CN110642947B - Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof - Google Patents

Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof Download PDF

Info

Publication number
CN110642947B
CN110642947B CN201910796766.8A CN201910796766A CN110642947B CN 110642947 B CN110642947 B CN 110642947B CN 201910796766 A CN201910796766 A CN 201910796766A CN 110642947 B CN110642947 B CN 110642947B
Authority
CN
China
Prior art keywords
antibody
seq
variable region
dna
chain variable
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
CN201910796766.8A
Other languages
Chinese (zh)
Other versions
CN110642947A (en
Inventor
陈志南
朱平
边惠洁
杨向民
张征
张阳
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Fourth Military Medical University FMMU
Original Assignee
Fourth Military Medical University FMMU
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Fourth Military Medical University FMMU filed Critical Fourth Military Medical University FMMU
Priority to CN202310565909.0A priority Critical patent/CN117327179A/en
Priority to CN202310558186.1A priority patent/CN117586397A/en
Priority to CN201910796766.8A priority patent/CN110642947B/en
Publication of CN110642947A publication Critical patent/CN110642947A/en
Application granted granted Critical
Publication of CN110642947B publication Critical patent/CN110642947B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
    • A61K31/4015—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil having oxo groups directly attached to the heterocyclic ring, e.g. piracetam, ethosuximide
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/535—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines
    • A61K31/537—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines spiro-condensed or forming part of bridged ring systems
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K33/00—Medicinal preparations containing inorganic active ingredients
    • A61K33/18—Iodine; Compounds thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/55—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug, i.e. a dimer, oligomer or polymer of pharmacologically or therapeutically active compounds
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6857—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from lung cancer cell
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6859—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from liver or pancreas cancer cell
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567—Framework region [FR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Cell Biology (AREA)
  • Oncology (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Inorganic Chemistry (AREA)
  • Pulmonology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The invention discloses an anti-human CD147 monoclonal antibody, a cell strain, an expression vector and application thereof. The antibody of the invention can be used for preparing antibody coupling medicines, medicines for diagnosing and treating CD147 expression positive diseases and biotechnological products thereof.

