtgtcaatgtgcctgccctgagtcgcactgcacagtgggacttcagtcccgtcagtgtcaaggttggaagccacattactggtggtgacctgtacggtttggtccacgaaaatactctggtgaaacacaagttgctgctgccgccccgtgccaagggaactgtcacgtacattgcagaacctggaaactacacagttgatgatgttgtcctggagacagaatttgacggcgagcgatcaaagttcaccatgctgcaagtgtggcctgtacgtcagcccaggcctgttacagaaaagttgccagctaactaccccctccttactggccagcgtgtgctcgactccctattcccgtgtgtccagggtggaacaacagctattcctggggccttcggatgtggcaagactgtaatatcacagtctttgtcaaaatactcaaactccgatgtaattatctatgtaggttgtggtgagcgaggtaatgaaatgtcagaagtactcagggatttccccgagttgtcggtggagattgatggtgtgactgaatcaatcatgaagagaacagccctggtcgcaaacacatcaaacatgcctgtggctgctcgagaagcatctatctacacaggtattacactgtcagaatacttcagggacatgggttacaatgtatccatgatggctgactcaacttcacgatgggccgaagctcttcgagaaatctcaggtcgattggctgaaatgcctgccgacagcggttatcccgcctacctaggtgcacgacttgccagtttctacgagcgtgccggccgtgtgaagtgcttgggtaacccagacagggagggctccgtgagtatagtgggcgccgtgtcgccgcccggtggagacttctcagatcccgtgacgacggccacactaggtatcgtccaggtgttctggggtctcgacaagaaacttgcccagcgaaagcacttcccatccatcaactggctcatctcgtacagtaaatacatgcgtgctctggatgacttctacgacaagaatttcccagagtttgtcccactgcgtacaaaggtgaaggagattttgcaggaggaagaagacctgtctgaaattgtgcagttggtcggtaaagcttcattggcagaaactgacaagatcacacttgaggttgccaaactattaaaggatgatttcctgcaacagaacagctattcaccatatgaccgtttctgcccattctacaagacagtaggaatgctgaaaaatatgattgctttctacgatatgtctcggcatgcagttgaatctactgctcagagcgagaacaagatcacttggaatgttattagagattctatgggcaatattctgtatcagctttcctccatgaaattcaaggatccagtcaaggatggagaagcgaagatcaaggcagactttgagcagcttcatgaagacattcagcaagccttcaggaacctggaggattaa

LmV-ATPase-A SEQ ID NO：2

MTSTLIKTSDEDRESKFGFVFAVSGPVVTAERMAGSAMYELVRVGYYELVGEIIRLEGDMATIQVYEDTSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINELSNSIYIPKGVNVPALSRTAQWDFSPVSVKVGSHITGGDLYGLVHENTLVKHKLLLPPRAKGTVTYIAEPGNYTVDDVVLETEFDGERSKFTMLQVWPVRQPRPVTEKLPANYPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELSVEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPDREGSVSIVGAVSPPGGDFSDPVTTATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNFPEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSPYDRFCPFYKTVGMLKNMIAFYDMSRHAVESTAQSENKITWNVIRDSMGNILYQLSSMKFKDPVKDGEAKIKADFEQLHEDIQQAFRNLED

LmV-ATPase-A SEQ ID NO：3

gcaaacacatcaaacatgcctgtggctgctcgagaagcatctatctacacaggtattacactgtcagaatacttcagggacatgggttacaatgtatccatgatggctgactcaacttcacgatgggccgaagctcttcgagaaatctcaggtcgattggctgaaatgcctgccgacagcggttatcccgcctacctaggtgcacgacttgccagtttctacgagcgtgccggccgtgtgaagtgcttgggtaacccagacagggagggctccgtgagtatagtgggcgccgtgtcgccgcccggtggagacttctcagatcccgtgacgacggccacactaggtatcgtccaggtgttctggggtctcgacaagaaacttgcccagcgaaagcacttcccatccatcaactggctcatctcgtacagtaaatacatgcgtgctctggatgacttctacgacaagaatttcccagagtttgtcccactgcgtacaaaggt

LmV-ATPase-A SEQ ID NO：4

taatacgactcactataggggcaaacacatcaaacatgcc

LmV-ATPase-A SEQ ID NO：5

taatacgactcactatagggacctttgtacgcagtgggac

LmV-ATPase-B SEQ ID NO：6

atgtcgtacaacaaagttataagtccaaatcaggcgaataaagaacatgttttggcagtttcaagagattttatatcccagcctcgtctaacatataaaactgtatctggtgtcaatggaccactagttattctcgacgaagttaagttcccaaagttcgctgaaattgttcagttgaaacttgcagatggaactatcagatcgggccaggtcttggaagtcagtggatctaaagctgttgtccaagtttttgaaggtacatcaggtatagacgccaaaaatacactatgtgaattcacaggagatattctgcggacaccagtgtcagaggatatgttgggcagagtattcaatgggagtgggaaacccattgacaaaggcccacctattttggctgaagattatcttgatattcagggtcaacctattaacccatggtctcgtatatatccggaagaaatgatccagacaggtatatctgccattgatgtgatgaattccattgcccgtgggcaaaagattccaatcttctctgctgctggcttgccacacaatgaaattgctgctcagatctgccgtcaagcaggacttgttaagcttccaggaaagtcagttttggatgatcatgaggataattttgctatcgtatttgcagctatgggtgttaacatggagacagctcgtttcttcaagcaggactttgaggaaaatggttctatggaaaacgtgtgtctgttcttgaacttggccaatgatccaaccattgaacgtatcatcacaccccggcttgcattgacagctgctgaattcctggcatatcaatgtgagaaacacgtattagtcattctcacagacatgagttcatatgctgaggctttgcgagaggtttcagctgctagggaggaagtaccagggcgaagaggattccctggttacatgtacacagatcttgccaccatctatgaaagagctgggagagtggaaggtcgaagtggttccattacacagattcccattctgactatgcccaatgatgacattacacatcctatcccagatctgacaggatacatcacagaaggtcaaatatatgtagaccgtcagttgcacaacaggcaaatatatcctccagtcaatgtattgccatcactcagtcgtctcatgaagtcggccattggtgaaaacatgactcgtaaggaccatgctgatgtatcaaaccagctgtacgcttgttacgctattgggaaagatgtgcaggccatgaaggctgttgttggtgaggaagctcttaccccagatgaccttctgtatctcgaattcctcacaaaatttgagaagaatttcatatctcaaggtaactatgagaaccgtaccgtatttgaatcattggatattggttggcaactgcttcgaattttcccgaaggagatgttgaagaggatcccagcatcaatacttgcagaattctatccacgtgactcaagacaccctcaaactaaatag

LmV-ATPase-B SEQ ID NO：7

MSYNKVISPNQANKEHVLAVSRDFISQPRLTYKTVSGVNGPLVILDEVKFPKFAEIVQLKLADGTIRSGQVLEVSGSKAVVQVFEGTSGIDAKNTLCEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIQGQPINPWSRIYPEEMIQTGISAIDVMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKLPGKSVLDDHEDNFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITPRLALTAAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRSGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPVNVLPSLSRLMKSAIGENMTRKDHADVSNQLYACYAIGKDVQAMKAVVGEEALTPDDLLYLEFLTKFEKNFISQGNYENRTVFESLDIGWQLLRIFPKEMLKRIPASILAEFYPRDSRHPQTK

