CN111208308A - Preparation method of fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection - Google Patents
Preparation method of fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection Download PDFInfo
- Publication number
- CN111208308A CN111208308A CN202010014816.5A CN202010014816A CN111208308A CN 111208308 A CN111208308 A CN 111208308A CN 202010014816 A CN202010014816 A CN 202010014816A CN 111208308 A CN111208308 A CN 111208308A
- Authority
- CN
- China
- Prior art keywords
- fsh
- antibody
- assisting
- ovarian cancer
- cancer diagnosis
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Images
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/74—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving hormones or other non-cytokine intercellular protein regulatory factors such as growth factors, including receptors to hormones and growth factors
- G01N33/76—Human chorionic gonadotropin including luteinising hormone, follicle stimulating hormone, thyroid stimulating hormone or their receptors
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/543—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
- G01N33/54313—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals the carrier being characterised by its particulate form
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/558—Immunoassay; Biospecific binding assay; Materials therefor using diffusion or migration of antigen or antibody
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/57449—Specifically defined cancers of ovaries
Abstract
The invention discloses a preparation method of fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection, which comprises a bottom plate, a chromatographic membrane, absorbent paper, a sample pad and a fluorescent microsphere solution, wherein the fluorescent microsphere is coupled with a labeled antibody, the labeled antibody is an FSH β subunit antibody 2 or an antibody 4, the chromatographic membrane is provided with a detection line and a quality control line, the quality control line is coated with an antibody of anti-FSH β subunit antibody 2 or antibody 4 homologous IgG, and the detection line is coated with an FSH β subunit antibody 4 or antibody 2.
Description
Technical Field
The invention belongs to the technical field of preparation methods of fluorescence chromatography test paper, and particularly relates to a preparation method of fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH (FSH-free rapid detection).
Background
Follicle Stimulating Hormone (FSH) is a hormone secreted by anterior pituitary basophilic cells, is an endogenous ligand of a Follicle Stimulating Hormone Receptor (FSHR), and consists of α subunits and β subunits, FSH has the same α subunit consisting of 92 amino acids with Luteinizing Hormone (LH), Thyrotropin (TSH) and chorionic gonadotropin (HCG), the unique β subunit consists of 111 amino acids and has the function of specifically binding with FSHR, wherein the 33-53 segment has the strongest binding force with FSHR, the molecular weight of FSH is about 30Kd, and the half life is 3-4 hours, and generally, the β subunit of FSH is mainly detected when the FSH is detected.
According to the research, the FSH content in the ovarian cancer tissue fluid is detected by a radioimmunoassay method, and the result shows that the concentration of FSH in the ovarian tumor tissue fluid has obvious difference between benign and malignant and between benign and borderline and is increased along with the increase of the ovarian malignancy degree, but whether the FSH related detection product can accurately diagnose the malignant tumor is not clear.
Disclosure of Invention
This section is for the purpose of summarizing some aspects of embodiments of the invention and to briefly introduce some preferred embodiments. In this section, as well as in the abstract and the title of the invention of this application, simplifications or omissions may be made to avoid obscuring the purpose of the section, the abstract and the title, and such simplifications or omissions are not intended to limit the scope of the invention.
In one aspect of the present invention, the present invention provides a method for preparing a fluorescence immunochromatographic strip for assisting ovarian cancer diagnosis based on FSH rapid detection.
In order to solve the technical problems, the invention provides the following technical scheme that the preparation method of the fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection comprises a bottom plate, a chromatographic membrane, absorbent paper, a sample pad and a fluorescence microsphere solution, wherein the fluorescence microsphere is coupled with a labeled antibody, and the labeled antibody is an FSH β subunit antibody 2 or an antibody 4;
the chromatographic membrane is provided with a detection line and a quality control line, the quality control line is coated with an antibody of anti-FSH β subunit antibody 2 or antibody 4 homologous IgG, and the detection line is coated with FSH β subunit antibody 4 or antibody 2.
As a preferred scheme of the preparation method of the fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection, the kit comprises the following steps: the mass ratio of the labeled antibody to the fluorescent microsphere is 15-25 mug antibody/mg fluorescent microsphere.