Description

Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof
Technical Field
The invention relates to the field of biotechnology, and in particular provides three humanized antibodies of anti-CD 147 molecules, anti-human cells, related cell lines, expression vectors and application thereof.
Background
CD147 has been named differently and includes TCSF/EMMPRIN, M6, baskin, neurochelin, which has higher homology with the different species-derived antigens of mouse basin/gp 42, rat OX-47/CE-9 and chicken HT7/5A11, which are ultimately identified as Baskin by the human Committee for Gene nomenclature HUGO; the human leukocyte differentiation antigen-cooperating group was designated as CD147 from each laboratory, and was classified as endothelial cell group. The molecule is a highly glycosylated transmembrane glycoprotein with the molecular weight of 50-60 kD, and belongs to immunoglobulin superfamily (IgSF) members. In humans, CD147 is composed of 269 amino acids and is divided into extracellular, transmembrane and intracellular domains. The first 21 residues after N-terminal initial translation are signal peptides, 22-205 form extracellular regions, 206-229 are transmembrane regions, a typical leucine zipper structure is provided, and the C-terminal 230-269 is an intracellular region. CD147 has been demonstrated to be overexpressed in many types of human solid tumors, such as lung, liver, cervical, colon, breast, ovarian, esophageal, or gastric cancers.
Previous studies have shown that CD147 molecules are important functional membrane proteins in the tumor development process, are involved in a variety of cancer-related phenomena, and that there is a close correlation between the expression intensity of CD147 molecules in tumor tissues and prognosis of tumor patients. In non-small cell lung cancer patients, increased levels of CD147 expression are closely related to the prognosis of the patient. Thus, CD147 molecules have become new targets for tumor therapy, where the antibody drug "iodine 131 I]The successful development of the rituximab injection-Li Kating' proves the safety and effectiveness of the target patent medicine.
Monoclonal antibodies (McAb) have the advantages of high specificity, high affinity, small toxic and side effects, low immunogenicity, long in-vivo action time, capability of exerting curative effects by using an in-vivo autoimmune system and the like, are widely applied to diagnosis and treatment of a plurality of diseases, and become an effective way for developing novel medicines. However, repeated injection of murine mcabs into humans can cause patients to elicit a response to human anti-murine antibodies (human anti mouse antibody, HAMA), develop systemic allergic toxic responses and block the development of antibody efficacy.
Disclosure of Invention
Based on the needs, deficiencies and shortcomings of the prior art, the present invention provides anti-human CD147 monoclonal antibodies, expression vectors, cell lines and uses thereof.
The invention provides a monoclonal antibody of anti-human CD147, which has the amino acid sequences of a heavy chain variable region and a light chain variable region:
wbp247.hab12 antibody: the amino acid sequence of the heavy chain variable region is shown in SEQ ID NO. 111 or the sequence with the homology of more than 90 percent with the sequence shown in SEQ ID NO. 111, and the amino acid sequence of the light chain variable region is shown in SEQ ID NO. 113 or the sequence with the homology of more than 90 percent with the sequence shown in SEQ ID NO. 113;
wbp247.hab4 antibody: the amino acid sequence of the heavy chain variable region is a sequence shown as SEQ ID NO. 103 or a sequence with homology of more than 90% with the sequence shown as SEQ ID NO. 103, and the amino acid sequence of the light chain variable region is a sequence shown as SEQ ID NO. 105 or a sequence with homology of more than 90% with the sequence shown as SEQ ID NO. 105;
or alternatively, the method can be used for preparing the composite,
wbp247.hab6 antibody: the amino acid sequence of the heavy chain variable region is shown in SEQ ID NO. 107 or the sequence with the homology of more than 90% with the sequence shown in SEQ ID NO. 107, and the amino acid sequence of the light chain variable region is shown in SEQ ID NO. 109 or the sequence with the homology of more than 90% with the sequence shown in SEQ ID NO. 109.
Further, the nucleotide sequence of the heavy chain variable region of the wbp247.hab12 antibody of the present invention comprises the sequences of the specific complementarity determining regions CDR1, CDR2 and CDR3 of SEQ ID NO: 16. SEQ ID NO:17 and SEQ ID NO:18, the CDR1, CDR2 and CDR3 sequences of the specific complementarity determining regions comprised by the nucleotide sequence of the light chain variable region are SEQ ID NOs: 13. SEQ ID NO:14 and SEQ ID NO:15.
The nucleotide sequences of the heavy chain variable region and the light chain variable region of the antibody of the present invention are:
wbp247.hab12 antibody: the nucleotide sequence of the heavy chain variable region is a sequence shown as SEQ ID NO. 110 or a sequence with the homology of more than 90% with the sequence shown as SEQ ID NO. 110; the nucleotide sequence of the light chain variable region is a sequence shown as SEQ ID NO. 112 or a sequence with the homology of more than 90% with the sequence shown as SEQ ID NO. 112;
wbp247.hab4 antibody: the nucleotide sequence of the heavy chain variable region is a sequence shown as SEQ ID NO. 102 or a sequence with the homology of more than 90% with the sequence shown as SEQ ID NO. 102; the nucleotide sequence of the light chain variable region is a sequence shown as SEQ ID NO. 104 or a sequence with the homology of more than 90% with the sequence shown as SEQ ID NO. 104;
or alternatively, the method can be used for preparing the composite,
wbp247.hab6 antibody: the nucleotide sequence of the heavy chain variable region is a sequence shown as SEQ ID NO. 106 or a sequence with the homology of more than 90% with the sequence shown as SEQ ID NO. 106; the nucleotide sequence of the light chain variable region is the sequence shown as SEQ ID NO. 108 or the sequence with the homology of more than 90 percent with the sequence shown as SEQ ID NO. 108.
In another aspect, the invention provides a cell line expressing the monoclonal antibody, wherein the cell line is named and has the accession number:
cell line expressing wbp247.hab12 antibody: the name is: 247C-B4Z2-01-C-005, accession number: cctccc No. C2019147;
Cell line expressing wbp247.hab4 antibody: designated 247A-B9Z4-02-C-T9, deposit
The number is: cctccc No. C2019148;
or alternatively, the method can be used for preparing the composite,
cell line expressing wbp247.hab6 antibody: designated 247B-B9Z4-01-C-T9, accession number: cctccc No. C2019149.
The invention also provides an expression vector of the monoclonal antibody.
Further, the invention provides a preparation method of the monoclonal antibody. The provided method comprises the following steps:
a) Obtaining the DNA molecule sequence of the antibody of claim 1, 2 or 3;
b) Constructing an expression vector containing the DNA molecule described in step a) and a regulatory sequence for expressing the DNA molecule;
c) Transfecting a host cell, in particular a mammalian cell, preferably a CHO cell, with the expression vector described in step b); culturing under culture conditions suitable for the host cell;
d) The monoclonal antibody is obtained through separation and purification steps.
The antibody can reduce the reaction of the human anti-mouse antibody (human anti mouse antibody, HAMA) caused by repeatedly injecting the murine McAb into human bodies, and avoid systemic anaphylactic toxicity reaction. The obtained antibodies were analyzed for affinity by ELISA assay, and the humanized antibodies of the present invention had EC50 values of about half that of the chimeric antibody wbp247.Cab1, with affinities about one time higher than those of the chimeric antibody.
Preferably, the humanized antibody WBP247.hAb12 has the heavy chain variable region amino acid sequence shown in SEQ ID NO. 111, the light chain variable region amino acid sequence shown in SEQ ID NO. 113, the EC50 of the antibody prepared by expression is 0.002614 ug/ml, which is improved by about one time compared with the EC50 (0.0382 nM) of the parent chimeric antibody WBP247.cAb1, and the antibody can be specifically combined with solid tumors such as lung cancer, liver cancer and the like.
In addition, humanized antibodies WBP247.hAb4 and WBP247.hAb6 are stably screened, and the EC50 of the two antibodies prepared by detection and expression are 0.002864 ug/ml and 0.003022 ug/ml respectively, so that the antibodies can be specifically combined with solid tumors such as liver cancer.
In the construction of the above example antibodies, the light chain constant region is kappa and the heavy chain constant region is of the IgG1 composition, and the invention also protects the isotypes of other antibodies, such as IgG2, igG3, igG4, igM, igA1, igA2, igD, igE. The invention also protects antigen binding fragments of antibodies, including Fab, fv, scFv, and single chain antibodies.
The antibody of the invention can be applied to the preparation of medicines for diagnosing and treating CD147 expression positive diseases, and biotechnology products, detection reagents, imaging, inspection and diagnosis and the like thereof.
The invention also provides application of the antibody in preparation of an antibody coupling drug. The medicine is maytansine derivative DM1, tubulin polymerase inhibitor MMAE or radionuclide iodine.
Drawings
SDS-PAGE analysis of humanized antibody clones 1-4 of FIG. 1; wherein: the left panel according to the drawing shows a non-reducing electrophoretic sample of purified protein, and the right panel shows a reducing electrophoretic sample of purified protein. The method comprises the following steps in sequence from left to right: m is a protein Marker; lane1 clone 1; lane2 clone 2; lane3 clone 3; lane4 clone 3 (prepared in different batches); lane5 WBP247.hAb4; lane6 WBP247.hAb4 (prepared in different batches);
FIG. 2 is a graph of SPR dissociation for determining affinity of humanized antibodies, wherein the abscissa represents response time of a sample and the ordinate represents signal values after binding, each line in the graph being a detection curve of different concentration dilutions of the same sample, indicating a specific change in signal with dose;
FIG. 3 SDS-PAGE non-reducing electrophoretic analysis of humanized antibody clones 5-12; wherein Lane1 clone 5
non-reduced; lane2 WBP247.hAb6 non-reduced; lane3 clone 7 non-reduced; lane4 clone 8 non-reduced; lane5 clone 9 non-reduced; lane6 clone 10non-reduced; lane7 clone 11non-reduced; lane8 clone 12 non-reduced;
FIG. 4 SDS-PAGE reduction electrophoresis analysis of humanized antibody clones 5-12; lane1 clone 5reduced; lane2 WBP247.HAb6 reduced; lane3 clone 7 reduced; lane4 clone 8reduced; lane5 clone 9reduced; lane6 clone 10reduced; lane7 clone 11 reduced; lane8 clone 12 reduced;
FIG. 5 SDS-PAGE reduction and non-reduction electrophoretic analysis of humanized antibody clones 13-16; lane1 clone 13reduced; lane2 clone 14reduced; lane3 clone 15 reduced; lane4 clone 16 reduced; lane5 clone 13 non-reduced; lane6 clone 14 non-reduced; lane7 clone 15 non-reduced; lane8 clone 16non-reduced;
FIG. 6 shows a gradient dilution of 3 antibodies screened against antigen;
FIG. 7 is a diagram of a full-length humanized antibody immunohistochemical screen; WBP247, hAb5 (liver cancer), WBP247, hAb12 (32270) liver cancer and WBP247, hAb12 (32270) lung cancer staining are shown in the figures in order from left to right, wherein the brown area is indicated as antibody staining positive area;
FIG. 8 shows a plasmid map of the expression vector pWX2.1-LC-B-247B 4;
FIG. 9 shows a plasmid map of the expression vector pWX2.1-LC-B-247B 12;
FIG. 10 shows a map of the vector pWX1.1-HC-Z-247B 4;
FIG. 11 shows a plasmid map of the expression vector pWX1.1-HC-Z-247B 6;
FIG. 12 immunohistochemical staining of different tissues with CD147 humanized antibodies; the brown (dark) areas in the figure are antibody staining positive areas, and the white Bar is 100 μm;
FIG. 13 in vitro killing experiments of humanized antibodies against tumor cells.
Detailed Description
1. Term interpretation:
immunoglobulin: refers to a class of structurally related glycoproteins consisting of two pairs of polypeptide chains, a pair of low molecular weight light chains (L) and a pair of high molecular weight heavy chains (H), all four chains being interconnected by disulfide bonds. Each heavy chain typically consists of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region (abbreviated herein as CH). Each light chain typically consists of a light chain variable region (abbreviated herein as VL) and a light chain constant region (abbreviated herein as CL). The light chain constant region typically consists of one domain CL. VH and VL can be further subdivided into regions of hypervariability (or regions of hypervariability in sequence and/or in the form of structurally defined loops), also known as Complementarity Determining Regions (CDRs), interspersed with regions that are more conserved, known as Framework Regions (FR). Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order, FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 (see Chothia and Lesk, 1987). Typically, the numbering of amino acid residues in this segment can be by the Kabat rule. SequencesofProteinsofImmunologicalInterest,5thEd,PublicHealthService,NationalInstitutesofHealth,Bethesda,MD (1991) (this numbering system describes the procedure used herein for either the heavy chain variable domain or the light chain variable domain).
Humanized antibodies: as used herein, refers to antibodies derived from non-human antibodies, typically murine, that retain or substantially retain the antigen binding properties of the parent antibody (parent antibody) after being engineered, but have reduced immunogenicity in humans. Since the antibodies of the present invention are defined by structural and functional features, "humanized antibodies" may be used interchangeably with "antibodies".
Complementarity Determining Regions (CDRs): refers to a characteristic sequence of antibodies containing a plurality of amino acids which together define the binding affinity and specificity of the variable fragment (Fv) region of the immunoglobulin binding site for the target antigen CD 147.
Framework Region (FR): refers to the amino acid sequence inserted between the CDRs. These parts of the antibody are used to hold the CDRs in place (allowing the CDRs to bind antigen). The light chain variable region and the heavy chain variable region each comprise a Framework Region (FR) and typically three CDRs.
