CN111018984A

CN111018984A - anti-CK 8 monoclonal antibody and application thereof

Info

Publication number: CN111018984A
Application number: CN201911174638.6A
Authority: CN
Inventors: 黄宁
Original assignee: Shandong Lifei Biological Industry Co ltd
Current assignee: Shandong Lifei Biological Industry Co ltd
Priority date: 2019-11-26
Filing date: 2019-11-26
Publication date: 2020-04-17
Anticipated expiration: 2039-11-26
Also published as: CN111018984B

Abstract

The invention provides an antibody targeting CK8, and a preparation method and application thereof. Specifically, the invention provides a novel anti-CK 8 monoclonal antibody. The antibody of the invention can be combined with CK8 antigen with high specificity, has high affinity and low immunogenicity, and is used for preparing medicines for preventing or treating CK8 related diseases.

Description

anti-CK 8 monoclonal antibody and application thereof

Technical Field

The invention relates to the field of biological medicines, in particular to an anti-CK 8 monoclonal antibody and application thereof.

Background

Cytokeratin 8(CK8) is the protein component of the intermediate filament of the cytoskeleton of epithelial cells. Various studies have shown that the appearance of CK8 protein is associated with the plasma membrane of various cancer cells. For example, Godfroid et al describe the presence of CK8 protein on the surface of cultured breast cancer cells. Hembrough et al describe the presence of CK8 or CK 8-like proteins on the surface of hepatocytes, HepG2 cells and breast cancer cells. CK8 protein has also been detected on the surface of other cancers such as digestive tract cancer and the like, and it has been shown experimentally that CK8 protein is exposed on the surface of invasive and non-invasive tumor cells in colorectal cancer.

However, the performance of the current antibodies against CK8 protein is still unsatisfactory. Therefore, there is a need in the art to develop a new CK8 protein antibody reagent or antibody drug with excellent performance against the target to meet the clinical needs.

Disclosure of Invention

The invention aims to provide an anti-CK 8 antibody, a preparation method and application thereof.

In a first aspect of the invention, there is provided an antibody that targets CK8 and that comprises a heavy chain variable region and a light chain variable region, wherein,

the heavy chain variable region comprises the following three Complementarity Determining Regions (CDRs): CDR1 shown in SEQ ID No. 1, CDR2 shown in SEQ ID No. 2, and CDR3 shown in SEQ ID No. 3;

the light chain variable region comprises the following three Complementarity Determining Regions (CDRs): CDR1 ' shown in SEQ ID NO. 4, CDR2 ' shown in SEQ ID NO. 5 and CDR3 ' shown in SEQ ID NO. 6.

In another preferred embodiment, the heavy chain variable region sequence of the antibody is as shown in SEQ ID No. 7; and/or

The light chain variable region sequence of the antibody is shown as SEQ ID NO. 8.

In another preferred embodiment, the heavy chain variable region sequence of the antibody is as shown in SEQ ID No. 9; and/or

The light chain variable region sequence of the antibody is shown in SEQ ID NO. 10.

In another preferred embodiment, the antibody comprises a heavy chain variable region having the sequence shown in SEQ ID No. 7; and a light chain variable region having the sequence shown in SEQ ID No. 8.

In another preferred embodiment, the antibody comprises a heavy chain variable region having the sequence shown in SEQ ID No. 9; and a light chain variable region having the sequence shown in SEQ ID No. 10.

In another preferred embodiment, the antibody is selected from the group consisting of: an antibody of animal origin, a chimeric antibody, a humanized antibody, or a combination thereof.

In another preferred embodiment, the antibody is a double-chain antibody or a single-chain antibody.

In another preferred embodiment, the antibody is a monoclonal antibody.

In another preferred embodiment, the antibody is a partially or fully humanized monoclonal antibody.

In another preferred embodiment, the antibody is monospecific, bispecific or multispecific.

In a second aspect of the present invention, there is provided an antibody drug conjugate comprising:

(a) an antibody moiety which is an antibody according to the first aspect of the invention; and

(b) a coupling moiety coupled to the antibody moiety, the coupling moiety selected from the group consisting of: a detectable label, a drug, a toxin, a cytokine, a radionuclide, an enzyme, or a combination thereof.

In another preferred embodiment, said antibody moiety is coupled to said coupling moiety by a chemical bond or a linker.

In a third aspect of the present invention, there is provided a recombinant protein having:

(i) an antibody according to the first aspect of the invention; and

(ii) optionally a tag sequence to facilitate expression and/or purification.

In another preferred embodiment, the tag sequence comprises a 6His tag.

In another preferred embodiment, the recombinant protein (or polypeptide) comprises a fusion protein.

In another preferred embodiment, the recombinant protein is a monomer, dimer, or multimer.

In a fourth aspect of the present invention, there is provided a chimeric antigen receptor, wherein the antigen-binding region of the chimeric antigen receptor is a binding region that specifically binds to CK8, and the antigen-binding region has a heavy chain variable region and a light chain variable region, wherein

In a fifth aspect of the invention, there is provided a recombinant immune cell expressing an exogenous chimeric antigen receptor according to the fourth aspect of the invention.

In another preferred embodiment, the immune cell is selected from the group consisting of: NK cells, T cells.

In another preferred embodiment, the immune cell is from a human or non-human mammal (e.g., a mouse).