As a preferred scheme of the preparation method of the fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection, the kit comprises the following steps: the concentration of the fluorescent microspheres in the working solution of the fluorescent microsphere solution is 10-15 mug/ml.
As a preferred scheme of the preparation method of the fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection, the kit comprises the following steps: the working solution of the fluorescent microsphere solution is 0.05M phosphate buffer solution with pH7.4.
As a preferred scheme of the preparation method of the fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection, the kit comprises the following steps: the content of the antibody on the quality control line is 0.5-2 mug/cm.
As a preferred scheme of the preparation method of the fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection, the kit comprises the following steps: the content of the antibody on the detection line is 0.5-2 mug/cm.
As a preferable scheme of the preparation method of the fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection, the amino acid sequence of β subunit of FSH is NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE.
As a preferred scheme of the preparation method of the fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection, the kit comprises the following steps: the fluorescent material of the fluorescent microsphere is europium.
As a preferred scheme of the preparation method of the fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection, the kit comprises the following steps: the chromatographic membrane is a nitrocellulose membrane.
As a preferred scheme of the preparation method of the fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection, the kit comprises the following steps: and (3) rapidly detecting the FSH, wherein the sample to be detected is a puncture tissue sample.
The kit has the beneficial effects that the β subunit of FSH is preferably used as the ovarian cancer detection index, the antibody with good specificity is preferably selected from a plurality of antibodies and combined, the fluorescent microsphere coupling antibody and the detection line membrane scratching antibody are matched with each other, the detection sensitivity and specificity are obviously improved, the deviation is small, and the rapid and accurate detection of ovarian cancer by using FSH is realized.
Drawings
In order to more clearly illustrate the technical solutions of the embodiments of the present invention, the drawings needed to be used in the description of the embodiments will be briefly introduced below, and it is obvious that the drawings in the following description are only some embodiments of the present invention, and it is obvious for those skilled in the art to obtain other drawings based on these drawings without inventive exercise. Wherein:
FIG. 1 is a schematic diagram of the FSH detection test strip of the present invention.
FIG. 2 is a flow chart of the detection according to the present invention.
Detailed Description
In order to make the aforementioned objects, features and advantages of the present invention comprehensible, embodiments accompanied with examples are described in detail below.
In the following description, numerous specific details are set forth in order to provide a thorough understanding of the present invention, but the present invention may be practiced in other ways than those specifically described and will be readily apparent to those of ordinary skill in the art without departing from the spirit of the present invention, and therefore the present invention is not limited to the specific embodiments disclosed below.
Furthermore, reference herein to "one embodiment" or "an embodiment" means that a particular feature, structure, or characteristic described in connection with the embodiment is included in at least one implementation of the invention. The appearances of the phrase "in one embodiment" in various places in the specification are not necessarily all referring to the same embodiment, nor are separate or alternative embodiments mutually exclusive of other embodiments.
Example 1:
the amino acid sequence of the subunit FSH β of the test substance is as follows:
NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE。
the FSH β subunit antibodies of the present invention include monoclonal antibodies, as shown in Table 1:
TABLE 1
Specific identification of FSH antibodies: performing detection by ELISA, respectively taking FSH, Luteinizing Hormone (LH), chorionic gonadotropin (HCG) and Thyroid Stimulating Hormone (TSH) as detection antigens to coat an ELISA plate, respectively detecting specific reactions of selected FSH antibodies 1-5 and different proteins by ELISA, taking normal BALB/c mouse serum as a negative control, and taking PBS liquid as a blank control.
Identification of specificity of FSH antibodies: the antibodies 1-5 react positively (P/N) 2.1 with FSH, but react negatively with Luteinizing Hormone (LH), chorionic gonadotropin (HCG) and Thyroid Stimulating Hormone (TSH), which indicates that the antibodies 1-5 screened by the invention have specificity respectively.
Preparing a fluorescence immunochromatographic test strip for detecting human FSH in a substance to be detected:
1. study subjects: specimens were obtained from 50 clinical specimens, all of which were intraoperatively punctured with a syringe.
