CN110396127A - The preparation of anti-CD20 nano antibody - Google Patents
The preparation of anti-CD20 nano antibody Download PDFInfo
- Publication number
- CN110396127A CN110396127A CN201910215825.8A CN201910215825A CN110396127A CN 110396127 A CN110396127 A CN 110396127A CN 201910215825 A CN201910215825 A CN 201910215825A CN 110396127 A CN110396127 A CN 110396127A
- Authority
- CN
- China
- Prior art keywords
- antibody
- nano antibody
- seq
- nano
- vhh
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2887—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
Abstract
The invention discloses a kind of VHH chains of the nano antibody of CD20, including framework region FR and complementary determining region CDR, disclose the amino acid sequence and complementary determining region cdr amino acid sequence of framework region FR FR selected from the group below, the invention also discloses a kind of CD20 nano antibodies, also disclose a kind of DNA molecular, it encodes the VHH chain or CD20 nano antibody of the present invention of the nano antibody of CD20 of the present invention, also disclose a kind of host cell, it can express the nano antibody of CD20, also disclose the CD20 nano antibody for detecting the purposes of CD20.Nano antibody gene order announced through the invention and host cell, the nano antibody can in Escherichia coli high efficient expression, applied to CD20 detection reagent and the research and development of bio-pharmaceuticals.
Description
Technical field
The invention belongs to biomedical or biopharmaceutical technologies, are related to being directed to the nano antibody of CD20 and its coding
Sequence.
Background technique
Prelude of the monoclonal antibody for diagnosing human disease and treatment has been pulled open in the appearance of hybridoma technology in 1975, so
And monoclonal antibody volume is big, stability is poor, and have immunogenicity, make its clinically application be subject to certain restrictions.20th century 80
After age, novel gene engineered antibody is continuously emerged, including chimeric antibody, humanized antibody, human antibody and miniaturization
Genetic engineering antibody, single domain antibody are a kind of miniaturization genetic engineering antibodies, but it stability, expression yield, protease
Still have much room for improvement in terms of repellence and polymerism.
Hamers-Casterman in 1993 is reported has found a kind of natural deletions light chain in camellid body
Antibody, i.e. heavy chain antibody, antigen binding site are only made of the variable region of heavy chain (VHH), referred to as VHH antibody, are at present may be used
With the obtained minimum Antibody molecule fragments with complete function.In general, scFv relative molecular mass is about 30KD, and
The relative molecular mass of VHH antibody is 15KD, only the 1/10 of conventional antibody, numberator height 4.8nm, diameter in 2.2nm, therefore
Also known as nano antibody (Nanobody).Compared with conventional antibody, nano antibody has many advantages: 1) molecular weight is small, can wear
Saturating blood-brain barrier is easier to act on focal zone；2) it high can be expressed in protokaryon or eukaryotic system；3) high specificity, affinity
It is high；4) high-fire resistance and chemical stability；5) weak to the immunogenicity of people.
Non-Hodgkin lymphoma (NHL) is the most common lymphoid malignancies, is apt to occur in person between twenty and fifty, wherein absolutely mostly
Number is B cell source, accounts for about 85%.CD20 molecule has expression in 95% or more B cell NHL, and antigen molecule is thin
Be easier to expose on after birth, provide easy access to, in conjunction with monoclonal antibody after without being significantly internalized by and fall off, will not because and antibody combination
And antigenic modulation occurs, therefore become the promising target for the treatment of B cell lymphoma.Someone mouse is fitted on anti-CD 20 antibodies at present
City (Rituximab-C2B8).Although Rituximab has shown that preferable curative effect in clinical treatment, still there is part
Patient reaction is not generated for the treatment of Rituximab, and it is only 10% that the drug cure rate, which is used alone, most of patient
Recurrence and resistance can be generated, and there is the potential risk for generating human anti-mouse antibody (HAMA) reaction, is based on this, we have developed
The completely new nano antibody for CD20 reduces the risk of HAMA reaction to further increase the function of antibody.
Summary of the invention
Goal of the invention: technical problem to be solved by the invention is to provide a kind of nano antibodies for CD20, mention simultaneously
The application detected for the coded sequence of the nano antibody and the nano antibody in preparation.