In a sixth aspect of the present invention, there is provided a pharmaceutical composition, comprising:

(i) an active ingredient selected from the group consisting of: an antibody according to the first aspect of the invention, or an antibody drug conjugate according to the second aspect of the invention, or a recombinant protein according to the third aspect of the invention, or a chimeric antigen receptor according to the fourth aspect of the invention, or an immune cell according to the fifth aspect of the invention, or a combination thereof; and

(ii) a pharmaceutically acceptable carrier.

In another preferred embodiment, the pharmaceutical composition is a liquid preparation.

In another preferred embodiment, the pharmaceutical composition is an injection.

In another preferred embodiment, the pharmaceutical composition further comprises other drugs (such as nucleic acid drugs, antibody drugs, targeting drugs, other immune cell drugs, other CAR-T drugs, chemotherapeutic drugs, or combinations thereof) that selectively kill tumor cells.

In another preferred embodiment, the pharmaceutical composition is used for treating tumors.

In another preferred example, the tumor is a tumor highly expressing CK 8.

In a seventh aspect of the invention, there is provided the use of an active ingredient selected from the group consisting of: an antibody according to the first aspect of the invention, or an antibody drug conjugate according to the second aspect of the invention, or a recombinant protein according to the third aspect of the invention, or a chimeric antigen receptor according to the fourth aspect of the invention, or an immune cell according to the fifth aspect of the invention, or a combination thereof, for use in (a) preparing a detection reagent or kit; (b) preparing a medicament or preparation for preventing and/or treating CK8 related diseases; and/or (c) preparing a medicament or preparation for preventing and/or treating cancer or tumor.

In another preferred embodiment, the active ingredient is used for preventing and/or treating CK8 related diseases.

In another preferred embodiment, the detection reagent or the kit is used for diagnosing CK8 related diseases.

In another preferred embodiment, the detection reagent or kit is used for detecting CK8 protein in a sample.

In another preferred embodiment, the detection reagent is a detection sheet.

In another preferred embodiment, the tumor is selected from the group consisting of: a hematologic tumor, a solid tumor, or a combination thereof.

In another preferred embodiment, the hematological tumor is selected from the group consisting of: acute Myeloid Leukemia (AML), Multiple Myeloma (MM), Chronic Lymphocytic Leukemia (CLL), Acute Lymphocytic Leukemia (ALL), diffuse large B-cell lymphoma (DLBCL), Hodgkin's lymphoma, or a combination thereof.

In another preferred embodiment, the solid tumor is selected from the group consisting of: gastric cancer, gastric cancer peritoneal metastasis, liver cancer, leukemia, kidney tumor, lung cancer, small intestine cancer, bone cancer, prostate cancer, colorectal cancer, breast cancer, large intestine cancer, cervical cancer, ovarian cancer, lymph cancer, nasopharyngeal cancer, adrenal gland tumor, bladder tumor, non-small cell lung cancer (NSCLC), brain glioma, endometrial cancer, or a combination thereof.

In another preferred example, the tumor is a tumor highly expressing CK 8.

In an eighth aspect of the invention, there is provided a polynucleotide encoding a polypeptide selected from the group consisting of:

(1) an antibody according to the first aspect of the invention; or

(2) A recombinant protein according to the third aspect of the invention; or

(3) The chimeric antigen receptor according to the fourth aspect of the invention.

According to a ninth aspect of the invention, there is provided a vector comprising a polynucleotide according to the eighth aspect of the invention.

In another preferred embodiment, the carrier comprises: bacterial plasmids, bacteriophages, yeast plasmids, plant cell viruses, mammalian cell viruses such as adenoviruses, retroviruses, or other vectors.

In a tenth aspect of the invention, there is provided a genetically engineered host cell comprising a vector or genome according to the ninth aspect of the invention into which has been integrated a polynucleotide according to the eighth aspect of the invention.

In an eleventh aspect of the present invention, there is provided a method for producing a recombinant polypeptide, the method comprising:

(a) culturing a host cell according to the tenth aspect of the invention under conditions suitable for expression;

(b) isolating a recombinant polypeptide from the culture, said recombinant polypeptide being an antibody according to the first aspect of the invention or a recombinant protein according to the third aspect of the invention.

In a twelfth aspect of the invention, there is provided a method of CK 8-related diseases, the method comprising: administering to a subject in need thereof an antibody according to the first aspect of the invention, or an antibody drug conjugate according to the second aspect of the invention, or a recombinant protein according to the third aspect of the invention, or an immune cell according to the fifth aspect of the invention, or a combination thereof.

It is to be understood that within the scope of the present invention, the above-described features of the present invention and those specifically described below (e.g., in the examples) may be combined with each other to form new or preferred embodiments. Not to be reiterated herein, but to the extent of space.

Detailed Description

The present inventors have made extensive and intensive studies and, as a result, have unexpectedly obtained an anti-CK 8 monoclonal antibody having extremely excellent affinity and specificity, and a humanized antibody obtained based on the antibody. The antibody of the invention can be combined with CK8 antigen with high specificity, and has no visible toxic and side effects on mammals. The antibodies that can be produced based on the monoclonal antibody of the present invention include recombinant antibodies, scFv antibodies, humanized antibodies, bispecific antibodies, chimeric antigen receptor antibodies, and the like. The present invention has been completed based on this finding.

Term(s) for

In order that the invention may be more readily understood, certain technical and scientific terms are specifically defined below. Unless otherwise defined herein, all other technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.

The three letter codes and the one letter codes for amino acids used in the present invention are as described in j. diol. chem,243, p3558 (1968).