2. Reagents and instrumentation: the fluorescent microsphere labeled antibody of the immunochromatographic test paper is selected from 1 FSH antibody in Table 1, the membrane scratching antibody on the detection line is selected from another FSH antibody in Table 1, an antibody combination which has no cross reaction and is suitable for fluorescent immunochromatographic detection and high in specificity and sensitivity is screened, the quality control antibody on the quality control line in immunochromatographic is an antibody of one antibody homologous IgG in antibodies 1-5, a carboxylated polystyrene time-resolved fluorescent microsphere, a fluorescent detector is from original real industry technology of Yangtze, Wuxi city, a nitrocellulose membrane (Merck-Millipore, USA), a sample pad, a binding pad, a bottom plate and water absorption paper are purchased from Shanghainejei, and other reagents are domestic analytical pure.
3. The preparation method of the fluorescence immunochromatographic test strip comprises the following steps:
the FSH content in the pathological specimen tissue fluid is detected by a point-of-care testing (POCT) method and a rapid fluorescence immunochromatography technology and a double-antibody sandwich technology.
Preparation of FSH fluorescence immunochromatographic test strip:
1) labeling fluorescent microspheres containing europium by using an antibody of FSH β subunit, namely activating the fluorescent microspheres (purchased from Bangs Laboratories, Inc. of FCEU003) by using 1mg/ml of carbodiimide (EDC) and 1mg/ml of N-hydroxysuccinimide (NHS) in MES activation buffer solution, wherein the amount of the fluorescent microspheres is 500 mu g, reacting for 30min at room temperature, washing the fluorescent microspheres, redissolving the fluorescent microspheres by using 0.05M phosphate buffer solution with pH7.4, adding one of antibodies 1-5 according to 20 mu g of antibody/mg time resolution fluorescent microspheres, reacting for 2h at room temperature, adding 0.05M phosphate buffer solution with pH7.4 containing 10% BSA to 1% BSA, reacting for 30min at room temperature, washing the fluorescent microspheres, redissolving the fluorescent microspheres by using the buffer solution, and storing in a dark place for later use;
t-line membrane-lining antibody and C-line quality control antibody:
sticking a nitrocellulose membrane on a PVC (polyvinyl chloride) bottom plate, respectively diluting one of FSH (follicle-stimulating hormone) antibodies 1-5 and an anti-antibody 1-5 homologous IgG antibody to 1mg/ml by using a 0.05M phosphate buffer solution with the pH of 7.4 and containing 5% of sucrose, spraying the two antibodies on the nitrocellulose membrane at an interval of 0.5cm, drying for 6h at 37 ℃, and adding a drying agent for sealing for later use; the content of the quality control antibody on the quality control line is 1 mug/cm; the content of the membrane scratching antibody on the detection line is 1 mug/cm.
2) Preparation of nitrocellulose membrane: diluting an FSH detection antibody (T line) and a quality control antibody (C line) respectively by using a buffer solution, scratching the diluted FSH detection antibody and the quality control antibody on a nitrocellulose membrane at intervals of 0.5cm, drying, adding a drying agent, and sealing for later use;
3) assembly of fluorescence immunochromatographic test strip
Sticking a nitrocellulose membrane 2, absorbent paper 3 and a sample pad 4 on a PVC base plate 1 to form a microfiltration system under the environment that the humidity is less than 35% and the temperature is stable at 20-25 ℃, cutting the microfiltration system into a width of 0.4cm, and putting the microfiltration system into a card shell to prepare a test strip (figure 1) shown in figure 1, 1 and the base plate; 2. a nitrocellulose membrane; 3. absorbent paper; 4. a sample pad; 5. a quality control line C; 6. and detecting the T line.
4. Detection of FSH in clinical tumor sample tissue fluid:
1) the sampled tissue from the clinical was sampled 5 times with a 26-gag syringe needle fine needle, and a 1ml syringe was attached to the back of the needle after sampling.
2) A tube containing 200. mu.l PBS buffer was taken and allowed to equilibrate to room temperature, ensuring that all liquid was at the bottom of the tube before use. And (3) the syringe punctured by the fine needle is stretched into the buffer solution, and the buffer solution is fully washed and uniformly mixed in a suction mode to prepare a sample to be detected.