LmV-ATPase-B SEQ ID NO：8

tgacagctgctgaattcctggcatatcaatgtgagaaacacgtattagtcattctcacagacatgagttcatatgctgaggctttgcgagaggtttcagctgctagggaggaagtaccagggcgaagaggattccctggttacatgtacacagatcttgccaccatctatgaaagagctgggagagtggaaggtcgaagtggttccattacacagattcccattctgactatgcccaatgatgacattacacatcctatcccagatctgacaggatacatcacagaaggtcaaatatatgtagaccgtcagttgcacaacaggcaaatatatcctccagtcaatgtattgccatcactcagtcgtctcatgaagtcggccattggtgaaaacatgactcgtaaggaccatgctgatgtatcaaaccagctgtacgcttgttacgctattgggaaagatgtgcaggccatgaaggctgttgttggtgag

LmV-ATPase-B SEQ ID NO：9

taatacgactcactatagggtgacagctgctgaattcctg

LmV-ATPase-B SEQ ID NO：10

taatacgactcactatagggctcaccaacaacagccttca

LmV-ATPase-C SEQ ID NO：11

atgacggaatactggctaatatcggctccaggagacaaaacttgccagcaaacatgggaaactttgaataatctgacgagtaaacagaacaatgtatcagtaaactacaaattccatattccagacctaaaggttggtacactggatcagctggttggtttatcagatgatttagggaagctagacagctatgttgaacaagtgaccaggaaggttgcagcctatcttggtgaagtactcgaagaccaaagagacaaactccatgaaaaccttttggcaaacaatagtgatcttcctgggtacatcacacgttttcagtgggatatggcaaaatatcccatcaaacaatctttgcggaacatagctgacattatcagtaaacaagtaggtcagatagatgctgatttaaaaacaaaatctactgcttataataatttgaaaggcaacctgcaaaatctggagaagaagcaaactgggagtctactaacgagaaatctcgctgatttagtgaagaaagagcacttcatattggattctgaataccttactacactattggttattgtaccaaaaatactattcaatgaatggaatcagaactatgagaaaattacagatatgattgtacctcgatcaagccaattgatttaccaggattcggactttggcttgtacactgtgactttgttcaagaaagttgttgatgaatttaaactccatgctcgagagagaaagtttgttgtaagagatttcacttacaatgaggaagaattgttggctgggaaaaatgaaatgacaaaactggttacggacaagaagaaacaatttggcccattagtacgctggctcaaagtcaacttcagtgaatgtttctgtgcatggatacatgttaaagcactgagagtgtttgtggaatctgttctgaggtatggactgcccgtgaacttccaagctatgctgcttcacccacacaaaaaaagtacgaagaggttacgagacctcctgaaccaattatatggtcatctagacagcagtgcctcacaagggctgggtgcacatgatagtgtggagataccaggacttgggtttggccatgctgagtattacccatatgtttattacaaaattaatgttgatatggttgatactaaagtgtaa

LmV-ATPase-C SEQ ID NO：12

MTEYWLISAPGDKTCQQTWETLNNLTSKQNNVSVNYKFHIPDLKVGTLDQLVGLSDDLGKLDSYVEQVTRKVAAYLGEVLEDQRDKLHENLLANNSDLPGYITRFQWDMAKYPIKQSLRNIADIISKQVGQIDADLKTKSTAYNNLKGNLQNLEKKQTGSLLTRNLADLVKKEHFILDSEYLTTLLVIVPKILFNEWNQNYEKITDMIVPRSSQLIYQDSDFGLYTVTLFKKVVDEFKLHARERKFVVRDFTYNEEELLAGKNEMTKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAMLLHPHKKSTKRLRDLLNQLYGHLDSSASQGLGAHDSVEIPGLGFGHAEYYPYVYYKINVDMVDTKV

LmV-ATPase-C SEQ ID NO：13

aaggcaacctgcaaaatctggagaagaagcaaactgggagtctactaacgagaaatctcgctgatttagtgaagaaagagcacttcatattggattctgaataccttactacactattggttattgtaccaaaaatactattcaatgaatggaatcagaactatgagaaaattacagatatgattgtacctcgatcaagccaattgatttaccaggattcggactttggcttgtacactgtgactttgttcaagaaagttgttgatgaatttaaactccatgctcgagagagaaagtttgttgtaagagatttcacttacaatgaggaagaattgttggctgggaaaaatgaaatgacaaaactggttacggacaagaagaaacaatttggcccattagtacgctggctcaaagtcaacttcagtgaatgtttctgtgcatggatacatgttaaagcactgagagtgtttgtggaatctgttctgaggtatggactgccc

LmV-ATPase-C SEQ ID NO：14

taatacgactcactatagggaaggcaacctgcaaaatctg

LmV-ATPase-C SEQ ID NO：15

taatacgactcactataggggggcagtccatacctcagaa

LmV-ATPase-D SEQ ID NO：16

atgtcgggaaaagacagaattcaaatatttccctcgcgaggtgcgcagatgttaatgaaagctagactaaaaggagcacaaaaaggtcacagtttactgaagaaaaaggcagatgctttgcaaatgcgatttcggcagatactgggcaaaatcatagagactaagacgctcatgggagaagtaatgaaagaagctgctttctcattagctgaagcaaaatttactaccggagatttcaaccaagttgttctgcagaacgtaaatagggcacaagtgaagattcgcacaaagaaggacaatgttgcaggtgttatgttaccagtatttgaaagttatcaagatggttcagacacatatgaactggcaggtttggcaagaggaggacagcagcttgccaaactaaaaaagaactaccagagtgcagtaaagttgttagttgaattagcttctctacagacatcttttgttactcttgacgaggtcatcaaaattaccaatagaagagttaatgcaattgaacatgtaattattccacgcattgaacgtactcttgcctacattatatctgaattggatgaattggagagagaagagttttaccggttgaagaaaattcaagacaagaaacgcatagccagagccaaagccgaggcgaaagcagaagcccagaagcaggccctcctgaaggcgggccaagacgtcacctacaccccgagcctgctcgacgaaggggacgaagacatcttgttctag

LmV-ATPase-D SEQ ID NO：17

MSGKDRIQIFPSRGAQMLMKARLKGAQKGHSLLKKKADALQMRFRQILGKIIETKTLMGEVMKEAAFSLAEAKFTTGDFNQVVLQNVNRAQVKIRTKKDNVAGVMLPVFESYQDGSDTYELAGLARGGQQLAKLKKNYQSAVKLLVELASLQTSFVTLDEVIKITNRRVNAIEHVIIPRIERTLAYIISELDELEREEFYRLKKIQDKKRIARAKAEAKAEAQKQALLKAGQDVTYTPSLLDEGDEDILF

LmV-ATPase-D SEQ ID NO：18

gcgcagatgttaatgaaagctagactaaaaggagcacaaaaaggtcacagtttactgaagaaaaaggcagatgctttgcaaatgcgatttcggcagatactgggcaaaatcatagagactaagacgctcatgggagaagtaatgaaagaagctgctttctcattagctgaagcaaaatttactaccggagatttcaaccaagttgttctgcagaacgtaaatagggcacaagtgaagattcgcacaaagaaggacaatgttgcaggtgttatgttaccagtatttgaaagttatcaagatggttcagacacatatgaactggcaggtttggcaagaggaggacagcagcttgccaaactaaaaaagaactaccagagtgcagtaaagttgttagttgaattagcttctctacagacatcttttgttactcttgacgaggtcatcaaaattaccaatagaagagttaatgcaattgaacatgtaattattccacgcattgaacgtactcttgcctac