As used herein, the terms "administration" and "treatment" refer to the application of an exogenous drug, therapeutic agent, diagnostic agent, or composition to an animal, human, subject, cell, tissue, organ, or biological fluid. "administration" and "treatment" may refer to therapeutic, pharmacokinetic, diagnostic, research, and experimental methods. The treatment of the cells comprises contacting the reagent with the cells, and contacting the reagent with a fluid, and contacting the fluid with the cells. "administering" and "treating" also mean treating in vitro and ex vivo by a reagent, a diagnostic, a binding composition, or by another cell. "treatment" when applied to a human, animal or study subject refers to therapeutic treatment, prophylactic or preventative measures, research, and diagnosis; including contact of an anti-CK 8 antibody with a human or animal, subject, cell, tissue, physiological compartment, or physiological fluid.

As used herein, the term "treatment" refers to the administration of a therapeutic agent, either internally or externally, comprising any one of the CK8 conjugates of the invention and compositions thereof to a patient having one or more symptoms of a disease for which the therapeutic agent is known to have a therapeutic effect. Typically, the therapeutic agent is administered to the patient in an amount effective to alleviate one or more symptoms of the disease (therapeutically effective amount).

As used herein, the term "optional" or "optionally" means that the subsequently described event or circumstance may, but need not, occur. For example, "optionally comprising 1-3 antibody heavy chain variable regions" means that the antibody heavy chain variable regions of a particular sequence may, but need not, be 1, 2 or 3.

"sequence identity" as referred to herein means the degree of identity between two nucleic acid or two amino acid sequences when optimally aligned and compared with appropriate mutations such as substitutions, insertions or deletions. The sequence identity between a sequence described in the present invention and a sequence with which it is identical may be at least 85%, 90% or 95%, preferably at least 95%. Non-limiting examples include 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100%.

CK8

Antibodies

As used herein, the term "antibody" refers to an immunoglobulin, a tetrapeptide chain structure made up of two identical heavy chains and two identical light chains linked by interchain disulfide bonds. The constant regions of immunoglobulin heavy chains differ in their amino acid composition and arrangement, and thus, their antigenicity. Accordingly, immunoglobulins can be classified into five classes, or different classes called immunoglobulins, i.e., IgM, IgD, IgG, IgA, and IgE, and the heavy chain constant regions corresponding to the different classes of immunoglobulins are referred to as a, d, e, g, and m, respectively. IgG represents the most important class of immunoglobulins, which can be divided into 4 subclasses due to differences in chemical structure and biological function: IgG1, IgG2, IgG3, and IgG 4. Light chains are classified as kappa or lambda chains by differences in the constant regions. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known to those skilled in the art.

The sequences of the antibody heavy and light chains, near the N-terminus, are widely varied by about 110 amino acids, being variable regions (V-regions); the remaining amino acid sequence near the C-terminus is relatively stable and is a constant region (C-region). The variable regions include 3 hypervariable regions (HVRs) and 4 FR Regions (FRs) which are relatively conserved in sequence. The amino acid sequences of the 4 FRs are relatively conserved and do not directly participate in the binding reaction. The 3 hypervariable regions determine the specificity of the antibody, also known as Complementarity Determining Regions (CDRs). Each of the Light Chain Variable Region (LCVR) and Heavy Chain Variable Region (HCVR) is composed of 3 CDR regions and 4 FR regions, which are sequentially arranged from amino terminus to carboxy terminus in the order FR1, CDR1, FR2, CDR2, FR3, CDR3, FR 4. The 3 CDR regions of the light chain, the light chain hypervariable region (LCDR), designated LCDR1, LCDR2 and LCDR 3; the 3 CDR regions of the heavy chain, the hypervariable region of the Heavy Chain (HCDR), are referred to as HCDR1, HCDR2 and HCDR 3. The CDR amino acid residues in the LCVR and HCVR regions of the antibodies or antigen-binding fragments of the invention are in number and position in accordance with known Kabat numbering convention (LCDR1-3, HCDR2-3), or in accordance with Kabat and chothia numbering convention (HCDR 1). The four FR regions in the native heavy and light chain variable regions are in a substantially b-folded configuration, connected by three CDRs that form a connecting loop, and in some cases may form part of a b-folded structure. The CDRs in each chain are held together tightly by the FR regions and form the antigen binding site of the antibody with the CDRs of the other chain. It is possible to determine which amino acids constitute the FR or CDR regions by comparing the amino acid sequences of antibodies of the same type. The constant regions are not directly involved in the binding of antibodies to antigens, but they exhibit different effector functions, such as participation in antibody-dependent cytotoxicity of antibodies.

The term "antigen-binding fragment," as used herein, refers to a Fab fragment, Fab 'fragment, F (ab') 2 fragment, or single Fv fragment having antigen-binding activity. Fv antibodies contain the variable regions of the antibody heavy chain, the variable regions of the light chain, but no constant regions, and have the smallest antibody fragment of the entire antigen binding site. Generally, Fv antibodies also comprise a polypeptide linker between the VH and VL domains and are capable of forming the structures required for antigen binding.

As used herein, the term "antigenic determinant" refers to a three-dimensional spatial site on an antigen that is not contiguous and is recognized by an antibody or antigen-binding fragment of the invention.

The invention includes not only intact antibodies, but also fragments of antibodies with immunological activity or fusion proteins of antibodies with other sequences. Accordingly, the invention also includes fragments, derivatives and analogs of the antibodies.