Constant Region (CR): refers to the portion of the antibody molecule that confers effector function. The constant regions of the humanized antibodies of the invention are derived from human immunoglobulins. The heavy chain constant region may be selected from five isoforms: alpha, delta, epsilon, gamma or mu. Further, the heavy chains of the various subclasses (e.g., the IgG subclasses of heavy chains) can cause different effector functions, and thus, by selecting the desired heavy chain constant regions, antibodies with the desired effector functions can be produced. Preferred heavy chain constant regions are γ1 (IgG 1), γ2 (IgG 2), γ3 (IgG 3) and γ4 (IgG 4), more preferably γ2 (IgG 2). The light chain constant region may be kappa or lambda type, preferably kappa type.
The chimeric Fab is prepared by recombining the light and heavy chain variable region genes of a functional antibody with the kappa chain and heavy chain CH1 constant region genes of a human antibody respectively, cloning the recombinant into an expression vector to construct a mouse-human chimeric Fab gene expression vector, and transferring the recombinant into a host cell for expression. The first human-murine chimeric Fab antibody, reoPro (anti-platelet receptor gIIb/IIIa), was approved by the FDA in 1994 for antithrombotic treatment.
The CDR grafted antibody is a new antibody constructed by cloning all six CDRs of murine monoclonal antibody onto the corresponding Framework Regions (FRs) of human antibody by PCR and other methods. CDR grafting further reduces the content of heterologous sequences in the antibody and reduces antibody heterology compared to chimeric antibodies.
Affinity (avidity) of antibodies: refers to the total strength of interaction between two molecules, e.g., between an antibody and an antigen. The affinity characterizes the strength of binding between a pair of molecules (e.g., antibody-antigen). The affinity of a molecule X for a ligand Y can be expressed by the dissociation constant (KD), which is the concentration of Y required to occupy half of the binding sites of the X molecules present in the solution. A smaller Kd indicates stronger or higher affinity interactions and lower ligand concentrations are required to occupy the site.
The variable or constant regions of an immunoglobulin heavy or light chain can be joined as described by using standard recombinant DNA techniques to create a polynucleotide that can be expressed in a suitable host (thereby producing the immunoglobulin chain (s)), or can be joined by chemical synthesis using peptides.
The humanized antibody OF the present invention retains an important part OF the binding property OF a parent murine antibody, namely murine antibody HAb18, known as ANTI-human CD147 molecule, which is established as described in monoclonal antibody communication, 1989, 2:33-36, chen Zhina, liu Yanfang, yang Jizhen, etc. (prior patent: 1. ANTI-human liver cancer monoclonal antibody HAb18 light AND heavy chain variable region gene AND USE THEREOF, patent number ZL02114471.0, publication number CN1381461A, AND 2 VARIABLE REGION GENE OF HEAVY/LIGHT CHAIN OF ANTI-HUMAN HEPATOMA MONOCLONAL ANTIBODY HAb18 AND USE THEEOF, U.S. patent number US 7 638 619). In particular, the humanized modification of the invention based on the parent antibody of anti-human CD147 murine origin retains the ability to specifically bind antigen recognition by the parent antibody. The humanized antibodies obtained exhibit the same or substantially the same antibody binding affinity (avidity) or avidity as the parent antibody by optimization and screening.
"humanized antibodies" or "antibodies", as used herein, include intact molecules as well as fragments thereof capable of binding epitope determinants, such as Fab, F (ab') 2 and Fv. These antibody fragments retain the ability to selectively bind to human CD147, examples of which include, but are not limited to, the following:
(1) Fab: a fragment defined as a monovalent antigen binding fragment containing an antibody molecule, which is degraded by the enzyme papain to form a complete light chain and a portion of a heavy chain;
(2) Fab': a fragment defined as a monovalent antigen binding fragment containing an antibody molecule, treating the whole antibody with pepsin followed by reduction to produce a portion of the intact light and heavy chains; two Fab' fragments are available per antibody molecule;
(3)(Fab’) 2 : defined as the treatment with the enzyme pepsin without subsequent reduction to obtain antibody fragments; (Fab) 2 Is a dimer of two Fab' fragments bound together by two disulfide bonds;
(4) Fv: defined as a genetically engineered fragment containing a light chain variable region and a heavy chain variable region represented as two chains;
(4) Fv: homology (homology) is a central concept in comparative biology, meaning that in molecular evolution studies, homology generally refers to the degree of similarity between nucleotide sequences of two nucleic acid molecules or between amino acid sequences of two protein molecules. Typically, homology is checked by sequencing, but DNA-DNA or DNA-RNA hybridization provides valuable judgment (5) of Coupling, also called Coupling, oxidative Coupling, which is the process of obtaining an organic molecule from two organic chemical units (moities) by some chemical reaction. Depending on the type, it can be classified into cross-coupling and self-coupling reactions. The antibody coupling refers to the cross-linking of specific drug chemical reaction groups or small molecular drugs to antibody molecules through specific reagent reactions, so as to improve the killing and therapeutic effects of the antibodies or the small molecular drugs.
The invention determines the CDR and FR region genes of the mouse antibody HAb18 (ZL 02114471.0) light and heavy chain variable region of the anti-human CD147 molecule through bioinformatics analysis, uses a computer-aided antibody structure to carry out humanized design, adopts molecular biological means such as phage display antibody library technology and the like to carry out humanized transformation on the framework region in the variable region, obtains the humanized antibody variable region gene sequence of the anti-human CD147 molecule, constructs a eukaryotic expression system containing the full-length antibody molecule gene, and further expresses and prepares the anti-human CD147 humanized CDR grafted antibody in CHO host cells. Immunohistochemistry and ELISA results showed that the humanized antibodies against human CD147 molecules screened maintained affinity comparable to the murine parent antibody and maintained the specificity of the parent antibody for antigen recognition.
The present invention will be described in further detail with reference to examples. It is to be understood that these examples are for illustrative purposes only and are not intended to limit the present invention. The experimental methods used in the examples below are all conventional molecular biology methods unless otherwise indicated.
Materials, reagents, and the like used in the examples described below are available from commercial reagent company unless otherwise specified.
2. Construction of phage display vector containing murine antibody HAb18 light and heavy chain variable region of anti-human CD147 molecule
1. Material
Hybridoma cell line HAb18, established as described in monoclonal antibody Communications, 1989, 2:33-36, chen Zhina, liu Yanfang, yang Jizhen, et al (patent: CN 1381461A).
PCR amplification primers for murine VH and VL of HAb 18G: wherein, the VH gene amplification primer:
an upstream primer: HAb18-F, SEQ ID NO 1 in the sequence Listing;
downstream primer 1: linker-HAb18-R1 is shown in SEQ ID NO 2 of the sequence Listing.
Downstream primer 2: HAb18-linker-R2, see SEQ ID NO 3 of the sequence Listing.
Wherein, VL gene amplification primers:
an upstream primer: HAb18-Linker-F1, SEQ ID NO 4 in the sequence Listing;
a downstream primer: HAb18-R, SEQ ID NO. 5 of the sequence Listing.
2. Method and results
2.1 Total RNA extraction: total RNA in the hybridoma cells HAb18GC2 was extracted with reference to the total RNA extraction kit (OMEGA Total RNA R6834), and the integrity of the total RNA was checked by agarose gel electrophoresis.
2.2 Reverse transcription of cDNA: 1 μg of total RNA obtained in 2.1 is taken, and a cDNA first strand is synthesized by referring to TaKaRa PrimeScript ℃ and RT reagent Kit DRR037A reverse transcription kit instruction book and frozen at-20 ℃ for standby.
2.3 PCR amplification of VH and VL genes:
using the cDNA prepared in 2.2 as a template, and respectively amplifying a VH gene fragment and a VL gene fragment of a murine origin by using a VH gene amplification primer and a VL gene amplification primer, wherein an amplification system is configured according to Phusion High-Fidelity DNA Polymerase (NEB) specifications;
PCR reaction conditions: 94 ℃ for 5 min; 94 ℃,15s,54 ℃,30s,72 ℃,1min,35 cycles; 72℃for 10min. The size of the amplified fragment was observed by 1% agarose gel electrophoresis.
Wherein, the VH gene is amplified by an upstream primer HAb18-F and a downstream primer 1 Linker-HAb18-R1, and after the product is purified, the VH gene is obtained by amplifying the HAb18-F and the downstream primer 2 HAb18-Linker-R2 again. The VL gene is obtained by directly amplifying an upstream primer HAb18-Linker-F1 and a downstream primer HAb 18-R.
2.4 Amplification of ScFv Gene:
the VH gene fragment and VL gene fragment obtained in 2.3 were mixed in the same molar number, and ScFv genes were amplified by overlay-PCR using the following amplification system:
PCR reaction conditions: 95 ℃ for 5 min; 95 ℃,15s,56 ℃,30s,72 ℃,1min,35 cycles; 72℃for 10min. The target band was observed and recovered by 1% agarose gel electrophoresis.
2.5 ScFv gene digestion, connection with carrier and transformation: the amplified ScFv gene fragment and the vector plasmid pGEM-T vector (Promega) prepared above were selected for useNco I(NEB: C≡CATGG) andNot I(NEB: GC GGCCGC) to perform digestion. The recovered fragment product of 2.4 and pGEM-T vector were taken at 600ng and 3. Mu.g, respectively, 1. Mu.L of restriction enzyme (NEB) each, 5. Mu.L of 10 XCutSmart buffer was added, and water was added to 50. Mu.L, and digested at 37℃for 1.5 hours.
The enzyme digestion system is as follows:
after digestion in a 37℃water bath, the reaction was stopped by adding 5ul of 10 Xloading buffer, respectively. The enzyme-cut strips were recovered by 1% agarose gel electrophoresis and quantified by ultraviolet.
The ligation reaction was performed using T4 phage DNA ligase, and the reaction system consisted of:
the reaction was carried out at 16℃overnight. The ligation product was used to transform TG1 competent cells. Plated on LB agar plates and incubated overnight at 37 ℃. The next day, 10 single clones were randomly picked, positive clone colony identification was performed with vector universal primers, recorded as pGEM-ScFv, sequencing verified, and clones with correct sequencing were stored at-40℃for use.
3. CDR and FR sequence calibration of anti-CD 147 parent monoclonal antibody HAb18
The nucleotide sequences encoding the light and heavy chain variable region of the murine antibody HAb18, also known as the HAb18G monoclonal antibody (CN 021144710) against CD147 were translated into their encoded amino acid sequences using www.expasy.org on-line software, calibrated according to the Kabat database principle, and these marker sequences were retained for further humanization.
Amino acid sequences of CDR1, CDR2 and CDR3 of the complementarity determining regions marked in the sequence of the light chain variable region of monoclonal antibody HAb18 are shown in SEQ ID NO: 6. SEQ ID NO:7 and SEQ ID NO: shown at 8. Amino acid sequences of complementarity determining regions CDR1, CDR2 and CDR3 marked in the variable region sequence of the monoclonal antibody HAb18 heavy chain are shown in SEQ ID NO: 9. SEQ ID NO:10 and SEQ ID NO: 11.
4. Selection of framework sequence FR for antibody humanization engineering
In order to select a suitable human antibody framework sequence onto which the mouse CDRs are grafted, the inventors constructed a database of human antibody sequence information by means of antibody sequences derived from the Kabat protein database; the antibody molecular structure before and after humanization is analyzed and replaced by using Discovery Studio (VIOVIA, version 3.5) through homologous modeling and mechanical optimization technology, so that the replaced amino acid is ensured not to change the integral framework structure of VH and VL, especially not to damage the beta-strand secondary structure, thereby maintaining the original affinity of the antibody. The FR-stuffer method was first proposed by Dall' Acqua, and the humanized antibody was achieved by randomly substituting the murine antibody with the FR region of a human antibody sequence having higher homology with the FR region of the murine antibody sequence, which reduces theoretical reservoir capacity and irrelevant FR recombination.
The FR and CDR regions of the antibody variable region were determined according to the Kabat database. In the antibody database, homology alignment was performed using the variable region sequence of the murine antibody HAb 18. For the transformation of FR1, FR2 and FR3 of VH, the invention refers to the sequences of 12 FR1 germlines, 4 FR2 germlines and 10 FR3 germlines respectively, and the sequences of VH-FR4 are consistent with the sequence IGHJ1 of human and are kept unchanged; for engineering FR1, FR2, FR3 of VL, reference is made to 6, 9 and 7; the FR4 region of VH and VL are confirmed by JH and JK, respectively. By homologous modeling, the molecular structure of the antibody before and after humanization is analyzed, so that the replaced amino acid can not change the overall framework structure of VH and VL, especially can not damage the beta-strand secondary structure, thereby maintaining the original affinity of the antibody. The design schemes are shown in tables 1 and 2, and the theoretical storage capacity of the finally designed humanized antibody library is 1.8X10-5.
Table 1V H Amino acids selected for replacement in frame works
TABLE 2 selection of alternative amino acids in VL frame works
5. Construction and screening of phage display CD147 humanized antibody library
The human antibody FR sequence variable region sequence obtained according to (iii) above, and its replaceable amino acid sequence, in combination, retains CDR sequence (two) of parent mab HAb18, i.e., the light chain variable region sequence comprises SEQ ID NO: 6. SEQ ID NO:7 and SEQ ID NO:8 a feature sequence; the heavy chain variable region sequence comprises SEQ ID NO: 9. SEQ ID NO:10 and SEQ ID NO:11 a signature sequence; in the FR frame region, according to the candidate sites of tables 1 and 2, corresponding PCR primers are designed, and the full-length gene containing the mutation site is obtained by a method of overlapping PCR; and simultaneously selecting codons commonly used in mammalian cells for partial replacement, and cloning all obtained full-length genes into a phage vector pComb3Xss for constructing and screening humanized antibody libraries. Eventually 16 effective humanized sequence combination clones of the light and heavy chain pairing of the anti-CD 147 are obtained.