LmV-ATPase-D SEQ ID NO：19

taatacgactcactataggggcgcagatgttaatgaaagc

LmV-ATPase-D SEQ ID NO：20

taatacgactcactataggggtaggcaagagtacgttca

LmV-ATPase-E SEQ ID NO：21

atggctctaagcgatgctgatgtccaaaaacagattaagcatatgatggcctttatagatcaagaggcaaatgaaaaggccgaagaaatagatgcaaaagctgaagaagaattcaatattgagaaaggccgattggtgcaacagcaacgtttaaaaataatggaatattatgaaagaaaggaaaaacaagtggaactccagaagaaaattcagtcttcaaacatgctaaaccaagcacgcttaaaagctctgaaagttcgtgaggatcatgtgcgtggtgtacttgaagaggcaagaaagagattgggggagatcacaaaggatcagtctcgatacagccatgttctccatcagttaataatgcaggggctgctgcagctcttggagccgaatgtcactgtaaggacacgtgaagttgaccagcgcattgttgatagcatcttgccagctattacacaaaagtacaaagaaattactggtgggaaggatatctcgctaaaagtggatactgaagccttcttgaacccagaagttactggtggaatagagttgctagcacaaaagggcagaattaaaattgttaatactttggaagcacggctggagctcattgcccagcaacttattcctgagatacgatgtgcattgtttggtcgtaacccaaatcgcaagttcgctgactaa

LmV-ATPase-E SEQ ID NO：22

MALSDADVQKQIKHMMAFIDQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYERKEKQVELQKKIQSSNMLNQARLKALKVREDHVRGVLEEARKRLGEITKDQSRYSHVLHQLIMQGLLQLLEPNVTVRTREVDQRIVDSILPAITQKYKEITGGKDISLKVDTEAFLNPEVTGGIELLAQKGRIKIVNTLEARLELIAQQLIPEIRCALFGRNPNRKFAD

LmV-ATPase-E SEQ ID NO：23

ctaagcgatgctgatgtccaaaaacagattaagcatatgatggcctttatagatcaagaggcaaatgaaaaggccgaagaaatagatgcaaaagctgaagaagaattcaatattgagaaaggccgattggtgcaacagcaacgtttaaaaataatggaatattatgaaagaaaggaaaaacaagtggaactccagaagaaaattcagtcttcaaacatgctaaaccaagcacgcttaaaagctctgaaagttcgtgaggatcatgtgcgtggtgtacttgaagaggcaagaaagagattgggggagatcacaaaggatcagtctcgatacagccatgttctccatcagttaataatgcaggggctgctgcagctcttggagccgaatgtcactgta

LmV-ATPase-E SEQ ID NO：24

taatacgactcactatagggctaagcgatgctgatgtcca

LmV-ATPase-E SEQ ID NO：25

taatacgactcactatagggtacagtgacattcggctcca

LmV-ATPase-F SEQ ID NO：26

atggcattacattcggcttacaaagggaaactcgtctctgtcatcggagatgaggacacctgcgttggctttcttcttggaggagttggagaagtcaataaaagcagacatcccaatttcatggtggtggacaaaaacaccagtgttggtgagatagaagagtgcttcaaaagatttgtgaagagagatgatattgacatcatactgattaaccagaatattgctgagatgattcgacacgtaatcgacagccactcgcagcccgttccgtctgtcctcgagataccgtcaaaggaccatccttatgatgccaccaaagattcgatattacgtagggcaaagggaatgttcaacccagatgacttcaagtaa

LmV-ATPase-F SEQ ID NO：27

MALHSAYKGKLVSVIGDEDTCVGFLLGGVGEVNKSRHPNFMVVDKNTSVGEIEECFKRFVKRDDIDIILINQNIAEMIRHVIDSHSQPVPSVLEIPSKDHPYDATKDSILRRAKGMFNPDDFK

LmV-ATPase-F SEQ ID NO：28

acattcggcttacaaagggaaactcgtctctgtcatcggagatgaggacacctgcgttggctttcttcttggaggagttggagaagtcaataaaagcagacatcccaatttcatggtggtggacaaaaacaccagtgttggtgagatagaagagtgcttcaaaagatttgtgaagagagatgatattgacatcatactgattaaccagaatattgctgagatgattcgacacgtaatcgacagccactcgcagcccgttccgtctgtcctcgagataccgtcaaaggaccatcctta

LmV-ATPase-F SEQ ID NO：29

taatacgactcactatagggacattcggcttacaaaggga

LmV-ATPase-F SEQ ID NO：30

taatacgactcactatagggtaaggatggtcctttgacgg

LmV-ATPase-G SEQ ID NO：31

atggctagccagactcagggaattcaacagcttctagcagctgaaaaaagggcagcagagaaggtttcagaagcaagaaagcgaaaagcacgcaggttgaaacaggccaaagaagaagcccaggaagaaattgaaaaatacagacaagaaagagagaggcagtttaaagagtttgaagcaaagcacatgggctcacgagaggatagggctgcacagattgaagcagaaacaaaagtaaagattgcagaaatggagaaatctgtaaatcagcggaaggaaaagttgatagaaaggattttggaattggtgtacgatatcaagcccgaactccataagaacttcagagctgcaaagtag

LmV-ATPase-G SEQ ID NO：32

MASQTQGIQQLLAAEKRAAEKVSEARKRKARRLKQAKEEAQEEIEKYRQERERQFKEFEAKHMGSREDRAAQIEAETKVKIAEMEKSVNQRKEKLIERILELVYDIKPELHKNFRAAK

LmV-ATPase-G SEQ ID NO：33

aagggcagcagagaaggtttcagaagcaagaaagcgaaaagcacgcaggttgaaacaggccaaagaagaagcccaggaagaaattgaaaaatacagacaagaaagagagaggcagtttaaagagtttgaagcaaagcacatgggctcacgagaggatagggctgcacagattgaagcagaaacaaaagtaaagattgcagaaatggagaaatctgtaaatcagcggaaggaaaagttgat

LmV-ATPase-G SEQ ID NO：34

taatacgactcactatagggaagggcagcagagaaggttt

LmV-ATPase-G SEQ ID NO：35

taatacgactcactatagggatcaacttttccttccgctg

Sequence listing

<110> university of Shanxi

V-ATPase-V1 structural domain gene of <120> migratory locust and application of dsRNA thereof in pest control