In the present invention, antibodies include murine, chimeric, humanized or fully human antibodies prepared using techniques well known to those skilled in the art. Recombinant antibodies, such as chimeric and humanized monoclonal antibodies, including human and non-human portions, can be prepared using recombinant DNA techniques well known in the art.

As used herein, the term "monoclonal antibody" refers to an antibody secreted by a clone obtained from a single cell source. Monoclonal antibodies are highly specific, being directed against a single epitope. The cell may be a eukaryotic, prokaryotic, or phage clonal cell line.

As used herein, the term "chimeric antibody" is an antibody molecule expressed by a host cell transfected with a vector by splicing a V region gene of a murine antibody to a C region gene of a human antibody into a chimeric gene. Not only retains the high specificity and affinity of the parent mouse antibody, but also ensures that the humanized Fc segment can effectively mediate the biological effect function.

As used herein, the term "humanized antibody", is a variable region engineered version of a murine antibody of the invention, having CDR regions derived from (or substantially derived from) a non-human antibody (preferably a mouse monoclonal antibody), and FR regions and constant regions substantially derived from human antibody sequences; that is, the CDR sequence of the mouse antibody is grafted to the framework sequences of different types of human germline antibodies. Because the CDR sequences are responsible for most of the antibody-antigen interactions, recombinant antibodies that mimic the properties of a particular naturally occurring antibody can be expressed by constructing an expression vector.

In the present invention, the antibody may be monospecific, bispecific, trispecific, or more multispecific.

In the present invention, the antibody of the present invention also includes conservative variants thereof, which means that at most 10, preferably at most 8, more preferably at most 5, and most preferably at most 3 amino acids are replaced by amino acids having similar or similar properties as compared with the amino acid sequence of the antibody of the present invention to form a polypeptide. These conservative variants are preferably produced by amino acid substitutions according to Table A.

TABLE A

The invention provides a high specificity and high affinity antibody against CK8, comprising a heavy chain variable region (VH) amino acid sequence and a light chain comprising a light chain variable region (VL) amino acid sequence.

Preferably, the respective CDRs of the heavy chain variable region (VH) amino acid sequence and the light chain variable region (VL) amino acid sequence are selected from the group consisting of:

a1)SEQ ID NO.:1；

a2)SEQ ID NO.:2；

a3)SEQ ID NO.:3；

a4)SEQ ID NO.:4；

a5)SEQ ID NO.:5；

a6)SEQ ID No.:6；

a7) a sequence having CK8 binding affinity, wherein any one of the above amino acid sequences is subjected to addition, deletion, modification and/or substitution of at least one (e.g., 1-5, 1-3, preferably 1-2, and more preferably 1) amino acid.

In another preferred embodiment, the sequence formed by adding, deleting, modifying and/or substituting at least one amino acid sequence is preferably an amino acid sequence with homology of at least 80%, preferably at least 85%, more preferably at least 90%, and most preferably at least 95%.

The antibody of the present invention may be a double-chain or single-chain antibody, and may be selected from an animal-derived antibody, a chimeric antibody, a humanized antibody, more preferably a humanized antibody, a human-animal chimeric antibody, and still more preferably a fully humanized antibody.

The antibody derivatives of the present invention may be single chain antibodies, and/or antibody fragments, such as: fab, Fab’、(Fab’)₂Or other known antibody derivatives in the art, and any one or more of IgA, IgD, IgE, IgG, and IgM antibodies or antibodies of other subtypes.

Among them, the animal is preferably a mammal such as a mouse.

The antibody of the invention can be a murine antibody, a chimeric antibody, a humanized antibody, a CDR-grafted and/or modified antibody targeting human CK 8.

In a more preferred embodiment of the invention, the VH CDR1, CDR2 and CDR3 are respectively and independently selected from any one or more sequences in SEQ ID NO. 1-3, or sequences with CK8 binding affinity obtained by adding, deleting, modifying and/or substituting at least one amino acid; VL CDR1, CDR2 and CDR3 are respectively and independently selected from any one or more sequences in SEQ ID NO. 4-6, or sequences with CK8 binding affinity, wherein at least one amino acid is added, deleted, modified and/or substituted.

In the above-mentioned aspect of the present invention, the number of amino acids to be added, deleted, modified and/or substituted is preferably not more than 40%, more preferably not more than 35%, more preferably 1 to 33%, more preferably 5 to 30%, more preferably 10 to 25%, and more preferably 15 to 20% of the total number of amino acids in the original amino acid sequence.

In the present invention, the number of the amino acids to be added, deleted, modified and/or substituted is usually 1, 2, 3, 4 or 5, preferably 1 to 3, more preferably 1 to 2, and most preferably 1.

Preparation of antibodies

Any method suitable for producing monoclonal antibodies can be used to produce the anti-CK 8 antibodies of the invention. For example, animals can be immunized with a linked or naturally occurring CK8 homodimer or fragment thereof. Suitable immunization methods, including adjuvants, immunostimulants, repeated booster immunizations, and one or more routes may be used.

Any suitable form of CK8 can be used as an immunogen (antigen) for the production of non-human antibodies specific for CK8, which antibodies are screened for biological activity. The challenge immunogen can be full-length mature human CK8, including natural homodimers, or peptides containing single/multiple epitopes. The immunogen may be used alone or in combination with one or more immunogenicity enhancing agents known in the art. Immunogens can be purified from natural sources or produced in genetically modified cells. The DNA encoding the immunogen may be genomic or non-genomic in origin (e.g., cDNA). DNA encoding the immunogen may be expressed using suitable genetic vectors including, but not limited to, adenoviral vectors, adeno-associated viral vectors, baculovirus vectors, plasmids and non-viral vectors.