1. Primer design for CD147 humanized antibody library
According to the selection analysis result of the framework sequence FR of the humanized transformation of the antibody, 70 antibody library primers are designed, and all sequences are 247, such as 247-A1, 247-A2 and the like, and are respectively SEQ ID NO in sequence table: 12 to SEQ ID NO:81.
2. gene amplification protocol
According to the procedure of overlay-PCR, a specific humanized antibody library amplification protocol is as follows:
template length for primer selection
First step
247-A1,A2,A3,A4VH-FR1-A122bp
247-B1,B2,B3,A4VH-FR1-B122bp
247-B1,B2,C3,A4VH-FR1-C122bp
247-B1,B2,D3,A4VH-FR1-D122bp
247-B1,B2,E3,E4VH-FR1-E122bp
247-F1,B2,F3,A4VH-FR1-F122bp
247-G1,G2,A3,A4VH-FR1-G122bp
247-H1,H2,H3,A4VH-FR1-H122bp
247-A5,A6VH-FR2-A87bp
247-B5,B6VH-FR2-B87bp
247-C5,C6VH-FR2-C87bp
247-A7,A8,A9,A10VH-FR3-A150bp
247-A7,B8,B9,B10VH-FR3-B150bp
247-A7,C8,B9,C10VH-FR3-C150bp
247-A7,C8,D9,B10VH-FR3-D150bp
247-A7,C8,E9,E10VH-FR3-E150bp
247-A7,F8,B9,B10VH-FR3-F150bp
247-A7,G8,B9,B10VH-FR3-G150bp
247-A11,A12VH-FR484bp
247-A13,A14,A15,A16VL-FR1-A139bp
247-A13,B14,A15,A16VL-FR1-B139bp
247-A13,C14,A15,A16VL-FR1-C139bp
247-A13,D14,A15,A16VL-FR1-D139bp
247-A17,A18VL-FR2-A80bp
247-A17,B18VL-FR2-B80bp
247-A17,C18VL-FR2-C80bp
247-A17,D18VL-FR2-D80bp
247-A17,E18VL-FR2-E80bp
247-F17,F18VL-FR2-F80bp
247-A19,A20,A21,A22VL-FR3-A140bp
247-B19,B20,B21,B22VL-FR3-B140bp
247-B19,B20,C21,B22VL-FR3-C140bp
247-B19,D20,D21,B22VL-FR3-D140bp
247-B19,E20,E21,B22VL-FR3-E140bp
247-A23,A24VL-FR478bp
Second step
247-A1,B1,F1,G1,A12VH404bp
247-A13,A24VL394bp
Third step
247-A1,B1,F1,G1,A24VH+VL774bp
Amplifying the target fragment; the reaction condition is 95 ℃ for 3min; 95 ℃ for 30sec;55 ℃,30sec;72 ℃,40sec;30 cycles, last 72℃extension, 10min. After the completion of the PCR reaction, the PCR product was purified and recovered by 1% agarose gel electrophoresis.
3. Phage display library construction
3.1 cloning of phage vectors
Selecting and usingNco I(NEB: C≡CATGG) andNot I(NEB: GGCCGC) PCR amplified humanized antibody library gene fragment recovered by double digestion under the same conditions as (one) 2.5, and after separation by 1% agarose electrophoresis, the digested fragment was purified by Gel Extraction Kit (Omega bio-tek). Then, the purified fragment was ligated with the Nco I/Not I double-digested phage vector pComb3Xss using T4DNA ligase (TaKaRa Co.), and the TG1 competent cells were electrically transformed after deionization, Cloning and screening are carried out by inoculating on LB culture plates. Randomly picking 48 monoclonals, and carrying out positive clone colony identification by using M13-48 and M13-47 primers; counting the storage capacity, and storing the storage at-80 ℃ for standby.
3.2 preparation and titration of helper phages
XL-1 Blue single colony was picked and inoculated with 5m 1SB-T + (20 ug/ml) solution, cultured overnight at 37℃with shaking. 10ml SB-T was inoculated at a dilution of 1:500 + (20 ug/ml) solution, shaking at 37℃for one hour. Picking single phage M13K07 virus plaque, inoculating into the 10ml bacterial liquid, shake culturing at 37deg.C for 2 hr, adding 200M1SB-T + （20ug/ml）K + (70 ug/ml) solution, cultured overnight at 37℃with shaking. 4000 Centrifugation was carried out at 4℃for 15 minutes at rpm, and the phage titer was determined from the supernatant, and the supernatant was aseptically dispensed and stored at 4 ℃.
3.3 Phage rescue experiments
Scraping 3.1 electrotransfer bacteria 6 mL, diluting to 400 mL SOB-GAT solution, culturing at 30deg.C until A600=0.5, adding M13K07 deg.C, standing for super-infection for 1 hr (preferably multiple infection value reaches 5:1, adding pfu number of M13K 07: 5×10) 8 bacteria/A600 units) x multiple infection values (5) x A600 values (0.5) x final volume of bacteria (mL), centrifuged at 3500RPM at 4℃for 10min, and the pellet resuspended in 2YT-AKT stock volume and shake-cultured at 30℃at medium speed overnight. Centrifuging the rescue culture solution at 4000rpm at 4 ℃ for 20min, adding 4% PEG8000 and 3% N aC1 into the supernatant, precipitating phage in ice bath for 1 h, centrifuging at 15000g at 4 ℃ for 20min, re-suspending and precipitating with 1-2mL sterilized PBS (containing 1% BSA,0.02mol/L and pH 7.4), and centrifuging at a short time at a low speed, wherein the supernatant is the original phage antibody library after rescue (split charging, and preserving at 4 ℃ for later use).
3.4 Panning of phage antibody libraries
Antigen-specific panning was performed on the antibody phage library obtained in 3.1 using a solid phase panning method. The antigen coating concentration was decreased in each round of panning, and positive/negative controls were set. The specific operation is as follows: resuscitates 3.1 the stored antibody phage library was incubated in 60ml of 2YT medium in a shaker at 37 ℃ until the od600=0.3-0.4. M13KO7 helper phage (Invitrogen) was added; incubate at 37℃for 30 min and shake for 60 min. The cells were resuspended in 60ml of 50ug/ml kanamycin (no glucose) medium and incubated overnight in a 30℃shaker after centrifugation at 1500 rpm for 10 min, the supernatant was discarded; phage library was pelleted by centrifugation at 12000 rpm for 10 min, and the supernatant was transferred to a centrifuge tube at 30 ml/tube. 7.5ml PEG/NaCl was added to each of the tubes, mixed well and placed on ice for 1h. Centrifuging for 12000 r/s for 5 min, and discarding supernatant; phage were resuspended in 2.2ml of solution containing PBS-5% BSA, centrifuged, 12000 rpm, and cell debris removed for 5 minutes. Thereafter, the affinity screening library was performed with the expressed CD147 molecular encapsulation plate, and the antigen coating concentration was successively decreased (1 ug/ml, 0.1ug/ml, 0.01ug/ml, 0.001ug/ml, 0.0001 ug/ml) for each round of panning through 5 rounds of panning (adsorption-elution-amplification). The input/output ratio (recovery rate) of each round of screening phage is calculated as an index of enrichment of the specific phage antibody, and the calculation formula is as follows: recovery (% yield) = (eluent volume×eluent droplet size×100)/(input antibody library volume×antibody library titer), panning was performed until recovery was less than 10, the panning experiment was terminated, 768 clones obtained were picked up, expression was induced, and ScFv antibody, which was a gene product containing humanized gene antibody heavy chain VH and light chain VL, was obtained for further Elisa detection.
6. ELISA and sequencing assays
With coating buffer (200 mM Na 2 CO 3 /NaHCO 3 pH 9.2) CD147 was diluted to 1. Mu.g/ml, 50. Mu.l per well was added and coated overnight at 4 ℃; the solution in the reaction well was discarded, washed 3 times with 1XPBS buffer, and blocked with 200. Mu.l blocking buffer (2% BSA/1XPBS buffer) for 1h at room temperature; wash 3 times with 200 μl 1XPBS buffer; adding 768 samples of cell culture supernatant containing ScFv antibody (8 96-well microplates) and negative control (50 μl/well) which are induced to express by 3.4, and incubating for 2h at room temperature; wash 3 times with 200 μl 1XPBS buffer; anti-c-Myc Ab (HRP) (Abcam Cat#ab19312, 50 μl/well) diluted with blocking buffer (1:2500) was added and incubated for 1h at room temperature; wash 6 times with 200 μl with 1XPBS buffer; TMB substrate solution (50 μl/well) was added to each reaction well for reaction for 10min; stop solution (2M HCl, 50. Mu.l/well) was added to stop the reaction; the ELISA plate reader was used to read the A450nm absorbanceA light value;
based on ELISA results, 50 clone samples with A450>3.0 were selected for sequencing (sequencing work was done by Shanghai Boshang Biotechnology Co., ltd.). DNA sequence analysis: the degree of humanization of the sequences was evaluated with reference to the human antibody's germline database and http:// www.bioinf.org.uk/abs/shab, while affinity ordering was performed for molecules with better degrees of humanization.
7. SPR determination of the affinity of ScFv antibodies
7.1 SPR binding assay method
Affinity determination of ELISA antibodies strong positive in step (five) was performed with a Proteon XPR36 (Bio-Rad, XPR 36) instrument. GLC chips (Bio-Rad, 1765011) were activated with 0.04M EDC+0.01M sulfo-NHS (Bio-Rad). CD147 to 10 mM was diluted with 10 mM NaAc (pH 4.5) and injected onto the chip at a rate of 30 ul/min to couple the antigen to the activated chip via amino groups. Finally, inactivating the chip by using 1M ethane-HCl (Bio-Rad); after 90 degrees rotation the chip was rinsed with buffer (PBS/0.005% Tween 20) to baseline plateau. Cell culture supernatants containing (IV) 3.4-induced expression of ScFv-containing antibodies were injected separately on 6 horizontal channels. The sample injection rate was 30. Mu.l/min. Sample binding time is 60s, and dissociation time is 900s; data analysis was performed using the Langmuir Kinetic (Kinetic-Langmuir) model; clones with high affinity were selected for the construction of fully humanized antibodies.
7.2 SPR determination of affinity ordering of ScFv antibodies
Real-time monitoring of coated CD147 binding to (fourth) 3.4-induced expression of ScFv antibody-containing cell culture supernatants using SPR by determination of dissociation rate constants (K off ) Reflecting the size of the affinity of CD147 for humanized ScFv antibodies. The results are shown in Table 3, and a plurality of molecules with better affinity are selected for the construction of the fully humanized antibodies according to the change of the affinity.
TABLE 3 sequence analysis of the degree of humanization of HAb18 and K off Ordering of
8. Full length humanized antibody construction and detection
8.1 Material
Based on the results of the affinity ranking described above, the first 4 clones (i.e., clones 26601,26602,27028 and 27044) of the (sixth) 2, i.e., SPR assay fragment antibody ScFv antibody, with the top affinity ranking, were first picked for the first round of full-length antibody construction and expression.
That is, the first 4 clones were inoculated overnight for culture, plasmids were extracted separately, and the template sequence was confirmed by sequencing.
PCR primer: humanized antibody VH gene amplification primers: an upstream primer: 247-VH_F1 as shown in SEQ ID NO:84; a downstream primer: 247-VH_R1 as shown in SEQ ID NO:85, the size of the target product is 392bp; humanized antibody VL gene amplification primers: upstream of the first set: 247-33_f1, downstream primer: 247-33_r1 are respectively shown as SEQ ID NOs in the sequence table: 82 and SEQ ID NO:83, a step of detecting the position of the base; based on sequencing results, the second set of upstream primers: 247-VL-2_f2; a downstream primer: 247-vl_r1, respectively corresponding to SEQ ID NO:87 and SEQ ID NO:86.
8.2 PCR amplification procedure
Respectively extracting plasmids, sequencing to confirm that the template sequences are correct, and respectively carrying out PCR (polymerase chain reaction) amplification on target fragments by using the primers and the templates, wherein the amplification schemes are as follows:
primer template target fragment Length
247-VH_F1&247-VH_R125280-VHPw247-VH392bp
247-33_F1&247-33_R1WBP247-hIGKV1-33Pw247- hIGKV1-33-VL361bp
247-33_F1&247-33_R1WBP247-hIGKV1-39Pw247- hIGKV1-39-VL 361bp
247-VL-2_F2&247-vl_R126364-VLPw247- mut16-VL361bp
247-VL-2_F2&247-vl_R126372-VLPw247- mut18-VL361bp
8.3 preparation of transient expression vectors
Adding the light chain variable region gene or heavy chain variable region gene amplified in the step 7.2 into type II restriction enzymes NgoMIV and SnaBI respectively for double digestion, purifying by a DNA purification kit after enzyme digestion, and connecting with a mammalian cell expression vector pCI-vector containing hIgG1/k digested by the same restriction enzymes NgoMIV/SnaBI. The ligation product was transformed into TOP10 E.coli, spread on LB agar medium containing 100. Mu.g/ml ampicillin, and the obtained positive clone was cultured in LB liquid medium containing 100. Mu.g/ml ampicillin, followed by plasmid extraction and sequencing to obtain full-length eukaryotic expression vector clones 1-VH1 to 4 containing the humanized antibody VH gene and full-length eukaryotic expression vector clones 1-VL1 to 4 containing the humanized antibody VL gene, respectively. The nucleotide sequence corresponding to the heavy chain variable region of clone 4 is shown as SEQ ID NO. 102; the nucleotide sequence corresponding to the light chain variable region is shown as SEQ ID NO. 104.
9. Cell transient transfection and antibody expression purification
9.1 cell transient transfection of antibodies
The full-length eukaryotic expression vector clone 1-VH 1-4 of the VH gene obtained in (seventh) 7.3 and the full-length eukaryotic expression vector clone 1-VL 1-4 containing the VL gene of the humanized antibody were co-transfected into HEK293 cells (1.0X10 6 Each ml), the transfected cells were placed in a shaker at 37℃and placed in CO 2 Shake culturing in an incubator with concentration of 5%, and shaking table rotation speed of 120 rotation. The transfected cell supernatants were collected by centrifugation 7 days after transfection, and the full-length humanized antibody of interest was isolated and purified from the cell culture supernatants using a protein A affinity column, and the protein concentration was measured for the purified antibody and used for further determination of affinity SPR for the purified antibodies (antibodies were designated clone 1-4, respectively).
9.2 SDS-PAGE analysis of antibodies
The samples were centrifuged by mixing NuPAGE LDS sample buffer, nuPAGE Reducing Agent with each sample, respectively, using a laboratory conventional SDS-PAGE analysis, in a 75℃water bath for 10 minutes. The loading was 2. Mu.g/well and the 200V voltage was run for 35 minutes. After electrophoresis was completed, the gel was taken and rinsed three times for 5 minutes each. Adding the dyeing liquid SimplyBlue Safestain for dyeing for one hour, and adding deionized water to decolor after finishing the dyeing, until the decoloring of the rubber background is complete; the observation results are shown in figure 1.
Wherein the left panel is a non-reducing electrophoretic sample of purified protein and the right panel is a reducing electrophoretic sample of purified protein. The six lanes in the left and right figures are, in order from left to right: lane1 clone 1; lane2 clone 2; lane3 clone 3; lane4 clone 3 (prepared in different batches); lane5 clone 4; lane6 clone 4 (prepared in different batches); m is a protein Marker.
10. Humanized antibody affinity assay
SPR assay of humanized antibody affinity: the first 4 purified humanized antibodies were assayed for affinity by SPR as described in (six) 6.1, which shows that the purified antibodies clone 1, clone 2, clone 3 and clone 4 have slightly lower affinities (1.9E-9,2.63E-9,1.61E-9 and 1.83E-9) than the parent chimeric antibody WBP247.CAb1 (3.94E-10), as shown in FIG. 2.