<160> 35

<170> SIPOSequenceListing 1.0

<210> 1

<211> 1848

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 1

atgacgagca cattgataaa gacgtccgat gaggaccggg agtccaaatt cggctttgtt 60

tttgccgtat ctggacctgt ggtgacagct gaacgaatgg ccggttctgc tatgtacgaa 120

ctggtgcgtg tcggttatta tgaactggtc ggagagatca tccggttgga gggtgacatg 180

gcaacaatcc aagtatacga agacacctca ggtgtgacag taggcgatcc cgtgctgcgc 240

acaggcaagc cgctgtccgt ggaactggga cccggaatca tgggcagcat cttcgacggt 300

atccagcgac cgctgaagga tatcaatgaa ctgtcaaata gtatctacat cccgaaaggt 360

gtcaatgtgc ctgccctgag tcgcactgca cagtgggact tcagtcccgt cagtgtcaag 420

gttggaagcc acattactgg tggtgacctg tacggtttgg tccacgaaaa tactctggtg 480

aaacacaagt tgctgctgcc gccccgtgcc aagggaactg tcacgtacat tgcagaacct 540

ggaaactaca cagttgatga tgttgtcctg gagacagaat ttgacggcga gcgatcaaag 600

ttcaccatgc tgcaagtgtg gcctgtacgt cagcccaggc ctgttacaga aaagttgcca 660

gctaactacc ccctccttac tggccagcgt gtgctcgact ccctattccc gtgtgtccag 720

ggtggaacaa cagctattcc tggggccttc ggatgtggca agactgtaat atcacagtct 780

ttgtcaaaat actcaaactc cgatgtaatt atctatgtag gttgtggtga gcgaggtaat 840

gaaatgtcag aagtactcag ggatttcccc gagttgtcgg tggagattga tggtgtgact 900

gaatcaatca tgaagagaac agccctggtc gcaaacacat caaacatgcc tgtggctgct 960

cgagaagcat ctatctacac aggtattaca ctgtcagaat acttcaggga catgggttac 1020

aatgtatcca tgatggctga ctcaacttca cgatgggccg aagctcttcg agaaatctca 1080

ggtcgattgg ctgaaatgcc tgccgacagc ggttatcccg cctacctagg tgcacgactt 1140

gccagtttct acgagcgtgc cggccgtgtg aagtgcttgg gtaacccaga cagggagggc 1200

tccgtgagta tagtgggcgc cgtgtcgccg cccggtggag acttctcaga tcccgtgacg 1260

acggccacac taggtatcgt ccaggtgttc tggggtctcg acaagaaact tgcccagcga 1320

aagcacttcc catccatcaa ctggctcatc tcgtacagta aatacatgcg tgctctggat 1380

gacttctacg acaagaattt cccagagttt gtcccactgc gtacaaaggt gaaggagatt 1440

ttgcaggagg aagaagacct gtctgaaatt gtgcagttgg tcggtaaagc ttcattggca 1500

gaaactgaca agatcacact tgaggttgcc aaactattaa aggatgattt cctgcaacag 1560

aacagctatt caccatatga ccgtttctgc ccattctaca agacagtagg aatgctgaaa 1620

aatatgattg ctttctacga tatgtctcgg catgcagttg aatctactgc tcagagcgag 1680

aacaagatca cttggaatgt tattagagat tctatgggca atattctgta tcagctttcc 1740

tccatgaaat tcaaggatcc agtcaaggat ggagaagcga agatcaaggc agactttgag 1800

cagcttcatg aagacattca gcaagccttc aggaacctgg aggattaa 1848

<210> 2

<211> 615

<212> PRT

<213> migratory locust (Locusa migratoria)