Humanized antibodies may be selected from any class of immunoglobulins, including IgM, IgD, IgG, IgA, and IgE. In the present invention, the antibody is an IgG antibody, and an IgG1 subtype is used. Optimization of the sequence of the essential constant domains to produce the desired biological activity is readily achieved by screening antibodies using the biological assays described in the examples below.

Likewise, any type of light chain can be used in the compounds and methods herein. In particular, kappa, lambda chains or variants thereof are useful in the compounds and methods of the invention.

The sequence of the DNA molecule of the antibody or fragment thereof of the present invention can be obtained by a conventional technique, for example, by PCR amplification or genomic library screening. Alternatively, the coding sequences for the light and heavy chains may be fused together to form a single chain antibody.

Once the sequence of interest has been obtained, it can be obtained in large quantities by recombinant methods. This is usually done by cloning it into a vector, transferring it into a cell, and isolating the relevant sequence from the propagated host cell by conventional methods.

In addition, the sequence can be synthesized by artificial synthesis, especially when the fragment length is short. Generally, fragments with long sequences are obtained by first synthesizing a plurality of small fragments and then ligating them. The DNA sequence may then be introduced into various existing DNA molecules (or vectors, for example) and cells known in the art.

The invention also relates to a vector comprising a suitable DNA sequence as described above and a suitable promoter or control sequence. These vectors may be used to transform an appropriate host cell so that it can express the protein.

The host cell may be a prokaryotic cell, such as a bacterial cell; or lower eukaryotic cells, such as yeast cells; or higher eukaryotic cells, such as mammalian cells. Preferred animal cells include (but are not limited to): CHO-S, CHO-K1, HEK-293 cells.

The steps described in the present invention for transforming a host cell with a recombinant DNA can be performed using techniques well known in the art. The obtained transformant can be cultured by a conventional method, and the transformant expresses the polypeptide encoded by the gene of the present invention. Depending on the host cell used, it is cultured in a conventional medium under suitable conditions.

Typically, the transformed host cells are cultured under conditions suitable for expression of the antibodies of the invention. The antibody of the invention is then purified by conventional immunoglobulin purification procedures, such as protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, ion exchange chromatography, hydrophobic chromatography, molecular sieve chromatography or affinity chromatography, using conventional separation and purification means well known to those skilled in the art.

The resulting monoclonal antibodies can be identified by conventional means. For example, the binding specificity of a monoclonal antibody can be determined by immunoprecipitation or by an in vitro binding assay, such as Radioimmunoassay (RIA) or enzyme-linked immunosorbent assay (ELISA).

Pharmaceutical composition

The invention also provides a composition. In a preferred embodiment, the composition is a pharmaceutical composition comprising an antibody or an active fragment thereof or a fusion protein thereof or an ADC thereof or a corresponding CAR-T cell as described above, and a pharmaceutically acceptable carrier. Generally, these materials will be formulated in a non-toxic, inert and pharmaceutically acceptable aqueous carrier medium, wherein the pH is generally from about 5 to about 8, preferably from about 6 to about 8, although the pH will vary depending on the nature of the material being formulated and the condition being treated. The formulated pharmaceutical compositions may be administered by conventional routes including, but not limited to: intratumoral, intraperitoneal, intravenous, or topical administration.

The antibody of the present invention may also be used for cell therapy by intracellular expression of a nucleotide sequence, for example, for chimeric antigen receptor T cell immunotherapy (CAR-T) and the like.

The pharmaceutical composition of the invention can be directly used for binding CK8 protein molecules, and thus can be used for preventing and treating CK8 related diseases. In addition, other therapeutic agents may also be used simultaneously.

The pharmaceutical composition of the present invention comprises a safe and effective amount (e.g., 0.001-99 wt%, preferably 0.01-90 wt%, more preferably 0.1-80 wt%) of the monoclonal antibody (or conjugate thereof) of the present invention as described above and a pharmaceutically acceptable carrier or excipient. Such vectors include (but are not limited to): saline, buffer, glucose, water, glycerol, ethanol, and combinations thereof. The pharmaceutical preparation should be compatible with the mode of administration. The pharmaceutical composition of the present invention can be prepared in the form of an injection, for example, by a conventional method using physiological saline or an aqueous solution containing glucose and other adjuvants. Pharmaceutical compositions such as injections, solutions are preferably manufactured under sterile conditions. The amount of active ingredient administered is a therapeutically effective amount, for example from about 1 microgram per kilogram of body weight to about 5 milligrams per kilogram of body weight per day. In addition, the polypeptides of the invention may also be used with other therapeutic agents.

Where a pharmaceutical composition is used, a safe and effective amount of the pharmaceutical composition is administered to the mammal, wherein the safe and effective amount is generally at least about 10 micrograms/kg body weight, and in most cases does not exceed about 50 mg/kg body weight, preferably the dose is from about 10 micrograms/kg body weight to about 20 mg/kg body weight. Of course, the particular dosage will depend upon such factors as the route of administration, the health of the patient, and the like, and is within the skill of the skilled practitioner.

Detection use and kit

The antibodies of the invention are useful in detection applications, for example, for detecting a sample, thereby providing diagnostic information.