TABLE 4 humanized antibody SPR kinetic data
11. Specific screening and identification of humanized antibodies by immunohistochemical staining method
Although affinity measurement was performed on humanized antibodies by SPR method, since the antigen used was a purified antigen prepared by in vitro expression, the above antibodies were subjected to further immunohistochemical staining by tumor tissue specimens maintained in the laboratory in order to further observe the binding specificity of the obtained humanized antibodies.
And detecting the specific binding capacity of the expressed serial humanized antibody clones 1-4 and tumor tissues, and examining the immune tissue cross reaction of the antibody.
The specific operation is as follows: conventional xylene dewaxing, gradient alcohol dehydration and hydration tissue chip; 3%H 2 O 2 Blocking inactivation of endogenous peroxidases; sealing the normal sheep serum working solution; antibody clone 1-4 is used as primary antibody, biotin-marked rabbit anti-human Fc antibody is used as secondary antibody, and horseradish peroxidaseThe working solution of streptomycin ovalbumin marked by the chemoenzyme is three antibodies, DAB color development, hematoxylin counterstain, and sealing and microscopic examination after dehydration and transparency. The result of the screening by the organization shows that only the antibody clone 4, namely WBP247.hAb4, can be specifically colored in malignant tumor tissues such as lung cancer, liver cancer and the like, and the degree of the coloring is "++" or "++ +"; while rarely binding to normal tissue. While the other three antibodies were negative. The above results show that only 1 available candidate humanized antibody WBP247.hAb4, which is similar to the murine parent antibody in terms of antigen recognition specificity, was screened by this round of expression, and the humanized antibody was successfully constructed, but the available number was very small and did not meet the quantitative requirements, thus requiring multiple rounds of expression and screening.
11. Repeated rounds of full-length humanized antibody construction and immunohistochemical screening
11.1 Repeated rounds of full-length humanized antibody construction and detection
According to the results provided by immunohistochemistry, the specificity of the humanized antibodies possibly changes, so that the strategy of the earlier stage is adjusted, and firstly, the 16 clones with the earlier affinity sequence of the SPR measurement fragment antibody ScFv antibody (the sixth) 2 are constructed and expressed by the full-length antibodies; the method is the same as the previous 7.1, and the vector construction and expression of the full-length antibody are carried out on the selected clone. Wherein, the nucleotide sequence corresponding to clone 6, namely WBP247.hAb6, is shown as SEQ ID NO. 106; the nucleotide sequence of the light chain variable region is shown as SEQ ID NO. 108. Clone 12, WBP247.HAb12, has the corresponding heavy chain variable region nucleotide sequence shown in SEQ ID NO. 110; the corresponding nucleotide sequence of the light chain variable region is shown as SEQ ID NO. 112. The obtained antibodies were then purified according to the above-described (eight) 8.1 and cell transient transfection and antibody expression purification (antibodies were designated as clones 5 to 16, respectively), and SDS-PAGE analysis was performed according to the method of the above-described 8.2, and the results are shown in FIG. 3, FIG. 4 and FIG. 5.
12. ELISA analysis of humanized antibody affinity
200ng of recombinant CD147 protein is coated in an ELISA plate, and the ELISA plate is kept stand at 4 ℃ overnight; blocking was performed with 1XPBS/2% BSA for 1 hour at room temperature. Cloning the purified antibody product of step (eight) and subsequent preparation by 1 to ultra6 from 1 ug/ml, the mixture was diluted 1:3.16 with a gradient of blocking solution, 100. Mu.l each was added to each well, and the mixture was allowed to stand at room temperature for 1 hour. 100 μl of 1:4000 dilution of horseradish peroxidase-labeled Goat anti-human IgG Fc HRP (Bethy Cat#A80-304P) was added, and the mixture was allowed to stand at room temperature for 1 hour. TMB was added for color development and the mixture was incubated with 2M H 2 SO 4 The reaction was terminated. Read with a microplate reader at 450 nm. ELISA results showed that the EC50 value of 16 humanized antibodies of screening clone 1-clone 16 total was about half that of chimeric antibody WBP247.CAb1, with approximately one-fold higher affinity than chimeric antibody. (see Table 5, FIG. 6).
TABLE 5 binding of antibodies to antigen CD147 EC 50 Measurement
13. Full length humanized antibody immunohistochemical screening
In order to further detect the specific binding capacity of the expressed serial humanized antibody clones 5-16 and tumor tissues, the immune tissue cross reaction of the antibody is examined, and the specificity of the humanized antibody is further screened by an immunohistochemical staining method. The specific operation is as follows: conventional xylene dewaxing, gradient alcohol dehydration and hydration tissue chip; 3%H 2 O 2 Blocking inactivation of endogenous peroxidases; sealing the normal sheep serum working solution; antibody clone 5-16 is used as a primary antibody, a biotin-marked rabbit anti-human Fc antibody is used as a secondary antibody, a horseradish peroxidase-marked streptomycin ovalbumin working solution is used as a tertiary antibody, DAB color development, hematoxylin counterstain, dehydration and transparency are carried out, and then the piece is sealed and subjected to microscopic examination. Positive judgment: positive with brown staining of cell membrane. Through this round of expression screening, two available candidate humanized antibodies WBP247.hAb6 and clone 12 were obtained again, wherein clone 12 was able to bind not only to liver cancer specimens, but also to lung cancer specimens. Specific information is shown in table 6 below:
TABLE 6 specific screening of humanized antibodies by immunohistochemical staining method
Three humanized monoclonal antibodies, namely clone 4 (WBP 247.hAb4), clone 6 (WBP 247.hAb6) and clone 12 (WBP 247.hAb12) were initially screened for downstream stable cell line selection by multiple histochemical staining.
14. Construction of humanized antibody high-efficiency expression vector and screening of stable expression cell strain
According to the results of the ELISA and the immunity, three clones with the best affinity and specificity, namely clone 4, clone 6 and clone 12, namely the gene sequences of WBP247.hAb4, WBP247.hAb6 and WBP247.hAb12 are selected to construct a high-efficiency expression vector and screen stable cell strains.
TABLE 7 WBP247.hAb4, WBP247.hAb6 and WBP247.hAb12 sequence combination information
(wherein the clone 12 light chain variable region has the amino acid sequence shown as SEQ ID NO:113, the corresponding light chain variable region (VL) nucleotide sequence shown as SEQ ID NO:112, the heavy chain variable region has the amino acid sequence shown as SEQ ID NO:111, and the corresponding heavy chain variable region (VH) nucleotide sequence shown as SEQ ID NO: 110).
14.1 Construction of the light chain expression vector pWX2.1-LC-B-247B4
In vitro gene DNA (27989-VL) fragment amplification is carried out, the DNA is used as a template, primers WX-893, WX-894, WX-895 and WX-900 (corresponding to SEQ ID NO:94, SEQ ID NO:95, SEQ ID NO:96 and SEQ ID NO: 101) are used for amplifying variable region fragments WBP247B4-VL, ecoRI restriction enzyme sites are introduced at the 5 'end of WBP247B4-VL, bsiWI restriction enzyme sites are introduced at the 3' end, ecoRI and BsiWI double enzyme digestion are carried out on the fragments and an expression vector pWX2.1 containing a light chain constant region gene, and 5119bp DNA fragments are recovered by gel cutting after 1% agarose gel electrophoresis. The DNA fragment after gel cutting and purification was subjected to ligation reaction with the fragment from plasmid pWX2.1, and the reaction was carried out at 16℃for 20 min with 20. Mu.l of T4 ligase system, and 10. Mu.l of ligation solution was used to transform E.coli TOP10 competent cells. After colony PCR identification, restriction enzyme identification and sequencing, a correct single clone was selected and cultured in 200ml LB medium at 37℃overnight with shaking at 220rpm, and the plasmid was extracted in large quantities, and the resulting plasmid was designated pWX2.1-LC-B-247B4 (5521 bp) (see FIG. 8).
14.2 construction of the light chain expression vector pWX2.1-LC-B-247B12
In vitro gene DNA (32270-VL) fragment amplification is carried out, the DNA is used as a template, primers WX-896, WX-897, WX-898 and WX-900 (corresponding to SEQ ID NO:97, SEQ ID NO:98, SEQ ID NO:99 and SEQ ID NO: 101) are used for amplifying variable region fragments WBP247B12-VL, ecoRI restriction enzyme cutting sites are introduced at the 5 'end of WBP247B12-VL, bsiWI restriction enzyme cutting sites are introduced at the 3' end, ecoRI and BsiWI double enzyme cutting is carried out on the fragments and an expression vector pWX2.1 containing light chain constant region genes, and 5119bp DNA fragments are recovered by gel cutting after 1% agarose gel electrophoresis. The DNA fragment after gel cutting purification was subjected to ligation reaction with the fragment derived from plasmid pWX2.1 to transform E.coli TOP10 competent cells. After colony PCR identification, restriction enzyme identification and sequencing, a correct single clone was selected and cultured in 200ml LB medium at 37℃overnight with shaking at 220rpm, and the plasmid was extracted in large quantities, and the resulting plasmid was designated pWX2.1-LC-B-247B12 (5521 bp) (see FIG. 9).
14.3 construction of the heavy chain expression vector pWX1.1-HC-Z-247B4
In vitro gene DNA (27989-VH) fragment amplification is carried out, the DNA is taken as a template, primers WX-887, WX-888, WX-889 and WX-899 (corresponding to SEQ ID NO:88, SEQ ID NO:89, SEQ ID NO:90 and SEQ ID NO:100 in a sequence table) are used for amplifying variable region fragment WBP247B4-VH, ecoRI restriction enzyme sites are introduced at the 5 'end of WBP247B4-VH, nheI restriction enzyme sites are introduced at the 3' end, ecoRI and NheI double enzyme digestion are carried out on the fragment and an expression vector pWX1.1 containing heavy chain constant region genes, and a 5202bp DNA fragment is recovered after agarose gel electrophoresis. The DNA fragment after gel cutting purification was subjected to ligation reaction with the fragment derived from plasmid pWX1.1 to transform E.coli TOP10 competent cells. After colony PCR identification, restriction enzyme identification and sequencing, a correct single clone was selected and cultured in 200ml LB medium at 37℃overnight with shaking at 220rpm, and the plasmid was extracted in large quantities, and the resulting plasmid was designated pWX1.1-HC-Z-247B4 (5625 bp) (see FIG. 10).
Construction of the 4-fold chain expression vector pWX1.1-HC-Z-247B6
In vitro gene DNA (32338-VH) fragment amplification is carried out, the DNA is taken as a template, primers WX-890, WX-891, WX-892 and WX-899 (corresponding to SEQ ID NO:91, SEQ ID NO:92, SEQ ID NO:93 and SEQ ID NO:100 in a sequence table) are used for amplifying variable region fragments WBP247B6-VH, ecoRI restriction enzyme sites are introduced at the 5 'end of WBP247B6-VH, nheI restriction enzyme sites are introduced at the 3' end, ecoRI and NheI double enzyme digestion are carried out on the fragments and an expression vector pWX1.1 containing heavy chain constant region genes, and 5202bp DNA fragments are recovered after agarose gel electrophoresis. The DNA fragment after gel cutting purification was subjected to ligation reaction with the fragment derived from plasmid pWX1.1 to transform E.coli TOP10 competent cells. After colony PCR identification, restriction enzyme identification and sequencing, a correct single clone was selected and cultured in 200ml LB medium at 37℃overnight with shaking at 220rpm, and the plasmid was extracted in large quantities, and the resulting plasmid was designated pWX1.1-HC-Z-247B6 (5625 bp) (see FIG. 11).
14.5 construction and screening of CHO Stable expression cell lines
After vector construction, the humanized antibody light chain expression vector and the humanized antibody heavy chain expression vector are carried out by the delegated drug Ming Kangde according to (1) pWX2.1-LC-B-247B4 and pWX1.1-HC-Z-247B4 respectively; (2) pWX2.1-LC-B-247B6, pWX1.1-HC-Z-247B4; (3) WX2.1-LC-B-247B12 and pWX1.1-HC-Z-247B4 are co-transfected into CHO/DHFR cells, medium with proper concentration is added for screening and passage, and monoclonal is selected to obtain CHO stable expression cell strain.
Thereafter, a miniport batch feed experiment was performed to measure titers. The WBP247.hAb12 antibody (named as cell line 247C-B4Z2-01-C-005 (CCTCC NO. C2019147), cell line 247A-B9Z4-02-C-T9 (CCTCC NO. C2019148) and cell line 247B-B9Z4-01-C-T9 (CCTCC NO. C2019149) which express WBP 247.hAb6) are obtained by screening through four-wheel batch feed optimization, and are currently preserved in the China center for type culture collection of Wuhan, and the preservation date is 2019, 7 months and 16 days.
15. In vitro killing experiment of tumor cells of humanized anti-CD 147 antibody
The method comprises the following steps: taking human lung cancer cell NCI-H520 in logarithmic phase, digesting with pancreatin to obtain single cell suspension, and adjusting concentration to 1×10 4 And each ml. 2000 cells (200. Mu.l cell suspension) were seeded into 96-well plates, 5% CO 2 Incubate overnight at 37 ℃, wait for cells to adhere and resume log-proliferated state.
Marking three humanized antibodies with DM1 according to the conventional ADC pharmaceutical laboratory preparation method to obtain WBP247.hAb12-DM1, WBP247.hAb4-DM1 and WBP247.hAb6-DM1. The following gradients were diluted with serum-free RPMI1640 medium, respectively: 1000. 100, 10, 1, 0.1, 0.01, 0.001, 0.0001 μg/mL; mu.l of each concentration was added to the corresponding well, and 6 multiplex wells were designed for each concentration. Negative antibody control (human IgG) and background (cell-free medium only) were designed at the same time. 5% CO 2 Incubation was carried out at 37℃for 48h, and 10. Mu.L of CCK-8 chromogenic solution was added to each well. Incubate at 37℃for 2h, and read absorbance at 450nm with a full wavelength microplate reader. The results are shown in FIG. 13, and the humanized antibodies have good killing effect on tumor cells (FIG. 13), which shows that the prepared humanized antibodies have good tumor specificity and targeting. From this effect, one skilled in the art can infer that the antibody of the present invention can be used for preparing a medicine for diagnosing and treating (a medicine for diagnosing CD147 expression positive diseases and biotechnological products, detection reagents, imaging and examination diagnostic reagents thereof).