<400> 2

Met Thr Ser Thr Leu Ile Lys Thr Ser Asp Glu Asp Arg Glu Ser Lys

1 5 10 15

Phe Gly Phe Val Phe Ala Val Ser Gly Pro Val Val Thr Ala Glu Arg

20 25 30

Met Ala Gly Ser Ala Met Tyr Glu Leu Val Arg Val Gly Tyr Tyr Glu

35 40 45

Leu Val Gly Glu Ile Ile Arg Leu Glu Gly Asp Met Ala Thr Ile Gln

50 55 60

Val Tyr Glu Asp Thr Ser Gly Val Thr Val Gly Asp Pro Val Leu Arg

65 70 75 80

Thr Gly Lys Pro Leu Ser Val Glu Leu Gly Pro Gly Ile Met Gly Ser

85 90 95

Ile Phe Asp Gly Ile Gln Arg Pro Leu Lys Asp Ile Asn Glu Leu Ser

100 105 110

Asn Ser Ile Tyr Ile Pro Lys Gly Val Asn Val Pro Ala Leu Ser Arg

115 120 125

Thr Ala Gln Trp Asp Phe Ser Pro Val Ser Val Lys Val Gly Ser His

130 135 140

Ile Thr Gly Gly Asp Leu Tyr Gly Leu Val His Glu Asn Thr Leu Val

145 150 155 160

Lys His Lys Leu Leu Leu Pro Pro Arg Ala Lys Gly Thr Val Thr Tyr

165 170 175

Ile Ala Glu Pro Gly Asn Tyr Thr Val Asp Asp Val Val Leu Glu Thr

180 185 190

Glu Phe Asp Gly Glu Arg Ser Lys Phe Thr Met Leu Gln Val Trp Pro

195 200 205

Val Arg Gln Pro Arg Pro Val Thr Glu Lys Leu Pro Ala Asn Tyr Pro

210 215 220

Leu Leu Thr Gly Gln Arg Val Leu Asp Ser Leu Phe Pro Cys Val Gln

225 230 235 240

Gly Gly Thr Thr Ala Ile Pro Gly Ala Phe Gly Cys Gly Lys Thr Val

245 250 255

Ile Ser Gln Ser Leu Ser Lys Tyr Ser Asn Ser Asp Val Ile Ile Tyr

260 265 270

Val Gly Cys Gly Glu Arg Gly Asn Glu Met Ser Glu Val Leu Arg Asp

275 280 285

Phe Pro Glu Leu Ser Val Glu Ile Asp Gly Val Thr Glu Ser Ile Met

290 295 300

Lys Arg Thr Ala Leu Val Ala Asn Thr Ser Asn Met Pro Val Ala Ala

305 310 315 320

Arg Glu Ala Ser Ile Tyr Thr Gly Ile Thr Leu Ser Glu Tyr Phe Arg

325 330 335

Asp Met Gly Tyr Asn Val Ser Met Met Ala Asp Ser Thr Ser Arg Trp

340 345 350

Ala Glu Ala Leu Arg Glu Ile Ser Gly Arg Leu Ala Glu Met Pro Ala

355 360 365

Asp Ser Gly Tyr Pro Ala Tyr Leu Gly Ala Arg Leu Ala Ser Phe Tyr

370 375 380

Glu Arg Ala Gly Arg Val Lys Cys Leu Gly Asn Pro Asp Arg Glu Gly

385 390 395 400

Ser Val Ser Ile Val Gly Ala Val Ser Pro Pro Gly Gly Asp Phe Ser

405 410 415

Asp Pro Val Thr Thr Ala Thr Leu Gly Ile Val Gln Val Phe Trp Gly

420 425 430

Leu Asp Lys Lys Leu Ala Gln Arg Lys His Phe Pro Ser Ile Asn Trp

435 440 445

Leu Ile Ser Tyr Ser Lys Tyr Met Arg Ala Leu Asp Asp Phe Tyr Asp

450 455 460

Lys Asn Phe Pro Glu Phe Val Pro Leu Arg Thr Lys Val Lys Glu Ile

465 470 475 480

Leu Gln Glu Glu Glu Asp Leu Ser Glu Ile Val Gln Leu Val Gly Lys

485 490 495

Ala Ser Leu Ala Glu Thr Asp Lys Ile Thr Leu Glu Val Ala Lys Leu

500 505 510

Leu Lys Asp Asp Phe Leu Gln Gln Asn Ser Tyr Ser Pro Tyr Asp Arg

515 520 525

Phe Cys Pro Phe Tyr Lys Thr Val Gly Met Leu Lys Asn Met Ile Ala

530 535 540

Phe Tyr Asp Met Ser Arg His Ala Val Glu Ser Thr Ala Gln Ser Glu

545 550 555 560

Asn Lys Ile Thr Trp Asn Val Ile Arg Asp Ser Met Gly Asn Ile Leu

565 570 575

Tyr Gln Leu Ser Ser Met Lys Phe Lys Asp Pro Val Lys Asp Gly Glu

580 585 590

Ala Lys Ile Lys Ala Asp Phe Glu Gln Leu His Glu Asp Ile Gln Gln

595 600 605

Ala Phe Arg Asn Leu Glu Asp

610 615

<210> 3

<211> 500

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 3

gcaaacacat caaacatgcc tgtggctgct cgagaagcat ctatctacac aggtattaca 60

ctgtcagaat acttcaggga catgggttac aatgtatcca tgatggctga ctcaacttca 120

cgatgggccg aagctcttcg agaaatctca ggtcgattgg ctgaaatgcc tgccgacagc 180

ggttatcccg cctacctagg tgcacgactt gccagtttct acgagcgtgc cggccgtgtg 240

aagtgcttgg gtaacccaga cagggagggc tccgtgagta tagtgggcgc cgtgtcgccg 300

cccggtggag acttctcaga tcccgtgacg acggccacac taggtatcgt ccaggtgttc 360

tggggtctcg acaagaaact tgcccagcga aagcacttcc catccatcaa ctggctcatc 420

tcgtacagta aatacatgcg tgctctggat gacttctacg acaagaattt cccagagttt 480

gtcccactgc gtacaaaggt 500

<210> 4

<211> 40

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 4

taatacgact cactataggg gcaaacacat caaacatgcc 40

<210> 5

<211> 40

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 5

taatacgact cactataggg acctttgtac gcagtgggac 40

<210> 6

<211> 1503

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 6

atgtcgtaca acaaagttat aagtccaaat caggcgaata aagaacatgt tttggcagtt 60

tcaagagatt ttatatccca gcctcgtcta acatataaaa ctgtatctgg tgtcaatgga 120

ccactagtta ttctcgacga agttaagttc ccaaagttcg ctgaaattgt tcagttgaaa 180

cttgcagatg gaactatcag atcgggccag gtcttggaag tcagtggatc taaagctgtt 240

gtccaagttt ttgaaggtac atcaggtata gacgccaaaa atacactatg tgaattcaca 300

ggagatattc tgcggacacc agtgtcagag gatatgttgg gcagagtatt caatgggagt 360

gggaaaccca ttgacaaagg cccacctatt ttggctgaag attatcttga tattcagggt 420

caacctatta acccatggtc tcgtatatat ccggaagaaa tgatccagac aggtatatct 480

gccattgatg tgatgaattc cattgcccgt gggcaaaaga ttccaatctt ctctgctgct 540

ggcttgccac acaatgaaat tgctgctcag atctgccgtc aagcaggact tgttaagctt 600

ccaggaaagt cagttttgga tgatcatgag gataattttg ctatcgtatt tgcagctatg 660

ggtgttaaca tggagacagc tcgtttcttc aagcaggact ttgaggaaaa tggttctatg 720

gaaaacgtgt gtctgttctt gaacttggcc aatgatccaa ccattgaacg tatcatcaca 780

ccccggcttg cattgacagc tgctgaattc ctggcatatc aatgtgagaa acacgtatta 840

gtcattctca cagacatgag ttcatatgct gaggctttgc gagaggtttc agctgctagg 900

gaggaagtac cagggcgaag aggattccct ggttacatgt acacagatct tgccaccatc 960

tatgaaagag ctgggagagt ggaaggtcga agtggttcca ttacacagat tcccattctg 1020

actatgccca atgatgacat tacacatcct atcccagatc tgacaggata catcacagaa 1080

ggtcaaatat atgtagaccg tcagttgcac aacaggcaaa tatatcctcc agtcaatgta 1140

ttgccatcac tcagtcgtct catgaagtcg gccattggtg aaaacatgac tcgtaaggac 1200

catgctgatg tatcaaacca gctgtacgct tgttacgcta ttgggaaaga tgtgcaggcc 1260

atgaaggctg ttgttggtga ggaagctctt accccagatg accttctgta tctcgaattc 1320

ctcacaaaat ttgagaagaa tttcatatct caaggtaact atgagaaccg taccgtattt 1380

gaatcattgg atattggttg gcaactgctt cgaattttcc cgaaggagat gttgaagagg 1440

atcccagcat caatacttgc agaattctat ccacgtgact caagacaccc tcaaactaaa 1500

tag 1503

<210> 7

<211> 500

<212> PRT

<213> migratory locust (Locusa migratoria)