Technical solution: the technical solution of the present invention is as follows:
The first aspect of the present invention provides a kind of for CD20 heavy chain antibody VHH, including framework region FR and complementary determining region
CDR, the amino acid sequence of the framework region FR FR selected from the group below: shown in FR1 shown in SEQ ID NO:1, SEQ ID NO:2
FR2, FR4 shown in FR3 shown in SEQ ID NO:3, SEQ ID NO:4.
The amino acid sequence of the complementary determining region CDR CDR selected from the group below: CDR1, SEQ shown in SEQ ID NO:5
CDR3 shown in CDR2 shown in ID NO:6, SEQ ID NO:7.
Preferably, the VHH chain of the CD20 nano antibody, it has amino acid sequence shown in SEQ ID NO:8.
Second aspect of the present invention, one kind being directed to CD20 heavy chain antibody VHH, this antibody specificity identifies CD20 antigen, including
One VHH chain with amino acid sequence shown in SEQ ID NO:8.
Third aspect present invention provides a kind of DNA molecular, it encodes protein selected from the group below: of the present invention
CD20 heavy chain antibody VHH.
Preferably, the DNA molecular, which is characterized in that it has DNA sequence dna selected from the group below: SEQ ID NO:9.
The utility model has the advantages that compared with prior art, advantages of the present invention is as follows: the CD20 extracted in blood is immunized the present invention
Xinjiang one-humped camel establishes the nano antibody gene pool for being directed to CD20 followed by the camel peripheral blood lymphocytes, test
Middle that CD20 is coupled on ELISA Plate, antigen in this format screens the nano antibody base of immunity using display technique of bacteriophage
Yin Ku (camel heavy chain antibody phage display gene pool), so that the nano antibody gene for CD20 specificity is obtained, it will
This gene is gone in Escherichia coli, can be in the nano antibody strain of E. coli to establish.
Detailed description of the invention
Fig. 1 is the ideograph with the single positive colony of enzyme-linked immunoassay method (ELISA) screening specificity of bacteriophage；Wherein
1 is by CD20 albumen coupling on ELISA Plate, and 2 be nano antibody, and 3 be the anti-HA antibody of mouse, and 4 be goat-anti-mouse alkaline phosphatase
The antibody of label, 5 be alkaline phosphatase developing solution.
Fig. 2 is the CD20 nano antibody of expression, the electrophoresis of the SDS-PAGE after nickel column resin gel affinitive layer purification
Figure；Wherein swimming lane 1 is protein molecular standard, remaining swimming lane is that the nanometer that 250 mMs of imidazole elutions are eluted is anti-
Body, CD20 nano antibody passes through the purification process as the result is shown, and purity can reach 95% or more.
Fig. 3 is the tolerance detection of CD20 nano antibody at different ambient temperatures.
Specific embodiment
An Xinjiang one-humped camel is immunized using the soluble protein of CD20 as antigen first in the present invention, it is immunized by 5 times
The one-humped camel peripheral blood lymphocytes is extracted afterwards and constructs the special single domain heavy chain antibody library CD20.CD20 is coupled at
On NUNC ELISA Plate, the correct space structure of display protein matter, so that the epitope of CD20 is exposed, in this format
Antigen using display technique of bacteriophage screening CD20 immunity nano antibody gene pool (camel heavy chain antibody phage display
Gene pool), and obtaining can be in the nano antibody strain of E. coli.
Present invention will be further explained below with reference to specific examples.