Nucleotide sequence Listing electronic document
<110> Chinese people's liberation army fourth army university
<120> anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof
<210>1
<211>37
<212>DNA
<213>
<220>HAb18-F
<400>1
CCCAGCCGGCCATGGCCGAAGTGAAGCTTGAGGAGTC
<210>2
<211>50
<212>DNA
<213>
<220>Linker-HAb18-R1
<400>2
TACCACCACCACCAGAACCGCCACCACCTGAAGAGACAGTGACCAGAGTC
<210>3
<211>45
<212>DNA
<213>
<220>HAb18-linker-R2
<400>3
ACCGCCACTACCACCGCCACCGCTACCACCACCACCAGAACCGCC
<210>4
<211>51
<212>DNA
<213>
<220>HAb18-Linker-F1
<400>4
GGCGGTGGTAGTGGCGGTGGCGGTGCTAGCAGTATTGTGATGACCCAGACT
<210>5
<211>39
<212>DNA
<213>
<220>HAb18-R
<400>5
GTTTTTGTTCTGCGGCCGCTTTGATTTCCAGCTTTGTCC
<210>6
<211>11
<212>PRT
<213>
<220>L-CDR1
<400>6
KASQSVINDVA
<210>7
<211>7
<213>PRT
<213>
<220>L-CDR2
<400>7
YASNRNT
<210>8
<211>9
<214>PRT
<213>
<220>L-CDR3
<400>8
QQDYSPPFT
<210>9
<211>5
<215>PRT
<213>
<220>H-CDR1
<400>9
DAWMD
<210>10
<211>19
<216>PRT
<213>
<220>H-CDR2
<400>10
EIRSKANNHAPYYTESVKG
<210>11
<211>6
<217>PRT
<213>
<220>H-CDR3
<400>11
DSTATH
<210>12
<211>39
<212>DNA
<213>
<220>247-A1
<400>12
CCCAGCCGGCCATGGCCGAAGTGCAGCTTGAGGAGTCTG
<210>13
<211>42
<212>DNA
<213>
<220>247-A2
<400>13
GGATCCTCCAGGTTGCACCAAGCCTCCTCCAGACTCCTCAAG
<210>14
<211>42
<212>DNA
<213>
<220>247-A3
<400>14
CCTGGAGGATCCCTGAGGCTGTCTTGTGCCGCCTCTGGATTC
<210>15
<211>34
<212>DNA
<213>
<220>247-A4
<400>15
GTCCATCCAGGCGTCACTAAAAGTGAATCCAGAG
<210>16
<211>50
<212>DNA
<213>
<220>247-A5
<400>16
CGCCTGGATGGACTGGGTCCGCCAGGCCCCAGGCAAGGGACTTGAGTGGG
<210>17
<211>50
<212>DNA
<213>
<220>247-A6
<400>17
GGTGCATGATTATTAGCTTTGCTTCTAATTTCAGMAACCCACTCAAGTCC
<210>18
<211>48
<212>DNA
<213>
<220>247-A7
<400>18
AATAATCATGCACCATACTATACTGAGTCTGTGAAAGGGAGGTTCACC
<210>19
<211>49
<212>DNA
<213>
<220>247-A8
<400>19
GCAGGTAGGTAATACTTTTGGAATCATCTCGTGAGATGGTGAACCTCCC
<210>20
<211>41
<212>DNA
<213>
<220>247-A9
<400>20
GTATTACCTACCTGCAAATGAACAGCTTAAGAGCTGAAGAC
<210>21
<211>50
<212>DNA
<213>
<220>247-A10
<400>21
GGTAGCCGTGCTATCCCTGGCACAGTAATACACGGCCRTGTCTTCAGCTC
<210>22
<211>48
<212>DNA
<213>
<220>247-A11
<400>22
TAGCACGGCTACCCACTGGGGCCAAGGGACTCTGGTCACTGTCTCTTC
<210>23
<211>50
<212>DNA
<213>
<220>247-A12
<400>23
CCGCCACTACCACCGCCACCGCTACCACCACCACCTGAAGAGACAGTGAC
<210>24
<211>46
<212>DNA
<213>
<220>247-A13
<400>24
TAGCGGTGGCGGTGGTAGTGGCGGTGGCGGTGCTAGCGACATTCAG
<210>25
<211>49
<212>DNA
<213>
<220>247-A14
<400>25
CTGAGGCGCTCASGGAGGAGGGGGACTGGGTCATCTGAATGTCGCTAGC
<211>38
<212>DNA
<213>
<220>247-A15
<400>26
TGAGCGCCTCAGTCGGAGACAGGGTTACCATAACCTGC
<210>27
<211>45
<212>DNA
<213>
<220>247-A16
<400>27
AGCTACATCATTAATCACACTCTGACTGGCCTTGCAGGTTATGGT
<210>28
<211>40
<212>DNA
<213>
<220>247-A17
<400>28
TGTGATTAATGATGTAGCTTGGTACCAACAGAAGCCAGGG
<210>29
<211>50
<212>DNA
<213>
<220>247-A18
<400>29
TGCGATTGGATGCATAGTATATCAGCAGTTTAGGGGGCTGCCCTGGCTTC
<210>30
<211>43
<212>DNA
<213>
<220>247-A19
<400>30
CATCCAATCGCAACACTGGAGTTCCTGATCGCTTCAGCGGCAG
<210>31
<211>43
<212>DNA
<213>
<220>247-A20
<400>31
GATTTTGAGAGTGAAATCCGTCCCGGMTCCACTGCCGCTGAAG
<210>32
<211>50
<212>DNA
<213>
<220>247-A21
<400>32
CTCTCAAAATCAGCCGGGTGGAGGCTGAAGACGTGGGGGTTTATTACTGT
<210>33
<211>39
<212>DNA
<213>
<220>247-A22
<400>33
CGTGAATGGAGGACTATAATCCTGCTGACAGTAATAAAC
<210>34
<211>44
<212>DNA
<213>
<220>247-A23
<400>34
CCTCCATTCACGTTCGGCCAGGGGACAAAGCTGGAAATCAAAGC
<210>35
<211>48
<212>DNA
<213>
<220>247-A24
<400>35
ATCCTCTTCTGAGATGAGTTTTTGTTCTGCGGCCGCTTTGATTTCCAG
<210>36
<211>39
<212>DNA
<213>
<220>247-B1
<400>36
CCCAGCCGGCCATGGCCGAAGTGCAGCTTGTGGAGTCTG
<210>37
<211>42
<212>DNA
<213>
<220>247-B2
<400>37
GGATCCTCCAGGTTGCACCAAGCCTCCTCCAGACTCCACAAG
<210>38
<211>42
<212>DNA
<213>
<220>247-B3
<400>38
CCTGGAGGATCCCTGAAACTGTCTTGTGCCGCCTCTGGATTC
<210>39
<211>50
<212>DNA
<213>
<220>247-B4
<400>39
CGCCTGGATGGACTGGGTCTGCCAGGCCCCAGAGAAGGGACTTGAGTGGG
<210>40
<211>50
<212>DNA
<213>
<220>247-B5
<400>40
GGTGCATGATTATTAGCTTTGCTTCTAATTTCAGCAACCCACTCAAGTCC
<210>41
<211>51
<212>DNA
<213>
<220>247-B6
<400>41
TTGCAGGTACAGTCTGTTTTTGGAGTTATCTCGTGAGATGGTGAACCTCCC
<210>42
<211>50
<212>DNA
<213>
<220>247-B7
<400>42
TGTACCTGCAAATGAACAGCTTAAGAGCTGAAGACACTGCCGTGTATTAC
<210>43
<211>39
<212>DNA
<213>
<220>247-B8
<400>43
GGTAGCCGTGCTATCCCTGGCACAGTAATACACGGCAGT
<210>44
<211>46
<212>DNA
<213>
<220>247-B9
<400>44
CTGAGGCGCTCAGGGAGGAGGGGGACTGGGTCATCTGAATGTCGCT
<210>45
<211>50
<212>DNA
<213>
<220>247-B10
<400>45
TGCGATTGGATGCATAGTATATCAGCAGCCTAGGGGCCTGCCCTGGCTTC
<210>46
<211>43
<212>DNA
<213>
<220>247-B11
<400>46
CATCCAATCGCAACACTGGAGTTCCTAGCCGCTTCAGCGGCAG
<210>47
<211>43
<212>DNA
<213>
<220>247-B12
<400>47
GATGGTGAAAGTGAAATCCGTCCCGCTTCCACTGCCGCTGAAG
<210>48
<211>50
<212>DNA
<213>
<220>247-B13
<400>48
CTTTCACCATCAGCAGCCTCCAGCCCGAAGACATCGCAACCTATTACTGT
<210>49
<211>41
<212>DNA
<213>
<220>247-B14
<400>49
CGTGAATGGAGGACTATAATCCTGCTGACAGTAATAGGTTG
<210>50
<211>42
<212>DNA
<213>
<220>247-C3
<400>50
CCTGGAGGATCCCTGAGGCTGTCTTGTBCCGCCTCTGGATTC
<210>51
<211>50
<212>DNA
<213>
<220>247-C5
<400>51
CGCCTGGATGGACTGGGTCCGCCAGCCCCCAGGCAAGGGACTTGAGTGGG
<210>52
<211>50
<212>DNA
<213>
<220>247-C6
<400>52
GGTGCATGATTATTAGCTTTGCTTCTAATTTCAGAAACCCACTCAAGTCC
<210>53
<211>51
<212>DNA
<213>
<220>247-C8
<400>53
TTGCAGGTACAGGGTGTTTTTGGAGTTATCTCGTGAGATGGTGAACCTCCC
<210>54
<211>38
<212>DNA
<213>
<220>247-C10
<400>54
GGTAGCCGTGCTATCCYTGGCACAGTAATACACGGCAG
<210>55
<211>49
<212>DNA
<213>
<220>247-C14
<400>55
CTGAGGCGCTCAGGRAGGAGGGGGACTGGGTCAGCTGAATGTCGCTAGC
<210>56
<211>50
<212>DNA
<213>
<220>247-C18
<400>56
TGCGATTGGATGCATAGTATATCAGCAGTTTAGGGGYCTTCCCTGGCTTC
<210>57
<211>50
<212>DNA
<213>
<220>247-C21
<400>57
CTTTCACCATCAGCAGCCTCGAGGCTGAAGACGCCGCAACCTATTACTGT
<210>58
<211>42
<212>DNA
<213>
<220>247-D3
<400>58
CCTGGAGGATCCCTGAGGCTGTCTTGTGCCGGCTCTGGATTC
<210>59
<211>50
<212>DNA
<213>
<220>247-D9
<400>59
TGTACCTGCAAATGAACARCTTAAGAGCTGAAGGCACTGCCGTGTATTAC
<210>60
<211>49
<212>DNA
<213>
<220>247-D14
<400>60
CTGAGGCGCTCAGGGAGGAGGGGGACTGGGTCACCTGAATGTCGCTAGC
<210>61
<211>50
<212>DNA
<213>
<220>247-D18
<400>61
TGCGATTGGATGCATAGTATATCAGCAGTTTAGGGACCTTCCCTGGCTTC
<210>62
<211>43
<212>DNA
<213>
<220>247-D20
<400>62
GATGGTGAGAGTGAAATCCGTCCCGCTTCCACTGCCGCTGAAG
<210>63
<211>50
<212>DNA
<213>
<220>247-D21
<400>63
CTCTCACCATCAGCAGCCTCCAGCCCGAAGACKTCGCAACCTATTACTGT
<210>64
<211>42
<212>DNA
<213>
<220>247-E3
<400>64
CCTGGAGGATCCCTGAGGCTGTCTTGTGCCGCCTCTGGATTC
<210>65
<211>36
<212>DNA
<213>
<220>247-E4
<400>65
GTCCATCCAGGCGTCACTCACAGTGAATCCAGAGGC
<210>66
<211>50
<212>DNA
<213>
<220>247-E9
<400>66
TGTACCTGCAAATGAACAACTTAAGAGCTGAAGGCACTGCCGCCTATTAC
<210>67
<211>38
<212>DNA
<213>
<220>247-E10
<400>67
GGTAGCCGTGCTATCCCTGGCACAGTAATAGGCGGCAG
<210>68
<211>50
<212>DNA
<213>
<220>247-E18
<400>68
TGCGATTGGATGCATAGTATATCACCAGCACAGGAKMCTGCCCTGGCTTC
<210>69
<211>43
<212>DNA
<213>
<220>247-E20
<400>69
GATGGTGAGAGTGAAATCCGTCCCGCTTCCACTGCCGCTGAAG
<210>70
<211>50
<212>DNA
<213>
<220>247-E21
<400>70
CTCTCACCATCAGCTGCCTCCAGAGCGAAGACTTCGCAACCTATTACTGT
<210>71
<211>40
<212>DNA
<213>
<220>247-F1
<400>71
GCCCAGCCGGCCATGGCCCAGGTGCAGCTTGTGGAGTCTG
<210>72
<211>42
<212>DNA
<213>
<220>247-F3
<400>72
CCTGGAGGATCCCTGAGGCTGTCTTGTTCCGCCTCTGGATTC
<210>73
<211>51
<212>DNA
<213>
<220>247-F8
<400>73
TTGCAGGTACAGGCTGTTTTTGGCGTTATCTCGTGAGATGGTGAACCTCCC
<210>74
<211>40
<212>DNA
<213>
<220>247-F17
<400>74
TGTGATTAATGATGTAGCTTGGTACCTGCAGAAGCCAGGG
<210>75
<211>50
<212>DNA
<213>
<220>247-F18
<400>75
TGCGATTGGATGCATAGTATATCAGCAGCTGAGGAGACTGCCCTGGCTTC
<210>76
<211>40
<212>DNA
<213>
<220>247-G1
<400>76
GCCCAGCCGGCCATGGCCSAAGTGCAGCTTGTGGAGTCTG
<210>77
<211>42
<212>DNA
<213>
<220>247-G2
<400>77
GGATCCTCCAGGCTTCACCAAGCCTCCTCCAGACTCCACAAG
<210>78
<211>51
<212>DNA
<213>
<220>247-G8
<400>78
TTGCAGGTACAGGGTGTTTTTGGCGTTATCTCGTGAGATGGTGAACCTCCC
<210>79
<211>40
<212>DNA
<213>
<220>247-H1
<400>79
GCCCAGCCGGCCATGGCCSAAGTGCAGCTTCTGGAGTCTG
<210>80
<211>42
<212>DNA
<213>
<220>247-H2
<400>80
GGATCCTCCAGGTTKCACCAAGCCTCCTCCAGACTCCAGAAG
<210>81
<211>42
<212>DNA
<213>
<220>247-H3
<400>81
CCTGGAGGATCCCTGAGGCTGTCTTGTGCCGCCTCTGGATTC
<210>82
<211>40
<212>DNA
<213>
<220>247-33_F1
<400>82
GGCTCCCCGGGGCGCGCTGTGACATCCAGATGACCCAGTC
<210>83
<211>40
<212>DNA
<213>
<220>247-33_R1
<400>83
GATGGTGCAGCCACCGTACGTTTGATTTCCACCTTGGTCC
<210>84
<211>41
<212>DNA
<213>
<220>247-VH_F1
<400>84
CTCTCCACAGGTGTACACTCCCAAGTGCAGCTTGTGGAGTC
<210>85
<211>41
<212>DNA
<213>
<220>247-VH_R1
<400>85
GATGGGCCCTTGGTCGACGCTGAAGAGACAGTGACCAGAGT
<210>86
<211>40
<212>DNA
<213>
<220>247-vl_R1
<400>86
GATGGTGCAGCCACCGTACGTTTGATTTCCAGCTTTGTCC
<210>87
<211>40
<212>DNA
<213>
<220>247-VL-2_F2
<400>87
GGCTCCCCGGGGCGCGCTGTGACATTCAGATGACCCAGTC
<210>88
<211>52
<212>DNA
<213>
<220>WX-887
<400>88
TTGTTGTTATTTTACAAGGTGTCCAGTGTCAAGTGCAGCTTGTGGAGTCTGG
<210>89
<211>43
<212>DNA
<213>
<220>WX-888
<400>89
AGTTTGGGCTGAGCTGGGTTTTCCTTGTTGTTATTTTACAAGG
<210>90
<211>55
<212>DNA
<213>
<220>WX-889
<400>90
TCTAGAGTCGACGAATTCGCCGCCACCATGGAGTTTGGGCTGAGCTGGGTTTTCC
<210>91
<211>44
<212>DNA
<213>
<220>WX-890
<400>91
TATTTTAAAAGGTGTCCAGTGTGAAGTGCAGCTTGTGGAGTCTG
<210>92
<211>50
<212>DNA
<213>
<220>WX-891
<400>92
GGAGTTTGGGCTGAGCTGGATTTTCCTTGCTGCTATTTTAAAAGGTGTCC
<210>93
<211>48
<212>DNA
<213>
<220>WX-892
<400>93
TCTAGAGTCGACGAATTCGCCGCCACCATGGAGTTTGGGCTGAGCTGG
<210>94
<211>46
<212>DNA
<213>
<220>WX-893
<400>94
GCTCTGGCTCTCAGGTGCCAGATGTGACATTCAGATGACCCAGTCC
<210>95
<211>50
<212>DNA
<213>
<220>WX-894
<400>95
GAGGGTCCCTGCTCAGCTCCTGGGGCTCCTGCTGCTCTGGCTCTCAGGTG
<210>96
<211>50
<212>DNA
<213>
<220>WX-895
<400>96
TCTAGAGTCGACGAATTCGCCGCCACCATGGACATGAGGGTCCCTGCTCA
<210>97
<211>48
<212>DNA
<213>
<220>WX-896
<400>97
CTACTCTGGCTCCGAGGTGCCAGATGTGACATTCAGATGACCCAGTCC
<210>98
<211>48
<212>DNA
<213>
<220>WX-897
<400>98
GGGTCCCCGCTCAGCTCCTGGGGCTCCTGCTACTCTGGCTCCGAGGTG
<210>99
<211>55
<212>DNA
<213>
<220>WX-898
<400>99
TCTAGAGTCGACGAATTCGCCGCCACCATGGACATGAGGGTCCCCGCTCAGCTCC
<210>100
<211>32
<212>DNA
<213>
<220>WX-899
<400>100
GGTGCTAGCTGAAGAGACAGTGACCAGAGTCC
<210>101
<211>29
<212>DNA
<213>
<220>WX-900
<400>101
CACCGTACGTTTGATTTCCAGCTTTGTCC
<210>102
<211>351
<212>DNA
<213> humanization
<220> humanized antibody WBP247.HAb4 heavy chain variable region (VH) nucleotide sequence
<400>102
CAAGTGCAGCTTGTGGAGTCTGGAGGAGGCTTGGTGCAGCCTGGAGGATCCCTGCGGCTGTCTTGTGTTGCCTCTGGATTCACTTTTAGTGACGCCTGGATGGACTGGGTCCGCCAGGCCCCAGGCAAGGGACTTGAGTGGGTTGCCGAAATTAGAAGCAAAGCTAATAATCATGCACCATACTATACTGAGTCTGTGAAAGGGAGGTTCACCATCTCACGAGATGACTCCAAAAACACCCTCTACCTGCAAATGAACAGCTTAAAGACCGAAGACACTGCCGTGTATTACTGTGCCAGGGATAGCACGGCTACCCACTGGGGCCAAGGGACTCTGGTCACTGTCTCTTCA
<210>103
<211>117
<212>PRT
<213> humanization
<220> humanized antibody WBP247.HAb4 heavy chain variable region (VH) amino acid sequence
<400>103
QVQLVESGGGLVQPGGSLRLSCVASGFTFSDAWMDWVRQAPGKGLEWVAEIRSKANNHAPYYTESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCARDSTATHWGQGTLVTVSS
<210>104
<211>321
<212>DNA
<213> humanization
<220> humanized antibody WBP247.HAb4 light chain variable region (VL) nucleotide sequence
<400>104
GACATTCAGATGACCCAGTCCCCCTCCTCCCTGAGCGCCTCAGTCGGAGACAGGGTTACCATAACCTGCAAGGCCAGTCAGAGTGTGATTAATGATGTAGCTTGGTACCAACAGAAGCCAGGGCAGCCCCCTAAACTGCTGATATACTATGCATCCAATCGCAACACTGGAGTTCCTAGCCGCTTCAGCGGCAGTGGAAGCGGGACGGATTTCACTTTCACCATCAGCAGCCTCCAGCCCGAAGACATCGCAACCTATTACTGTCAGCAGGATTATAGTCCTCCATTCACGTTCGGCCAGGGGACAAAGCTGGAAATCAAA
<210>105
<211>107
<212>PRT
<213> humanization
<220> humanized antibody WBP247.HAb4 light chain variable region (VL) amino acid sequence
<400>105
DIQMTQSPSSLSASVGDRVTITCKASQSVINDVAWYQQKPGQPPKLLIYYASNRNTGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQDYSPPFTFGQGTKLEIK
<210>106
<211>351
<212>DNA
<213> humanization
<220> humanized antibody WBP247.HAb6 heavy chain variable region (VH) nucleotide sequence
<400>106
GAAGTGCAGCTTGTGGAGTCTGGAGGAGGCTTGGTGAAGCCTGGAGGATCCCTGAGGCTGTCTTGTGCCGCCTCTGGATTCACTTTTAGTGACGCCTGGATGGACTGGGTCCGCCAGGCCCCAGGCAAGGGACTTGAGTGGGTTGCTGAAATTAGAAGCAAAGCTAATAATCATGCACCATACTATACTGAGTCTGTGAAAGGGAGGTTCACCATCTCACGAGATGATTCCAAAAGTATTACCTACCTGCAAATGAACAGCTTAAGAGCTGAAGACACTGCCGTGTATTACTGTGCCAGGGATAGCACGGCTACCCACTGGGGCCAAGGGACTCTGGTCACTGTCTCTTCA
<210>107
<211>117
<212>PRT
<213> humanization
<220> humanized antibody WBP247.HAb6 heavy chain variable region (VH) amino acid sequence
<400>107
EVQLVESGGGLVKPGGSLRLSCAASGFTFSDAWMDWVRQAPGKGLEWVAEIRSKANNHAPYYTESVKGRFTISRDDSKSITYLQMNSLRAEDTAVYYCARDSTATHWGQGTLVTVSS
<210>108
<211>321
<212>DNA
<213> humanization
<220> humanized antibody WBP247.HAb6 light chain variable region (VL) nucleotide sequence
<400>108
GACATTCAGATGACCCAGTCCCCCTCCTCCCTGAGCGCCTCAGTCGGAGACAGGGTTACCATAACCTGCAAGGCCAGTCAGAGTGTGATTAATGATGTAGCTTGGTACCAACAGAAGCCAGGGCAGCCCCCTAAACTGCTGATATACTATGCATCCAATCGCAACACTGGAGTTCCTAGCCGCTTCAGCGGCAGTGGAAGCGGGACGGATTTCACTTTCACCATCAGCAGCCTCCAGCCCGAAGACATCGCAACCTATTACTGTCAGCAGGATTATAGTCCTCCATTCACGTTCGGCCAGGGGACAAAGCTGGAAATCAAA
<210>109
<211>107
<212>PRT
<213> humanization
<220> humanized antibody WBP247.HAb6 light chain variable region (VL) amino acid sequence
<400>109
DIQMTQSPSSLSASVGDRVTITCKASQSVINDVAWYQQKPGQPPKLLIYYASNRNTGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQDYSPPFTFGQGTKLEIK
<210>110
<211>351
<212>DNA
<213> humanization
<220> humanized antibody clone 12 heavy chain variable region (VH) nucleotide sequence
<400>110
CAAGTGCAGCTTGTGGAGTCTGGAGGAGGCTTGGTGCAGCCTGGAGGATCCCTGCGGCTGTCTTGTGTTGCCTCTGGATTCACTTTTAGTGACGCCTGGATGGACTGGGTCCGCCAGGCCCCAGGCAAGGGACTTGAGTGGGTTGCCGAAATTAGAAGCAAAGCTAATAATCATGCACCATACTATACTGAGTCTGTGAAAGGGAGGTTCACCATCTCACGAGATGACTCCAAAAACACCCTCTACCTGCAAATGAACAGCTTAAAGACCGAAGACACTGCCGTGTATTACTGTGCCAGGGATAGCACGGCTACCCACTGGGGCCAAGGGACTCTGGTCACTGTCTCTTCA
<210>111
<211>117
<212>PRT
<213> humanization
<220> humanized antibody clone 12 heavy chain variable region (VH) amino acid sequence
<400>111
QVQLVESGGGLVQPGGSLRLSCVASGFTFSDAWMDWVRQAPGKGLEWVAEIRSKANNHAPYYTESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCARDSTATHWGQGTLVTVSS
<210>112
<211>321
<212>DNA
<213> humanization
<220> humanized antibody clone 12 light chain variable region (VL) nucleotide sequence
<400>112
GACATTCAGATGACCCAGTCCCCCTCCTCCCTGAGCGCCTCAGTCGGAGACAGGGTTACCATAACCTGCAAGGCCAGTCAGAGTGTGATTAATGATGTAGCTTGGTACCAACAGAAGCCAGGGCAGGCCCCTAGGCTGCTGATATACTATGCATCCAATCGCAACACTGGAGTTCCTGATCGCTTCAGCGGCAGTGGATCCGGGACGGATTTCACTCTCAAAATCAGCCGGGTGGAGGCTGAAGACGTGGGGGTTTATTACTGTCAGCAGGATTATAGTCCTCCATTCACGTTCGGCCAGGGGACAAAGCTGGAAATCAAA
<210>113
<211>107
<212>PRT
<213> humanization
<220> humanized antibody clone 12 light chain variable region (VL) amino acid sequence
<400>113
DIQMTQSPSSLSASVGDRVTITCKASQSVINDVAWYQQKPGQAPRLLIYYASNRNTGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQDYSPPFTFGQGTKLEIK
TCCAGCTGTGGAAGCACGACCTGGAATACTTCAAGTCGCTGCCCCAG
GCTGACCAGGACAATATCATCGGCCGCCGCCTGAGCGACAACGAAAA
GCTCGGCGATGCCCCCGAGTCCGCGCACGTCAAGCGCACTGCCCAGG
AAAGCTTTGAACCCGAAGCGTTCATGGTCCGTCGCTCGGTAGCCTGG
GCCGACCAGCGCGGCGCCGGCCTGGCCTTCGTCGCCTTGGGCAAGAG
TTTCGATGCATTCGGAGTGCAATTGCGGCGCATGAGTGGCCTGGAAGA
CGGCATCATCGACGGATTGTACCGCTTTAGCCGCCCGCTGACGGGTGG
CTACTACTGGTGCCCGCCGATGGGCGAGACGGGGGTTGATCTGAGCT
CCTTGCTGCGGGCCTGA
<210>4
<211>287
<212> amino acid
<213> amino acid sequence of type B dye-decolorized peroxidase mutant
<220>
<223>
<400>4
MPFQQGLLATPVPAHARHLFFTLQSPEALPAALDALLPQVDGEQLL
LGIGAPLVKALGREVPGLRAFPLLDTAVENPSTQHALWLWLRGDERGDLLLRAQALEQALAPALQLADSVDGFLRRGGYDLTGYEDGTENPVDEDVV
QAAIAADGSSFAAFQLWKHDLEYFKSLPQADQDNIIGRRLSDNEKLGDA
PESAHVKRTAQESFEPEAFMVRRSVAWADQRGAGLAFVALGKSFDAFGV
QLRRMSGLEDGIIDGLYRFSRPLTGGYYWCPPMGETGVDLSSLLRA