3) Adding 20 mul of the sample to be detected into a sample adding area of the FSH fluorescence immunochromatographic test paper, then adding 50 mul of fluorescent microsphere working solution coupled with an FSH labeled antibody, and carrying out chromatography reaction for 15 minutes in an incubator. The concentration of the fluorescent microspheres in the working solution is 12.5 mug/ml.
4) And inserting the reacted fluorescence immunochromatographic test paper and the calibration card into a card inserting port of a portable fluorescence immunity quantitative analyzer, operating the analyzer, and automatically reading the card by the analyzer to obtain a quality control band C value and a detection band T value in the fluorescence immunochromatographic test paper. And automatically converting the FSH concentration according to the T/C value. The entire detection process took 17 minutes to complete.
And (5) judging a result:
when the T/C is more than or equal to 0.3, the result is positive, which indicates that the FSH concentration in the tissue fluid of the puncture object is higher, and the ovarian cancer can be identified;
when T/C is less than 0.3, the result is negative, which indicates that FSH concentration in the tissue fluid of the puncture outfit is low, and the cancer can be identified as non-ovarian cancer.
5. Drawing a standard curve: the FSH standard was prepared in 6 different concentrations of 0mIU/ml, 1mIU/ml, 4mIU/ml, 16mIU/ml, 64mIU/ml, 256mIU/ml, 5 replicates per concentration.
6. And (3) testing the performance of the fluorescence immunochromatographic test strip: 1) sensitivity: the 10 blanks were measured, the mean (x) and standard deviation(s) were taken, and x + -2 s was calculated, from which the corresponding dose was looked up on the standard curve. (2) After the test strip is stored for 6 months at 4 ℃ in a dark place, the fluorescence immunochromatographic test strips of FSH of the same batch and different batches are respectively extracted, a standard substance with the concentration of 20mIU/ml is used for testing, and the difference CV between batches is calculated. (3) The standard was prepared to 6 concentrations corresponding to the FSH standard curve for specific detection.
7. Detection of FSH content in eluates of different tissues: and respectively taking the focus puncture solution and the normal puncture solution to detect the content of FSH.
8. Statistical treatment: data were analyzed using SPSS 19.0 statistical software and Chi between groups2The test shows that the difference is statistically significant when P is less than 0.05. The pairwise t test was used for correlation and difference comparisons.
In the research example 1, every two of the antibodies 1-5 are combined to be respectively used as a detection line membrane scratching antibody and a labeled antibody coupled with a fluorescent microsphere, and the detection sensitivity, the detection group internal difference and the detection group internal difference of each antibody combination are researched.
Comparative example:
this example is different from example 1 in that the fluorescent microspheres coupled with the antibody 2 are fixed on the bonding pad by a dry method, and the antibody 4 is sprayed on the detection line, and the rest conditions are the same as the example. According to the invention, the detection effect of the method adopting the control example is obviously worse than that of the method adopting the example 1, the detection sensitivity is reduced mainly due to the overhigh background fluorescence value, and the detection sensitivity of the method adopting the control example is calculated to be 82.9%.
It should be noted that the above-mentioned embodiments are only for illustrating the technical solutions of the present invention and not for limiting, and although the present invention has been described in detail with reference to the preferred embodiments, it should be understood by those skilled in the art that modifications or equivalent substitutions may be made on the technical solutions of the present invention without departing from the spirit and scope of the technical solutions of the present invention, which should be covered by the claims of the present invention.
Claims (10)
1. A preparation method of fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection is characterized by comprising a bottom plate, a chromatographic membrane, absorbent paper, a sample pad and a fluorescent microsphere solution, wherein the fluorescent microsphere is coupled with a labeled antibody, and the labeled antibody is an FSH β subunit antibody 2 or an antibody 4;
the chromatographic membrane is provided with a detection line and a quality control line, the quality control line is coated with an antibody of anti-FSH β subunit antibody 2 or antibody 4 homologous IgG, and the detection line is coated with FSH β subunit antibody 4 or antibody 2.
2. The method for preparing the fluorescence immunochromatographic test strip for assisting ovarian cancer diagnosis based on FSH rapid detection according to claim 1, which is characterized in that: the mass ratio of the labeled antibody to the fluorescent microsphere is 15-25 mug antibody/mg fluorescent microsphere.