Embodiment 1
It is directed to the building in the nano antibody library of CD20:
(1) synthetic antigen CD20 first, the concentration for CD20 used to be immunized is 500 μ g/mL, and being immunized every time will
0.5mgCD20 is mixed in equal volume with Freund's adjuvant, an Xinjiang one-humped camel (Jurong Sheng Long livestock culturing factory) is immunized, on every Mondays
It is secondary, it is immunized 5 times altogether, except using complete Freund's adjuvant (being purchased from sigma), residue is not helped using not formula all entirely several times for the first time
Agent (is purchased from sigma), and immunologic process moderate stimulation B cell expresses the nano antibody of antigentic specificity.After (2) 5 times immune, mention
It takes camel peripheral blood lymphocytes 100mL and extracts the RNA extracts kit that total serum IgE is provided referring to QIAGEN company.(3) according to
Super-Script III FIRST STRANDSUPERMIX kit specification, by the RNA reverse transcription of extraction at cDNA.With
The variable region fragment of nested PCR amplification heavy chain antibody:
First round PCR:
Upstream primer: GTCCTGGCTGCTCTTCTACAAGGC
Downstream primer: GGTACGTGCTGTTGAACTGTTCC
Expand the segment between heavy chain antibody guidance peptide and antibody CH2,54 DEG C of annealing, 25 circulations；The segment as the result is shown
Size is about 700bp, i.e., nano antibody gene electrophoresis band is about 700bp.
Second wheel PCR:
Make template with first round PCR product,
Upstream primer: GATGTGCAGCTGCAGGAGTCTGGRGGAGG
Downstream primer: GGACTAGTGCGGCCGCTGGAGACGGTGACCTGGGT
The segment (long segment and short-movie section) between the area heavy chain antibody FR1 and long and short hinge area is expanded, 60 DEG C of annealing, 17 are followed
Ring recycles target fragment, and the size of the segment is about 500bp as the result is shown, i.e., nano antibody gene electrophoresis band is about 500bp.
(4) using 20 μ g pComb3 Vector for Phage Display of restrictive restriction endonuclease (being purchased from NEB) PstI and NotI digestion
(Biovector supply) and 10 μ g VHH simultaneously connect two segments with T4 DNA ligase (being purchased from TaKaRa company).It (5) will be even
Object electrotransformation to electricity of practicing midwifery turns the Beijing competent cell TG1(Divine Land red autumnal leaves Science and Technology Ltd.) in, the nanometer for constructing CD20 is anti-
Body phage display library simultaneously measures storage capacity, and the size of storage capacity is 3.1 × 108.At the same time, pass through bacterium colony PCR detection primer
Using second wheel PCR primer, Tm55 DEG C.After the completion of library construction, for the insertion rate for detecting library, randomly selects 24 clones and do
Bacterium colony PCR.Insertion rate has reached 90% or more as the result is shown.
Embodiment 2
For the nano antibody screening process of CD20:
(1) CD20 for 100 μ g/mL being dissolved in PBS is coated on NUNC ELISA Plate, and 4 DEG C stand overnight, and is set up simultaneously
Negative control.200 μ L1% milk are separately added into (2) second days two holes, room temperature is closed 2 hours.After (3) 2 hours, it is added
100 μ L bacteriophages (8 × 1011Camel nano antibody phage display gene pool is immunized in tfu), it acts on 1 hour at room temperature.(4) it uses
PBST (containing 0.05% polysorbas20 in PBS) is washed 5 times, to wash off uncombined bacteriophage.(5) use triethylamine (100mM) will
Under the bacteriophage dissociation of CD20 specific binding, and the e. coli tg1 in logarithmic phase growth is infected, generates and purify
Bacteriophage is used for the screening of next round, and identical screening process repeats 2 wheels.As a result as Fig. 1 is shown: in the process constantly screened
In, positive clone will be constantly enriched with, and take CD20 in antibody library special using display technique of bacteriophage sieve to reach
The purpose of antibody.