In the present invention, the specimen (sample) used includes cells, tissue samples and biopsy specimens. The term "biopsy" as used herein shall include all kinds of biopsies known to the person skilled in the art. Thus, a biopsy as used in the present invention may comprise a tissue sample prepared, for example, by endoscopic methods or by needle or needle biopsy of an organ.

Samples for use in the present invention include fixed or preserved cell or tissue samples.

The invention also provides a kit containing the antibody (or fragment thereof) of the invention, and in a preferred embodiment of the invention, the kit further comprises a container, instructions for use, a buffer, and the like. In a preferred embodiment, the antibody of the present invention may be immobilized on a detection plate.

The main advantages of the invention

The antibody of the invention has excellent biological activity and specificity, and has high affinity, and has no visible toxic and side effect on mammals.

The invention will be further illustrated with reference to the following specific examples. It should be understood that these examples are for illustrative purposes only and are not intended to limit the scope of the present invention. Experimental procedures without specific conditions noted in the following examples, generally followed by conventional conditions, such as Sambrook et al, molecular cloning: the conditions described in the laboratory Manual (New York: Cold Spring harbor laboratory Press,1989), or according to the manufacturer's recommendations. Unless otherwise indicated, percentages and parts are percentages and parts by weight.

Example 1 preparation of mouse monoclonal antibody against human CK8

1.1 preparation of hybridoma cells producing murine monoclonal antibodies

Firstly, using human CK8 protein as antigen, emulsifying with adjuvant, carrying out multipoint subcutaneous immunization on BALB/c mice, monitoring serum titer of the immunized mice, taking splenocytes of the mice to fuse with myeloma (Sp2/0) cells after the requirement is met, and obtaining hybridoma polyclonal cells through HAT screening.

1.2 Indirect ELISA-screening method of hybridoma cells

Screening out high-specificity-binding polyclonal antibody by using an ELISA detection method, performing monoclonal culture, and screening out high-specificity-binding monoclonal cell strains by using an ELISA method; then, the affinity and half-life period are analyzed by a Biacore method, and finally, the monoclonal cell expressing the CK8 antibody is obtained.

Preparing 1 mu g/ml coating solution from human CK8 by CBS, adding an enzyme label plate into 50 mu L/hole, coating for more than 12 hours at 2-8 ℃, discarding the residual liquid of the plate, adding 3% milk into each hole, sealing for 1 hour at room temperature, wherein each hole is 200 mu L. Adding PBST (not less than 200 mu L) into each well, washing for 1 time, diluting hybridoma supernatant to 100 mu g/ml, diluting 10 times, and adding an enzyme label plate at 100 mu L/well. After incubation for 1 hour at room temperature, no less than 200. mu.L of PBST was added to each well, and after washing 4 times, 25000-fold diluted HRP-conjugated goat anti-mouse IgG Fc with 3% milk-PBST was added, and 100. mu.L/well was loaded. After 1 hour incubation at room temperature, no less than 200. mu.L of PBST was added to each well, washed 6 times, and patted dry. TMB developing solution was added thereto in an amount of 100. mu.L per well. After 5 minutes at room temperature, 2M H was added₂SO₄The reaction was stopped, 50. mu.L/well. And placing the enzyme label plate for stopping the reaction on an enzyme label instrument, and reading the absorbance A450 value by reading the wavelength of 450 nm.

Among the antibodies screened, the antibody produced by hybridoma 3D11 was found to have the highest binding activity to human CK8, with EC₅₀The value reached 219.2 ng/mL.

EXAMPLE 2 cloning of V-Gene sequence of anti-CK 8 antibody

The DNA sequence and amino acid sequence encoding the variable region of the mouse antibody (designated m3D11) expressed by hybridoma 3D11 were determined. The sequencing result showed that the variable region sequence of the anti-CK 8 antibody m3D11 expressed by hybridoma 3D11 was as follows:

heavy chain variable region sequence VH of anti-CK 8 antibody m3D11 (SEQ ID NO: 7)

EVQFLETGAGLVQPGGSRGLSCEGSGFYFSAYDSWVRQTPGKTLEWIGDINDSASGIKYAPSIKDRFTI GHYSGAGFGYQMSNVRSEDTATYFCIAHYSGGGFAYWGQGTSVTVSS

Among them, the CDRs 1, CDR2, CDR3(SEQ ID No.:1-3) are underlined.

Variable region sequence VL of light chain of anti-CK 8 antibody m3D11 (SEQ ID NO: 8)

NIVFTQAGDSVPVTPGESVSISCRSSKSLYLKNGNFYLYWFLQRPGQSPQRLIYASNLASGVPDRFSGRGSGTDFTLRISRVEAEDVGVYYCLQSLEFPYTFGGGTKLEIK

Among them, the CDRs 1 ', 2 ', and 3 ' are underlined (SEQ ID NO: 4-6).

TABLE 1 CDR sequences of murine anti-CK 8 antibody m3D11

EXAMPLE 3 preparation of humanized antibody

3.1 preparation of humanized antibodies

Chimeric heavy and light chains were constructed by linking the cDNA of the VH and VL regions of the PCR cloned mouse antibody m3D11 to human IgG1 and k constant regions, respectively. And the variable chain sequences of the antibodies were compared with the sequences available in the NCBI protein database, and by identification and analysis, the appropriate human frameworks on which to construct the CDR-grafted heavy and light chains were finally determined.