3. The method for preparing the fluorescence immunochromatographic strip for assisting ovarian cancer diagnosis based on FSH rapid detection according to claim 1 or 2, which is characterized in that: the concentration of the fluorescent microspheres in the working solution of the fluorescent microsphere solution is 10-15 mug/ml.
4. The method for preparing the fluorescence immunochromatographic test strip for assisting ovarian cancer diagnosis based on FSH rapid detection according to claim 3, wherein: the working solution of the fluorescent microsphere solution is 0.05M phosphate buffer solution with pH7.4.
5. The method for preparing the fluorescence immunochromatographic strip for assisting ovarian cancer diagnosis based on FSH rapid detection according to claim 1 or 2, which is characterized in that: the content of the antibody on the quality control line is 0.5-2 mug/cm.
6. The method for preparing the fluorescence immunochromatographic strip for assisting ovarian cancer diagnosis based on FSH rapid detection according to claim 1 or 2, which is characterized in that: the content of the antibody on the detection line is 0.5-2 mug/cm.
7. The method for preparing the fluorescence immunochromatographic test strip for assisting ovarian cancer diagnosis based on FSH rapid detection according to claim 1 or 2, wherein the amino acid sequence of β subunit of FSH is NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE.
8. The method for preparing the fluorescence immunochromatographic strip for assisting ovarian cancer diagnosis based on FSH rapid detection according to claim 1 or 2, which is characterized in that: the fluorescent material of the fluorescent microsphere is europium.
9. The method for preparing the fluorescence immunochromatographic strip for assisting ovarian cancer diagnosis based on FSH rapid detection according to claim 1 or 2, which is characterized in that: the chromatographic membrane is a nitrocellulose membrane.
10. The method for preparing the fluorescence immunochromatographic strip for assisting ovarian cancer diagnosis based on FSH rapid detection according to claim 1 or 2, which is characterized in that: and (3) rapidly detecting the FSH, wherein the sample to be detected is a puncture tissue sample.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202010014816.5A CN111208308A (en) | 2020-01-07 | 2020-01-07 | Preparation method of fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202010014816.5A CN111208308A (en) | 2020-01-07 | 2020-01-07 | Preparation method of fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN111208308A true CN111208308A (en) | 2020-05-29 |
Family
ID=70788772
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202010014816.5A Pending CN111208308A (en) | 2020-01-07 | 2020-01-07 | Preparation method of fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN111208308A (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113324957A (en) * | 2021-04-25 | 2021-08-31 | 南京长健生物科技有限公司 | Fluorescence immunoassay method |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2013250097A (en) * | 2012-05-30 | 2013-12-12 | Furukawa Electric Co Ltd:The | Test piece for immunochromatography |
| US20140273271A1 (en) * | 2013-03-14 | 2014-09-18 | Furukawa Electric Co., Ltd. | Fluorescence immuno-chromatography, kit and test strip for the same |
| CN107167596A (en) * | 2017-07-13 | 2017-09-15 | 深圳市亚辉龙生物科技股份有限公司 | A kind of immunochromatography reagent bar of fluorogenic quantitative detection FSH and preparation method thereof |
| CN107167595A (en) * | 2017-07-13 | 2017-09-15 | 深圳市亚辉龙生物科技股份有限公司 | A kind of immunochromatography reagent bar of fluorogenic quantitative detection INHB and preparation method thereof |
-
2020
- 2020-01-07 CN CN202010014816.5A patent/CN111208308A/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2013250097A (en) * | 2012-05-30 | 2013-12-12 | Furukawa Electric Co Ltd:The | Test piece for immunochromatography |
| US20140273271A1 (en) * | 2013-03-14 | 2014-09-18 | Furukawa Electric Co., Ltd. | Fluorescence immuno-chromatography, kit and test strip for the same |
| CN107167596A (en) * | 2017-07-13 | 2017-09-15 | 深圳市亚辉龙生物科技股份有限公司 | A kind of immunochromatography reagent bar of fluorogenic quantitative detection FSH and preparation method thereof |