Claims (9)

1. A monoclonal antibody against human CD147, the heavy chain variable region and the light chain variable region of which have the amino acid sequences:
wbp247.hab12 antibody: the amino acid sequence of the heavy chain variable region is shown as SEQ ID NO. 111, and the amino acid sequence of the light chain variable region is shown as SEQ ID NO. 113.
2. The monoclonal antibody against human CD147 of claim 1, wherein the nucleotide sequence of the heavy chain variable region of the wbp247.hab12 antibody comprises the sequences of the specific complementarity determining regions CDR1, CDR2 and CDR3 of SEQ ID NO: 16. SEQ ID NO:17 and SEQ ID NO:18, the CDR1, CDR2 and CDR3 sequences of the specific complementarity determining regions comprised by the nucleotide sequence of the light chain variable region are SEQ ID NOs: 13. SEQ ID NO:14 and SEQ ID NO:15.
3. A gene encoding the anti-human CD147 monoclonal antibody of claim 1, wherein the nucleotide sequences encoding the heavy chain variable region and the light chain variable region of the anti-human CD147 monoclonal antibody are:
wbp247.hab12 antibody: the nucleotide sequence of the coding heavy chain variable region is shown as SEQ ID NO. 110; the nucleotide sequence encoding the light chain variable region is shown as SEQ ID NO. 112.
4. A cell line expressing the monoclonal antibody of claim 1, the cell line being designated and deposited with the accession number:
cell line expressing wbp247.hab12 antibody: the name is: 247C-B4Z2-01-C-005, accession number: cctccc No. C2019147.
5. An antibody expressed by the cell line of claim 4.
6. An expression vector for the monoclonal antibody of claim 1.
7. The method of producing an antibody of claim 1, comprising:
a) Obtaining the DNA molecule sequence of the antibody of claim 1;
b) Constructing an expression vector containing the DNA molecule described in step a) and a regulatory sequence for expressing the DNA molecule;
c) Transfecting a host cell with the expression vector described in step b); culturing under culture conditions suitable for the host cell;
d) The monoclonal antibody of claim 1 is obtained through a separation and purification step.
8. Use of an antibody conjugate of the antibody of claim 1 coupled to maytansine derivative DM1 of the antibody of claim 1, a tubulin polymerase inhibitor MMAE of the antibody of claim 1 or a radionuclide iodine of the antibody of claim 1 for the preparation of a medicament for treating liver cancer or lung cancer.
9. Use of the antibody of claim 1 for the preparation of a medicament for diagnosing a CD147 expression positive disease, said CD147 expression positive disease being liver cancer or lung cancer.
CN201910796766.8A 2019-08-27 2019-08-27 Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof Active CN110642947B (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
CN202310565909.0A CN117327179A (en) 2019-08-27 2019-08-27 Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof
CN202310558186.1A CN117586397A (en) 2019-08-27 2019-08-27 Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof
CN201910796766.8A CN110642947B (en) 2019-08-27 2019-08-27 Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN201910796766.8A CN110642947B (en) 2019-08-27 2019-08-27 Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof

Related Child Applications (2)

Application Number Title Priority Date Filing Date
CN202310565909.0A Division CN117327179A (en) 2019-08-27 2019-08-27 Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof
CN202310558186.1A Division CN117586397A (en) 2019-08-27 2019-08-27 Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof

Publications (2)

Publication Number Publication Date
CN110642947A CN110642947A (en) 2020-01-03
CN110642947B true CN110642947B (en) 2023-07-28

Family

ID=69009925

Family Applications (3)

Application Number Title Priority Date Filing Date
CN201910796766.8A Active CN110642947B (en) 2019-08-27 2019-08-27 Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof
CN202310558186.1A Pending CN117586397A (en) 2019-08-27 2019-08-27 Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof
CN202310565909.0A Pending CN117327179A (en) 2019-08-27 2019-08-27 Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof

Family Applications After (2)

Application Number Title Priority Date Filing Date
CN202310558186.1A Pending CN117586397A (en) 2019-08-27 2019-08-27 Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof
CN202310565909.0A Pending CN117327179A (en) 2019-08-27 2019-08-27 Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof

Country Status (1)

Country Link
CN (3) CN110642947B (en)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112457406B (en) * 2020-11-27 2022-05-31 中国科学院上海药物研究所 anti-MMAE monoclonal antibody, coding sequence and application thereof
CN113549152B (en) * 2021-07-22 2023-06-20 中国人民解放军空军军医大学 anti-BASIGIN humanized antibody and application thereof

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1381461A (en) * 2002-03-15 2002-11-27 陈志南 Light chain or heavy chain variable region gene of human liver cancer monoclonal antibody HAb18 and its application
CN1782077A (en) * 2004-06-14 2006-06-07 陈志南 HAb18Gedomab 1 monoclonal antibody and its light and heavy chain variable area genes, coding polypeptide and use
CN101054416A (en) * 2006-06-23 2007-10-17 陈志南 HAb18GC2 monoclonal antibody and its light and heavy chain variable area genes, coding polypeptide and use
CN101076542A (en) * 2004-09-13 2007-11-21 伊沃詹尼克斯有限公司 Antibodies specific for hepatocellular carcinoma and other carcinomas and uses thereof
CN104086654A (en) * 2014-07-04 2014-10-08 中国人民解放军第四军医大学 Humanization modified anti-CD147 chimeric antibody HcHAb18 and application thereof

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1381461A (en) * 2002-03-15 2002-11-27 陈志南 Light chain or heavy chain variable region gene of human liver cancer monoclonal antibody HAb18 and its application
CN1782077A (en) * 2004-06-14 2006-06-07 陈志南 HAb18Gedomab 1 monoclonal antibody and its light and heavy chain variable area genes, coding polypeptide and use
CN101076542A (en) * 2004-09-13 2007-11-21 伊沃詹尼克斯有限公司 Antibodies specific for hepatocellular carcinoma and other carcinomas and uses thereof
CN101054416A (en) * 2006-06-23 2007-10-17 陈志南 HAb18GC2 monoclonal antibody and its light and heavy chain variable area genes, coding polypeptide and use
CN104086654A (en) * 2014-07-04 2014-10-08 中国人民解放军第四军医大学 Humanization modified anti-CD147 chimeric antibody HcHAb18 and application thereof

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
Chimeric antigen receptor T cells targeting CD147 for non-small cell lung cancer therapy;Xiaohong Chen等;《Translational Oncology》;20211209;101309 *
h5A12 抗体-药物偶联物治疗 HAb18G/CD147阳性结直肠癌的药效和药代动力学研究;赵宇;《中国优秀硕士学位论文全文数据库（电子期刊）医药卫生科技辑》;20180315;E072-354 *

Also Published As

Publication number Publication date
CN110642947A (en) 2020-01-03
CN117586397A (en) 2024-02-23
CN117327179A (en) 2024-01-02

Similar Documents

Publication Publication Date Title
Chiu et al. Engineering antibody therapeutics
EP4141029A1 (en) Antibody against nectin-4 and application thereof
US20170335016A1 (en) Stable multivalent antibody
WO2017197667A1 (en) Anti-human pd-l1 humanized monoclonal antibody and application thereof
CN105820250B (en) A kind of anti-BASIGIN humanized antibody and its application
EP3243838B1 (en) Humanized monoclonal antibody and uses thereof
EP4144758A1 (en) Single variable domain antibody targeting human programmed death ligand 1 (pd-l1) and derivative thereof
US9090994B2 (en) Antibody humanization by framework assembly
CN110642947B (en) Anti-human CD147 monoclonal antibody, expression vector, cell strain and application thereof
EP4321535A1 (en) Anti-cntn4 antibody and use thereof
CN109336973B (en) Anti-transferrin antibodies and uses thereof
WO2021197401A1 (en) Antigen-binding polypeptide binding to cd47, and use thereof
CN112480250A (en) Anti-human osteopontin antibody and application thereof
CN115536747B (en) Antibody combined with TROP2, bispecific antibody targeting TROP2 and CD3, and preparation method and application thereof
CN117384290B (en) Human ROBO1 binding molecules and uses thereof
CN113549152B (en) anti-BASIGIN humanized antibody and application thereof
CN108003238B (en) Fully human monoclonal antibody or antibody fragment capable of specifically recognizing CTLA-4, and method and application thereof
CN110407942B (en) Single domain antibodies against KN044
CN114163528B (en) CD47 binding molecules and uses thereof
EP4059962A1 (en) Pd-l1 binding molecule
CN117343182A (en) Anti-human TIGIT antibodies or functional fragments thereof and uses thereof
CN116478288A (en) Humanized CD47 antibody with weak red blood cell binding and application thereof
CN118496354A (en) Antibody libraries comprising common light chains, methods of making and uses thereof
CN118085092A (en) Isolated anti-human Claudin18.2 antibodies and uses thereof
CN116903747A (en) Humanized HER2 binding antibodies or HER2 antigen binding fragments and uses

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
GR01 Patent grant
GR01 Patent grant