When in modification, modification sites are designed according to conserved amino acid residues in the FR regions of the human antibodies and important amino acid residues in the FR regions of the antibodies, humanized mutation design is respectively carried out on the variable regions of the heavy chains and the light chains of the chimeric antibodies, and the humanized point mutation antibody expression plasmids are amplified and constructed by utilizing the PCR technology. The humanized point mutation antibody expression plasmids are respectively expressed by CHO-K1(ATCC, NO. CCL-61) cells and purified to obtain humanized antibody protein. A humanized antibody h3D11 with very excellent performance is obtained by ELISA, receptor binding inhibition experiment, Biacore, cell activity detection and the like.

The VH and VL sequences of the h3D11 antibody are shown in SEQ ID No. 9 and 10, respectively:

heavy chain variable region sequence VH of h3D11 antibody (SEQ ID NO: 9)

QVQLVQSGMELKKPGASVKVSCKASGFYFSAYDVKQAPGQGFEWMGWIINDSASGITYAQGFTGRFVFSLDSVSTAYLQISSLKDTATYYCDYIGHYSGAGFGYWGQGTTVTVSS

heavy chain variable region sequence VH of h3D11 antibody (SEQ ID NO: 10)

DVVMTQTPPSFLPVNPGEAPASISCKSLYLKNGNFYWYLQKPDGQSPQLLIYYASSGVPDRFSGASGSGTDFTLKISWVEDSAEDDVGVYFCLQSLEFPYTGGGTKLAEIK

3.2 determination of humanized antibodies

The binding activity to recombinant human CK8 was determined in the same manner as in example 1, using the m3D11 antibody and h3D11 antibody in place of hybridoma supernatant, and using HRP-conjugated rabbit anti-human IgG Fc antibody in place of HRP-conjugated goat anti-mouse IgG Fc.

TABLE 2 comparison of binding Activity of h3D11 antibody on human CK8

Sample (I)	EC₅₀(ng/ml)
		Negative control (PBS)	-
m3D11 antibody	60.2
		h3D11 antibody	86.5

The experimental result shows that through humanization transformation, the human invention unexpectedly obtains a humanized antibody h3D11 which has no substantial reduction on the binding activity of human CK 8. The experimental results show that the humanized antibody h3D11 has comparable affinity and specificity and that the antibody h3D11 is less immunogenic than the murine antibody.

Example 4 affinity assay for humanized monoclonal antibodies

A Human Antibody Capture Antibody (Human Antibody Capture Antibody) and an Anti-Human Capture-CM5 Chip (Anti-Human Capture-CM5 Chip) were immobilized on an S series Sensor Chip (Seris S Sensor Chip CM5) by amino coupling using an amino coupling kit. And (5) balancing at room temperature for 20-30 min, and loading the chip into an instrument. The antigen was diluted with equilibration buffer, the antigen was diluted 10nM starting with 5 concentration gradients, and 2 zero concentrations (i.e. equilibration buffer) and one replicate concentration (typically the lowest concentration replicate) were set. And (3) diluting the antibody sample to the experimental working concentration by using an equilibrium buffer solution, and sealing at 2-8 ℃ for later use. After the sample analysis was completed, the data was analyzed using the corresponding analysis program, no significant reference binding (relaying binding) was confirmed, kinetics was selected, 1:1binding model (Kinetics, 1:1binding mode), kinetic parameters of the samples were obtained by fitting analysis.

The results show that the h3D11 antibody has a KD (M) value of 5.37E-11 for affinity for human CK 8. The results of affinity constants (kd (m)) with human CK8 show that the h3D11 antibody of the invention has strong affinity.

All documents referred to herein are incorporated by reference into this application as if each were individually incorporated by reference. Furthermore, it should be understood that various changes and modifications of the present invention can be made by those skilled in the art after reading the above teachings of the present invention, and these equivalents also fall within the scope of the present invention as defined by the appended claims.

Sequence listing

<110> Shandonglifei Biochemical industries, Ltd

<120> anti-CK 8 monoclonal antibody and application thereof

<130>QHI191062

<160>10

<170>SIPOSequenceListing 1.0

<210>1

<211>8

<212>PRT

<213> mouse (Mus musculus)

<400>1

Gly Phe Tyr Phe Ser Ala Tyr Asp

1 5

<210>2

<211>8

<212>PRT

<213> mouse (Mus musculus)

<400>2

Ile Asn Asp Ser Ala Ser Gly Ile

1 5

<210>3

<211>11

<212>PRT

<213> mouse (Mus musculus)

<400>3

Ile Gly His Tyr Ser Gly Ala Gly Phe Gly Tyr

1 5 10

<210>4

<211>11

<212>PRT

<213> mouse (Mus musculus)

<400>4

Lys Ser Leu Tyr Leu Lys Asn Gly AsnPhe Tyr

1 5 10

<210>5

<211>3

<212>PRT

<213> mouse (Mus musculus)

<400>5

Tyr Ala Ser

1

<210>6

<211>9

<212>PRT

<213> mouse (Mus musculus)

<400>6

Leu Gln Ser Leu Glu Phe Pro Tyr Thr

1 5

<210>7

<211>116

<212>PRT

<213> mouse (Mus musculus)

<400>7

Glu Val Gln Phe Leu Glu Thr Gly Ala Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Arg Gly Leu Ser Cys Glu Gly Ser Gly Phe Tyr Phe Ser Ala Tyr