<400> 7

Met Ser Tyr Asn Lys Val Ile Ser Pro Asn Gln Ala Asn Lys Glu His

1 5 10 15

Val Leu Ala Val Ser Arg Asp Phe Ile Ser Gln Pro Arg Leu Thr Tyr

20 25 30

Lys Thr Val Ser Gly Val Asn Gly Pro Leu Val Ile Leu Asp Glu Val

35 40 45

Lys Phe Pro Lys Phe Ala Glu Ile Val Gln Leu Lys Leu Ala Asp Gly

50 55 60

Thr Ile Arg Ser Gly Gln Val Leu Glu Val Ser Gly Ser Lys Ala Val

65 70 75 80

Val Gln Val Phe Glu Gly Thr Ser Gly Ile Asp Ala Lys Asn Thr Leu

85 90 95

Cys Glu Phe Thr Gly Asp Ile Leu Arg Thr Pro Val Ser Glu Asp Met

100 105 110

Leu Gly Arg Val Phe Asn Gly Ser Gly Lys Pro Ile Asp Lys Gly Pro

115 120 125

Pro Ile Leu Ala Glu Asp Tyr Leu Asp Ile Gln Gly Gln Pro Ile Asn

130 135 140

Pro Trp Ser Arg Ile Tyr Pro Glu Glu Met Ile Gln Thr Gly Ile Ser

145 150 155 160

Ala Ile Asp Val Met Asn Ser Ile Ala Arg Gly Gln Lys Ile Pro Ile

165 170 175

Phe Ser Ala Ala Gly Leu Pro His Asn Glu Ile Ala Ala Gln Ile Cys

180 185 190

Arg Gln Ala Gly Leu Val Lys Leu Pro Gly Lys Ser Val Leu Asp Asp

195 200 205

His Glu Asp Asn Phe Ala Ile Val Phe Ala Ala Met Gly Val Asn Met

210 215 220

Glu Thr Ala Arg Phe Phe Lys Gln Asp Phe Glu Glu Asn Gly Ser Met

225 230 235 240

Glu Asn Val Cys Leu Phe Leu Asn Leu Ala Asn Asp Pro Thr Ile Glu

245 250 255

Arg Ile Ile Thr Pro Arg Leu Ala Leu Thr Ala Ala Glu Phe Leu Ala

260 265 270

Tyr Gln Cys Glu Lys His Val Leu Val Ile Leu Thr Asp Met Ser Ser

275 280 285

Tyr Ala Glu Ala Leu Arg Glu Val Ser Ala Ala Arg Glu Glu Val Pro

290 295 300

Gly Arg Arg Gly Phe Pro Gly Tyr Met Tyr Thr Asp Leu Ala Thr Ile

305 310 315 320

Tyr Glu Arg Ala Gly Arg Val Glu Gly Arg Ser Gly Ser Ile Thr Gln

325 330 335

Ile Pro Ile Leu Thr Met Pro Asn Asp Asp Ile Thr His Pro Ile Pro

340 345 350

Asp Leu Thr Gly Tyr Ile Thr Glu Gly Gln Ile Tyr Val Asp Arg Gln

355 360 365

Leu His Asn Arg Gln Ile Tyr Pro Pro Val Asn Val Leu Pro Ser Leu

370 375 380

Ser Arg Leu Met Lys Ser Ala Ile Gly Glu Asn Met Thr Arg Lys Asp

385 390 395 400

His Ala Asp Val Ser Asn Gln Leu Tyr Ala Cys Tyr Ala Ile Gly Lys

405 410 415

Asp Val Gln Ala Met Lys Ala Val Val Gly Glu Glu Ala Leu Thr Pro

420 425 430

Asp Asp Leu Leu Tyr Leu Glu Phe Leu Thr Lys Phe Glu Lys Asn Phe

435 440 445

Ile Ser Gln Gly Asn Tyr Glu Asn Arg Thr Val Phe Glu Ser Leu Asp

450 455 460

Ile Gly Trp Gln Leu Leu Arg Ile Phe Pro Lys Glu Met Leu Lys Arg

465 470 475 480

Ile Pro Ala Ser Ile Leu Ala Glu Phe Tyr Pro Arg Asp Ser Arg His

485 490 495

Pro Gln Thr Lys

500

<210> 8

<211> 488

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 8

tgacagctgc tgaattcctg gcatatcaat gtgagaaaca cgtattagtc attctcacag 60

acatgagttc atatgctgag gctttgcgag aggtttcagc tgctagggag gaagtaccag 120

ggcgaagagg attccctggt tacatgtaca cagatcttgc caccatctat gaaagagctg 180

ggagagtgga aggtcgaagt ggttccatta cacagattcc cattctgact atgcccaatg 240

atgacattac acatcctatc ccagatctga caggatacat cacagaaggt caaatatatg 300

tagaccgtca gttgcacaac aggcaaatat atcctccagt caatgtattg ccatcactca 360

gtcgtctcat gaagtcggcc attggtgaaa acatgactcg taaggaccat gctgatgtat 420

caaaccagct gtacgcttgt tacgctattg ggaaagatgt gcaggccatg aaggctgttg 480

ttggtgag 488

<210> 9

<211> 40

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 9

taatacgact cactataggg tgacagctgc tgaattcctg 40

<210> 10

<211> 40

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 10

taatacgact cactataggg ctcaccaaca acagccttca 40

<210> 11

<211> 1158

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 11

atgacggaat actggctaat atcggctcca ggagacaaaa cttgccagca aacatgggaa 60

actttgaata atctgacgag taaacagaac aatgtatcag taaactacaa attccatatt 120

ccagacctaa aggttggtac actggatcag ctggttggtt tatcagatga tttagggaag 180

ctagacagct atgttgaaca agtgaccagg aaggttgcag cctatcttgg tgaagtactc 240

gaagaccaaa gagacaaact ccatgaaaac cttttggcaa acaatagtga tcttcctggg 300

tacatcacac gttttcagtg ggatatggca aaatatccca tcaaacaatc tttgcggaac 360

atagctgaca ttatcagtaa acaagtaggt cagatagatg ctgatttaaa aacaaaatct 420

actgcttata ataatttgaa aggcaacctg caaaatctgg agaagaagca aactgggagt 480

ctactaacga gaaatctcgc tgatttagtg aagaaagagc acttcatatt ggattctgaa 540

taccttacta cactattggt tattgtacca aaaatactat tcaatgaatg gaatcagaac 600

tatgagaaaa ttacagatat gattgtacct cgatcaagcc aattgattta ccaggattcg 660

gactttggct tgtacactgt gactttgttc aagaaagttg ttgatgaatt taaactccat 720

gctcgagaga gaaagtttgt tgtaagagat ttcacttaca atgaggaaga attgttggct 780

gggaaaaatg aaatgacaaa actggttacg gacaagaaga aacaatttgg cccattagta 840

cgctggctca aagtcaactt cagtgaatgt ttctgtgcat ggatacatgt taaagcactg 900

agagtgtttg tggaatctgt tctgaggtat ggactgcccg tgaacttcca agctatgctg 960

cttcacccac acaaaaaaag tacgaagagg ttacgagacc tcctgaacca attatatggt 1020

catctagaca gcagtgcctc acaagggctg ggtgcacatg atagtgtgga gataccagga 1080

cttgggtttg gccatgctga gtattaccca tatgtttatt acaaaattaa tgttgatatg 1140

gttgatacta aagtgtaa 1158

<210> 12

<211> 385

<212> PRT

<213> migratory locust (Locusa migratoria)

<400> 12

Met Thr Glu Tyr Trp Leu Ile Ser Ala Pro Gly Asp Lys Thr Cys Gln

1 5 10 15

Gln Thr Trp Glu Thr Leu Asn Asn Leu Thr Ser Lys Gln Asn Asn Val

20 25 30

Ser Val Asn Tyr Lys Phe His Ile Pro Asp Leu Lys Val Gly Thr Leu

35 40 45

Asp Gln Leu Val Gly Leu Ser Asp Asp Leu Gly Lys Leu Asp Ser Tyr

50 55 60

Val Glu Gln Val Thr Arg Lys Val Ala Ala Tyr Leu Gly Glu Val Leu

65 70 75 80

Glu Asp Gln Arg Asp Lys Leu His Glu Asn Leu Leu Ala Asn Asn Ser

85 90 95

Asp Leu Pro Gly Tyr Ile Thr Arg Phe Gln Trp Asp Met Ala Lys Tyr

100 105 110

Pro Ile Lys Gln Ser Leu Arg Asn Ile Ala Asp Ile Ile Ser Lys Gln

115 120 125

Val Gly Gln Ile Asp Ala Asp Leu Lys Thr Lys Ser Thr Ala Tyr Asn

130 135 140

Asn Leu Lys Gly Asn Leu Gln Asn Leu Glu Lys Lys Gln Thr Gly Ser

145 150 155 160

Leu Leu Thr Arg Asn Leu Ala Asp Leu Val Lys Lys Glu His Phe Ile

165 170 175

Leu Asp Ser Glu Tyr Leu Thr Thr Leu Leu Val Ile Val Pro Lys Ile

180 185 190

Leu Phe Asn Glu Trp Asn Gln Asn Tyr Glu Lys Ile Thr Asp Met Ile

195 200 205

Val Pro Arg Ser Ser Gln Leu Ile Tyr Gln Asp Ser Asp Phe Gly Leu

210 215 220

Tyr Thr Val Thr Leu Phe Lys Lys Val Val Asp Glu Phe Lys Leu His

225 230 235 240

Ala Arg Glu Arg Lys Phe Val Val Arg Asp Phe Thr Tyr Asn Glu Glu

245 250 255

Glu Leu Leu Ala Gly Lys Asn Glu Met Thr Lys Leu Val Thr Asp Lys

260 265 270

Lys Lys Gln Phe Gly Pro Leu Val Arg Trp Leu Lys Val Asn Phe Ser

275 280 285

Glu Cys Phe Cys Ala Trp Ile His Val Lys Ala Leu Arg Val Phe Val

290 295 300

Glu Ser Val Leu Arg Tyr Gly Leu Pro Val Asn Phe Gln Ala Met Leu

305 310 315 320

Leu His Pro His Lys Lys Ser Thr Lys Arg Leu Arg Asp Leu Leu Asn

325 330 335

Gln Leu Tyr Gly His Leu Asp Ser Ser Ala Ser Gln Gly Leu Gly Ala

340 345 350

His Asp Ser Val Glu Ile Pro Gly Leu Gly Phe Gly His Ala Glu Tyr

355 360 365

Tyr Pro Tyr Val Tyr Tyr Lys Ile Asn Val Asp Met Val Asp Thr Lys

370 375 380

Val

385

<210> 13

<211> 500

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 13

aaggcaacct gcaaaatctg gagaagaagc aaactgggag tctactaacg agaaatctcg 60

ctgatttagt gaagaaagag cacttcatat tggattctga ataccttact acactattgg 120

ttattgtacc aaaaatacta ttcaatgaat ggaatcagaa ctatgagaaa attacagata 180

tgattgtacc tcgatcaagc caattgattt accaggattc ggactttggc ttgtacactg 240

tgactttgtt caagaaagtt gttgatgaat ttaaactcca tgctcgagag agaaagtttg 300

ttgtaagaga tttcacttac aatgaggaag aattgttggc tgggaaaaat gaaatgacaa 360

aactggttac ggacaagaag aaacaatttg gcccattagt acgctggctc aaagtcaact 420

tcagtgaatg tttctgtgca tggatacatg ttaaagcact gagagtgttt gtggaatctg 480

ttctgaggta tggactgccc 500

<210> 14

<211> 40

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 14

taatacgact cactataggg aaggcaacct gcaaaatctg 40

<210> 15

<211> 40

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 15

taatacgact cactataggg gggcagtcca tacctcagaa 40

<210> 16

<211> 753

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 16

atgtcgggaa aagacagaat tcaaatattt ccctcgcgag gtgcgcagat gttaatgaaa 60

gctagactaa aaggagcaca aaaaggtcac agtttactga agaaaaaggc agatgctttg 120

caaatgcgat ttcggcagat actgggcaaa atcatagaga ctaagacgct catgggagaa 180

gtaatgaaag aagctgcttt ctcattagct gaagcaaaat ttactaccgg agatttcaac 240

caagttgttc tgcagaacgt aaatagggca caagtgaaga ttcgcacaaa gaaggacaat 300

gttgcaggtg ttatgttacc agtatttgaa agttatcaag atggttcaga cacatatgaa 360

ctggcaggtt tggcaagagg aggacagcag cttgccaaac taaaaaagaa ctaccagagt 420

gcagtaaagt tgttagttga attagcttct ctacagacat cttttgttac tcttgacgag 480

gtcatcaaaa ttaccaatag aagagttaat gcaattgaac atgtaattat tccacgcatt 540

gaacgtactc ttgcctacat tatatctgaa ttggatgaat tggagagaga agagttttac 600

cggttgaaga aaattcaaga caagaaacgc atagccagag ccaaagccga ggcgaaagca 660

gaagcccaga agcaggccct cctgaaggcg ggccaagacg tcacctacac cccgagcctg 720

ctcgacgaag gggacgaaga catcttgttc tag 753

<210> 17

<211> 250

<212> PRT

<213> migratory locust (Locusa migratoria)