| CN107167595A (en) * | 2017-07-13 | 2017-09-15 | 深圳市亚辉龙生物科技股份有限公司 | A kind of immunochromatography reagent bar of fluorogenic quantitative detection INHB and preparation method thereof |
Non-Patent Citations (2)
| Title |
|---|
| 张赛等: "尿微量白蛋白荧光免疫层析定量检测试剂的研制及性能评价", 《生物技术通报》, no. 03 * |
| 李连香等: "FSH在上皮性卵巢肿瘤中的表达及意义", 现代肿瘤医学 * |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113324957A (en) * | 2021-04-25 | 2021-08-31 | 南京长健生物科技有限公司 | Fluorescence immunoassay method |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN107255726B (en) | Quantitatively detect the fluorescence immune chromatography test paper and preparation method thereof of human parathyroid hormone | |
| CN102323422B (en) | Immunochromatographic test strip for semi-quantitatively and simultaneously detecting cTnI and Myo and preparation method thereof | |
| JP3479100B2 (en) | Simple semi-quantitative immunochemical method and apparatus | |
| CN106153927A (en) | A kind of fast quantification detects time-resolved fluoroimmunoassay chromatography reagent and the preparation method of cTnI, CKMB, Myo simultaneously | |
| CN1279357C (en) | Biosensor and method for analyzing blood components using it | |
| CN109142758A (en) | It is a kind of to detect the immuno-chromatographic test paper strip of glycosylated hemoglobin, kit and preparation method thereof | |
| CN109239326A (en) | Based on the micro-fluidic immuno-chip analysis method of magnetic particle nano enzyme and application | |
| CN104380112B (en) | Maternal biomarkers for gestational diabetes | |
| CN109444423A (en) | Tetraodotoxin immunofluorescence Rapid detection test strip and preparation method and detection method | |
| CN115639366A (en) | Beta 2-microglobulin fluorescence immunochromatography assay kit and detection method thereof | |
| CN109188000A (en) | A kind of test strips and preparation method thereof of portable inspectiont human parathyroid hormone | |
| CN111208308A (en) | Preparation method of fluorescence immunochromatographic test paper for assisting ovarian cancer diagnosis based on FSH rapid detection | |
| JPH063449B2 (en) | Stable immobilized hapten reagent for use in heterogeneous immunoassay, method for producing the same and use thereof | |
| CN111175521B (en) | Preparation method of fluorescent immunochromatography test paper for rapid identification of thyroid medullary carcinoma and lymph node metastasis bedside | |
| CN112269024A (en) | Detection reagent, test paper and kit for interleukin-6 and application thereof | |
| CN107402300B (en) | A kind of method of quick identification human parathyroid | |
| JP2010101673A (en) | High-sensitivity measurement kit by immunochromatography | |
| CN107573536B (en) | Preparation method and application of aerogel | |
| CN110275014B (en) | Method for rapidly identifying metastasis of papillary thyroid carcinoma cervical lymph nodes in operation | |
| CN111273027B (en) | SPDP modified lectin chip for detecting sugar chains in liver cancer serum as well as preparation and application of SPDP modified lectin chip | |
| CN109884316B (en) | Kit for detecting tumor M2 type pyruvate kinase and preparation method thereof | |
| CN116679066A (en) | Kit for quantitatively detecting high-efficiency matrix glycoprotein 73 based on fluorescence immunochromatography and application of kit | |
| CN110687288B (en) | Multi-joint detection kit for rapidly detecting liver diseases and preparation method thereof | |
| CN106442977A (en) | Method for preparing CA125 immunochromatography test strip based on quantum dots | |
| CN111141917A (en) | Combined chromatography detection card of progesterone and β -hCG, preparation method and detection method thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| CB02 | Change of applicant information | ||
| CB02 | Change of applicant information |
Address after: 214063 Jiangsu province Binhu District of Wuxi City Qian Rong Lu No. 20 Applicant after: Jiangsu Institute of Nuclear Medicine Applicant after: Wuxi Jiangyuan industrial technology and Trade Co.,Ltd. Address before: 214063 Jiangsu province Binhu District of Wuxi City Qian Rong Lu No. 20 Applicant before: Jiangsu Institute of Nuclear Medicine Applicant before: Wuxi Jiangyuan Industrial Technology and Trade Corp. |