20 25 30

Asp Ser Trp Val Arg Gln Thr Pro Gly Lys Thr Leu Glu Trp Ile Gly

35 40 45

Asp Ile Asn Asp Ser Ala Ser Gly Ile Lys Tyr Ala Pro Ser Ile Lys

50 55 60

Asp Arg Phe Thr Ile Gly His Tyr Ser Gly Ala Gly Phe Gly Tyr Gln

65 70 75 80

Met Ser Asn Val Arg Ser Glu Asp Thr Ala Thr Tyr Phe Cys Ile Ala

85 90 95

His Tyr Ser Gly Gly Gly Phe Ala Tyr Trp Gly Gln Gly Thr Ser Val

100 105 110

Thr Val Ser Ser

115

<210>8

<211>111

<212>PRT

<213> mouse (Mus musculus)

<400>8

Asn Ile Val Phe Thr Gln Ala Gly Asp Ser Val Pro Val Thr Pro Gly

1 5 10 15

Glu Ser Val Ser Ile Ser Cys Arg Ser Ser Lys Ser Leu Tyr Leu Lys

20 25 30

Asn Gly Asn Phe Tyr Leu Tyr Trp Phe Leu Gln Arg Pro Gly Gln Ser

35 40 45

Pro Gln Arg Leu Ile Tyr Ala Ser Asn Leu Ala Ser Gly Val Pro Asp

50 55 60

Arg Phe Ser Gly Arg Gly Ser Gly Thr Asp Phe Thr Leu Arg Ile Ser

65 70 75 80

Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Leu Gln Ser Leu

85 90 95

Glu Phe Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys

100 105 110

<210>9

<211>115

<212>PRT

<213> Artificial sequence (artificial sequence)

<400>9

Gln Val Gln Leu Val Gln Ser Gly Met Glu Leu Lys Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Val Ser Cys Lys Ala Ser Gly Phe Tyr Phe Ser Ala Tyr

20 25 30

Asp Val Lys Gln Ala Pro Gly Gln Gly Phe Glu Trp Met Gly Trp Ile

35 40 45

Ile Asn Asp Ser Ala Ser Gly Ile Thr Tyr Ala Gln Gly Phe Thr Gly

50 55 60

Arg Phe Val Phe Ser Leu Asp Ser Val Ser Thr Ala Tyr Leu Gln Ile

65 70 75 80

Ser Ser Leu Lys Asp Thr Ala Thr Tyr Tyr Cys Asp Tyr Ile Gly His

85 90 95

Tyr Ser Gly Ala Gly Phe Gly Tyr Trp Gly Gln Gly Thr Thr Val Thr

100 105 110

Val Ser Ser

115

<210>10

<211>111

<212>PRT

<213> Artificial sequence (artificial sequence)

<400>10

Asp Val Val Met Thr Gln Thr Pro Pro Ser Phe Leu Pro Val Asn Pro

1 5 10 15

Gly Glu Ala Pro Ala Ser Ile Ser Cys Lys Ser Leu Tyr Leu Lys Asn

20 25 30

Gly Asn Phe Tyr Trp Tyr Leu Gln Lys Pro Asp Gly Gln Ser Pro Gln

35 40 45

Leu Leu Ile Tyr Tyr Ala Ser Ser Gly Val Pro Asp Arg Phe Ser Gly

50 55 60

Ala Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Trp Val Glu

65 70 75 80

Asp Ser Ala Glu Asp Asp Val Gly Val Tyr Phe Cys Leu Gln Ser Leu

85 90 95

Glu Phe Pro Tyr Thr Gly Gly Gly Thr Lys Leu Ala Glu Ile Lys

100 105 110

Claims

1. An antibody that targets CK8 and that comprises a heavy chain variable region and a light chain variable region, wherein,

the light chain variable region comprises the following three Complementarity Determining Regions (CDRs): the CDR1 ' shown in SEQ ID No. 4, the CDR2 ' shown in SEQ ID No. 5 and the CDR3 ' shown in SEQ ID No. 6.

2. The antibody of claim 1, wherein the heavy chain variable region sequence of the antibody is as set forth in SEQ ID No. 7; and/or

3. The antibody of claim 1, wherein the heavy chain variable region sequence of the antibody is as set forth in SEQ ID No. 9; and/or

4. The antibody of claim 1, wherein the antibody is selected from the group consisting of: an antibody of animal origin, a chimeric antibody or a humanized antibody.

5. The antibody of claim 1, wherein the antibody is monospecific, bispecific or multispecific.

6. An antibody drug conjugate, comprising:

(a) an antibody portion that is the antibody of claim 1; and

7. A recombinant protein, said recombinant protein having:

(i) the antibody of claim 1; and

(ii) optionally a tag sequence to facilitate expression and/or purification.

8. A chimeric antigen receptor, wherein the antigen binding region of said chimeric antigen receptor is a binding region that specifically binds to CK8, and said antigen binding region has a heavy chain variable region and a light chain variable region, wherein

9. A pharmaceutical composition, comprising:

(i) an active ingredient selected from the group consisting of: the antibody of claim 1, or the antibody drug conjugate of claim 6, or the recombinant protein of claim 7, or the chimeric antigen receptor of claim 8, or a combination thereof; and

(ii) a pharmaceutically acceptable carrier.

10. Use of an active ingredient selected from the group consisting of: the antibody of claim 1, or the antibody drug conjugate of claim 6, or the recombinant protein of claim 7, or the chimeric antigen receptor of claim 8, or a combination thereof, wherein the active ingredients are used (a) to prepare a detection reagent or kit; (b) preparing a medicament or preparation for preventing and/or treating CK8 related diseases; and/or (c) preparing a medicament or preparation for preventing and/or treating cancer or tumor.