<400> 17

Met Ser Gly Lys Asp Arg Ile Gln Ile Phe Pro Ser Arg Gly Ala Gln

1 5 10 15

Met Leu Met Lys Ala Arg Leu Lys Gly Ala Gln Lys Gly His Ser Leu

20 25 30

Leu Lys Lys Lys Ala Asp Ala Leu Gln Met Arg Phe Arg Gln Ile Leu

35 40 45

Gly Lys Ile Ile Glu Thr Lys Thr Leu Met Gly Glu Val Met Lys Glu

50 55 60

Ala Ala Phe Ser Leu Ala Glu Ala Lys Phe Thr Thr Gly Asp Phe Asn

65 70 75 80

Gln Val Val Leu Gln Asn Val Asn Arg Ala Gln Val Lys Ile Arg Thr

85 90 95

Lys Lys Asp Asn Val Ala Gly Val Met Leu Pro Val Phe Glu Ser Tyr

100 105 110

Gln Asp Gly Ser Asp Thr Tyr Glu Leu Ala Gly Leu Ala Arg Gly Gly

115 120 125

Gln Gln Leu Ala Lys Leu Lys Lys Asn Tyr Gln Ser Ala Val Lys Leu

130 135 140

Leu Val Glu Leu Ala Ser Leu Gln Thr Ser Phe Val Thr Leu Asp Glu

145 150 155 160

Val Ile Lys Ile Thr Asn Arg Arg Val Asn Ala Ile Glu His Val Ile

165 170 175

Ile Pro Arg Ile Glu Arg Thr Leu Ala Tyr Ile Ile Ser Glu Leu Asp

180 185 190

Glu Leu Glu Arg Glu Glu Phe Tyr Arg Leu Lys Lys Ile Gln Asp Lys

195 200 205

Lys Arg Ile Ala Arg Ala Lys Ala Glu Ala Lys Ala Glu Ala Gln Lys

210 215 220

Gln Ala Leu Leu Lys Ala Gly Gln Asp Val Thr Tyr Thr Pro Ser Leu

225 230 235 240

Leu Asp Glu Gly Asp Glu Asp Ile Leu Phe

245 250

<210> 18

<211> 516

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 18

gcgcagatgt taatgaaagc tagactaaaa ggagcacaaa aaggtcacag tttactgaag 60

aaaaaggcag atgctttgca aatgcgattt cggcagatac tgggcaaaat catagagact 120

aagacgctca tgggagaagt aatgaaagaa gctgctttct cattagctga agcaaaattt 180

actaccggag atttcaacca agttgttctg cagaacgtaa atagggcaca agtgaagatt 240

cgcacaaaga aggacaatgt tgcaggtgtt atgttaccag tatttgaaag ttatcaagat 300

ggttcagaca catatgaact ggcaggtttg gcaagaggag gacagcagct tgccaaacta 360

aaaaagaact accagagtgc agtaaagttg ttagttgaat tagcttctct acagacatct 420

tttgttactc ttgacgaggt catcaaaatt accaatagaa gagttaatgc aattgaacat 480

gtaattattc cacgcattga acgtactctt gcctac 516

<210> 19

<211> 40

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 19

taatacgact cactataggg gcgcagatgt taatgaaagc 40

<210> 20

<211> 39

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 20

taatacgact cactataggg gtaggcaaga gtacgttca 39

<210> 21

<211> 684

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 21

atggctctaa gcgatgctga tgtccaaaaa cagattaagc atatgatggc ctttatagat 60

caagaggcaa atgaaaaggc cgaagaaata gatgcaaaag ctgaagaaga attcaatatt 120

gagaaaggcc gattggtgca acagcaacgt ttaaaaataa tggaatatta tgaaagaaag 180

gaaaaacaag tggaactcca gaagaaaatt cagtcttcaa acatgctaaa ccaagcacgc 240

ttaaaagctc tgaaagttcg tgaggatcat gtgcgtggtg tacttgaaga ggcaagaaag 300

agattggggg agatcacaaa ggatcagtct cgatacagcc atgttctcca tcagttaata 360

atgcaggggc tgctgcagct cttggagccg aatgtcactg taaggacacg tgaagttgac 420

cagcgcattg ttgatagcat cttgccagct attacacaaa agtacaaaga aattactggt 480

gggaaggata tctcgctaaa agtggatact gaagccttct tgaacccaga agttactggt 540

ggaatagagt tgctagcaca aaagggcaga attaaaattg ttaatacttt ggaagcacgg 600

ctggagctca ttgcccagca acttattcct gagatacgat gtgcattgtt tggtcgtaac 660

ccaaatcgca agttcgctga ctaa 684

<210> 22

<211> 227

<212> PRT

<213> migratory locust (Locusa migratoria)

<400> 22

Met Ala Leu Ser Asp Ala Asp Val Gln Lys Gln Ile Lys His Met Met

1 5 10 15

Ala Phe Ile Asp Gln Glu Ala Asn Glu Lys Ala Glu Glu Ile Asp Ala

20 25 30

Lys Ala Glu Glu Glu Phe Asn Ile Glu Lys Gly Arg Leu Val Gln Gln

35 40 45

Gln Arg Leu Lys Ile Met Glu Tyr Tyr Glu Arg Lys Glu Lys Gln Val

50 55 60

Glu Leu Gln Lys Lys Ile Gln Ser Ser Asn Met Leu Asn Gln Ala Arg

65 70 75 80

Leu Lys Ala Leu Lys Val Arg Glu Asp His Val Arg Gly Val Leu Glu

85 90 95

Glu Ala Arg Lys Arg Leu Gly Glu Ile Thr Lys Asp Gln Ser Arg Tyr

100 105 110

Ser His Val Leu His Gln Leu Ile Met Gln Gly Leu Leu Gln Leu Leu

115 120 125

Glu Pro Asn Val Thr Val Arg Thr Arg Glu Val Asp Gln Arg Ile Val

130 135 140

Asp Ser Ile Leu Pro Ala Ile Thr Gln Lys Tyr Lys Glu Ile Thr Gly

145 150 155 160

Gly Lys Asp Ile Ser Leu Lys Val Asp Thr Glu Ala Phe Leu Asn Pro

165 170 175

Glu Val Thr Gly Gly Ile Glu Leu Leu Ala Gln Lys Gly Arg Ile Lys

180 185 190

Ile Val Asn Thr Leu Glu Ala Arg Leu Glu Leu Ile Ala Gln Gln Leu

195 200 205

Ile Pro Glu Ile Arg Cys Ala Leu Phe Gly Arg Asn Pro Asn Arg Lys

210 215 220

Phe Ala Asp

225

<210> 23

<211> 396

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 23

ctaagcgatg ctgatgtcca aaaacagatt aagcatatga tggcctttat agatcaagag 60

gcaaatgaaa aggccgaaga aatagatgca aaagctgaag aagaattcaa tattgagaaa 120

ggccgattgg tgcaacagca acgtttaaaa ataatggaat attatgaaag aaaggaaaaa 180

caagtggaac tccagaagaa aattcagtct tcaaacatgc taaaccaagc acgcttaaaa 240

gctctgaaag ttcgtgagga tcatgtgcgt ggtgtacttg aagaggcaag aaagagattg 300

ggggagatca caaaggatca gtctcgatac agccatgttc tccatcagtt aataatgcag 360

gggctgctgc agctcttgga gccgaatgtc actgta 396

<210> 24

<211> 40

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 24

taatacgact cactataggg ctaagcgatg ctgatgtcca 40

<210> 25

<211> 40

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 25

taatacgact cactataggg tacagtgaca ttcggctcca 40

<210> 26

<211> 372

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 26

atggcattac attcggctta caaagggaaa ctcgtctctg tcatcggaga tgaggacacc 60

tgcgttggct ttcttcttgg aggagttgga gaagtcaata aaagcagaca tcccaatttc 120

atggtggtgg acaaaaacac cagtgttggt gagatagaag agtgcttcaa aagatttgtg 180

aagagagatg atattgacat catactgatt aaccagaata ttgctgagat gattcgacac 240

gtaatcgaca gccactcgca gcccgttccg tctgtcctcg agataccgtc aaaggaccat 300

ccttatgatg ccaccaaaga ttcgatatta cgtagggcaa agggaatgtt caacccagat 360

gacttcaagt aa 372

<210> 27

<211> 123

<212> PRT

<213> migratory locust (Locusa migratoria)

<400> 27

Met Ala Leu His Ser Ala Tyr Lys Gly Lys Leu Val Ser Val Ile Gly

1 5 10 15

Asp Glu Asp Thr Cys Val Gly Phe Leu Leu Gly Gly Val Gly Glu Val

20 25 30

Asn Lys Ser Arg His Pro Asn Phe Met Val Val Asp Lys Asn Thr Ser

35 40 45

Val Gly Glu Ile Glu Glu Cys Phe Lys Arg Phe Val Lys Arg Asp Asp

50 55 60

Ile Asp Ile Ile Leu Ile Asn Gln Asn Ile Ala Glu Met Ile Arg His

65 70 75 80

Val Ile Asp Ser His Ser Gln Pro Val Pro Ser Val Leu Glu Ile Pro

85 90 95

Ser Lys Asp His Pro Tyr Asp Ala Thr Lys Asp Ser Ile Leu Arg Arg

100 105 110

Ala Lys Gly Met Phe Asn Pro Asp Asp Phe Lys

115 120

<210> 28

<211> 297

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 28

acattcggct tacaaaggga aactcgtctc tgtcatcgga gatgaggaca cctgcgttgg 60

ctttcttctt ggaggagttg gagaagtcaa taaaagcaga catcccaatt tcatggtggt 120

ggacaaaaac accagtgttg gtgagataga agagtgcttc aaaagatttg tgaagagaga 180

tgatattgac atcatactga ttaaccagaa tattgctgag atgattcgac acgtaatcga 240

cagccactcg cagcccgttc cgtctgtcct cgagataccg tcaaaggacc atcctta 297

<210> 29

<211> 40

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 29

taatacgact cactataggg acattcggct tacaaaggga 40

<210> 30

<211> 40

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 30

taatacgact cactataggg taaggatggt cctttgacgg 40

<210> 31

<211> 357

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 31

atggctagcc agactcaggg aattcaacag cttctagcag ctgaaaaaag ggcagcagag 60

aaggtttcag aagcaagaaa gcgaaaagca cgcaggttga aacaggccaa agaagaagcc 120

caggaagaaa ttgaaaaata cagacaagaa agagagaggc agtttaaaga gtttgaagca 180

aagcacatgg gctcacgaga ggatagggct gcacagattg aagcagaaac aaaagtaaag 240

attgcagaaa tggagaaatc tgtaaatcag cggaaggaaa agttgataga aaggattttg 300

gaattggtgt acgatatcaa gcccgaactc cataagaact tcagagctgc aaagtag 357

<210> 32

<211> 118

<212> PRT

<213> migratory locust (Locusa migratoria)

<400> 32

Met Ala Ser Gln Thr Gln Gly Ile Gln Gln Leu Leu Ala Ala Glu Lys

1 5 10 15

Arg Ala Ala Glu Lys Val Ser Glu Ala Arg Lys Arg Lys Ala Arg Arg

20 25 30

Leu Lys Gln Ala Lys Glu Glu Ala Gln Glu Glu Ile Glu Lys Tyr Arg

35 40 45

Gln Glu Arg Glu Arg Gln Phe Lys Glu Phe Glu Ala Lys His Met Gly

50 55 60

Ser Arg Glu Asp Arg Ala Ala Gln Ile Glu Ala Glu Thr Lys Val Lys

65 70 75 80

Ile Ala Glu Met Glu Lys Ser Val Asn Gln Arg Lys Glu Lys Leu Ile

85 90 95

Glu Arg Ile Leu Glu Leu Val Tyr Asp Ile Lys Pro Glu Leu His Lys

100 105 110

Asn Phe Arg Ala Ala Lys

115

<210> 33

<211> 240

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 33

aagggcagca gagaaggttt cagaagcaag aaagcgaaaa gcacgcaggt tgaaacaggc 60

caaagaagaa gcccaggaag aaattgaaaa atacagacaa gaaagagaga ggcagtttaa 120

agagtttgaa gcaaagcaca tgggctcacg agaggatagg gctgcacaga ttgaagcaga 180

aacaaaagta aagattgcag aaatggagaa atctgtaaat cagcggaagg aaaagttgat 240

<210> 34

<211> 40

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 34

taatacgact cactataggg aagggcagca gagaaggttt 40

<210> 35

<211> 40

<212> DNA

<213> migratory locust (Locusa migratoria)

<400> 35

taatacgact cactataggg atcaactttt ccttccgctg 40

Claims (5)

1. The locusta migratoria V-ATPase-V1 structural domain gene is characterized in that: the gene comprises the following genes:

the nucleotide sequence of the migratory locust V-ATPase-F gene is SEQ ID NO: 26.

2. the dsRNA of the locusta migratoria V-ATPase-V1 structural domain gene is characterized in that: including the following dsrnas:

the locust migratory V-ATPase-F gene fragment SEQ ID NO: 28 synthetic dsRNA.

3. The synthetic method of dsRNA of locusta migratoria V-ATPase-V1 structural domain gene is characterized in that: the method comprises the following steps of taking the gene SEQ ID NO: 26 as template, upstream primer and downstream primer corresponding to gene, PCR amplifying to obtain DNA template with T7 promoter at two ends, and in vitro transcription synthesizing corresponding dsRNA according to HiScribe ™ T7 High Yield RNA Synthesis Kit.

4. The method for synthesizing dsRNA of locusta migratoria V-ATPase-V1 domain gene according to claim 3, wherein the method comprises the following steps:

the upstream primer and the downstream primer of the migratory locust V-ATPase-F gene are respectively as follows: SEQ ID NO: 29 and SEQ ID NO: 30.

5. the application of dsRNA of locusta migratoria V-ATPase-V1 structural domain gene in pest control is characterized in that: the dsRNA of the V-ATPase-F gene of the migratory locust as the claim 2 is prepared into a spraying pesticide or a bait, or the dsRNA is transferred into a migratory locust feeding plant body to be applied to the control of the migratory locust.

Images