Embodiment 3
The single positive colony of specificity is screened with the enzyme-linked immunoassay method (ELISA) of bacteriophage:
The principle modes figure of the experiment is as shown in Figure 1, specifically detect as follows:
(1) after 3-4 wheel screening in the Tissue Culture Dish containing bacteriophage, 96 single bacterium colonies is selected and are inoculated in containing 100 μ
The ampicillin of g/mL TB culture medium (in 1L TB culture medium contain 2.3g potassium dihydrogen phosphate, 12.52g dipotassium hydrogen phosphate,
12g peptone, 24g yeast extract, 4mL glycerol) in, after growing to logarithmic phase, add the IPTG of final concentration 1mmol, 28 DEG C
Overnight incubation.(2) antibody slightly is mentioned using osmosis acquisition, and antibody is transferred in the elisa plate through antigen coat, in room
Temperature is lower to place 1 hour.(3) unbonded antibody is washed away with PBST, and it is (anti-that primary antibody mouse anti-HA tag antibody is added
The anti-HA antibody of mouse is purchased from Beijing CoWin Bioscience Co., Ltd.), it places 1 hour at room temperature.(4) it is washed away with PBST
Secondary antibody anti-mouse alkaline phosphatase conjugate (goat-anti-mouse alkaline is added in unbonded antibody
Phosphatase enzyme mark antibody is purchased from Amy victory Science and Technology Ltd.), it places 1 hour at room temperature.(5) it is washed away with PBST unbonded
Antibody, alkaline phosphatase developing solution is added, on ELISA instrument, in 405nm wavelength, reads absorption value.(6) work as sample well
When OD value is greater than 3 times of control wells OD value or more, it is judged to positive colony hole.(7) bacterium in positive colony hole is turned to shake and is containing 100 μ
To extract plasmid and to be sequenced in the LB liquid of g/mL.
The gene order that each clone strain is analyzed according to sequence alignment program Vector NTI, CDR1, CDR2, CDR3 sequence phase
With strain be considered as same clone strain, and the different strain of its sequence is considered as different clone strains, finally obtains amino acid sequence SEQ ID
Nano antibody shown in NO:8.
Embodiment 4
Nano antibody is in host strain expression in escherichia coli, purifying:
(1) front sequencing analysis is obtained two kinds of nano antibodies to be subcloned into the carrier PET32a of expressivity, and will sequencing
Correct recombinant plasmid transformed is identified into expression type host strain DE3, is coated on the LB containing 100 μ g/mL ampicillins
On the plate of solid medium, 37 DEG C overnight.(2) it selects single bacterium colony and is seeded in the LB culture solution that 15mL contains ampicillin
In, 37 DEG C of shaking table cultures are stayed overnight.(3) the overnight strain of 1mL is inoculated with into 330mLLB culture medium, and 37 DEG C of shaking table cultures, culture is arrived
When OD value reaches 0.6-1, IPTG is added, 28 DEG C of shaking table cultures are stayed overnight.(4) second days, bacterium was received in centrifugation.(5) by bacterial cell disruption with
Obtain antibody crude extract.(6) through nickel column ion affinity chromatography antibody purification albumen, for the antibody for obtaining high-purity, using imidazoles
Linear gradient elution method, low concentration imidazole elution (50mmol) for washing away miscellaneous band, high concentration imidazole elution (250mmol,
Purity 500mmol) can finally be prepared up to 90% or more albumen.Band shown in Fig. 2 from left to right is respectively: first is standard
Protein molecular, the protein sample of the elution of the second the 3rd 250mmol imidazoles；The results show that nano antibody is pure by this
After change, purity can reach 95% or more.
Embodiment 5
Biotinylation nano antibody and its purification process:
(1) will be subcloned for the nano antibody genetic fragment of PIK3 to pBAD carrier, the plasmid pBAD then built with
Plasmid BirA corotation is coated on the LB culture containing ampicillin, chloramphenicol and glucose into Escherichia coli WK6
On plate, 37 DEG C of overnight incubations；(2) it selects single bacterium colony and is seeded in the LB culture solution that 5mL contains ampicillin and chloramphenicol
In, 37 DEG C of shaking table cultures are stayed overnight；(3) it is inoculated with TB culture solution of the overnight strain of 1mL to 330mL containing ampicillin and chloramphenicol
In, 37 DEG C of shaking table cultures, when culture reaches 0.4-0.5 to OD value, the D-Biotin (D-biotion) that 330 μ l50mM are added is molten
Liquid, 37 DEG C are shaken 1h slowly；(4) final concentration of 1mMIPTG is added, 28 DEG C of shaking table cultures are stayed overnight；(4) it is centrifuged, receives bacterium；(5) infiltration is utilized
Saturating method obtains antibody crude extract；(6) using the nano antibody of Streptavidin MagneSphere purifying couple biotin.
Embodiment 6
The detection of CD20 nano antibody temperature tolerance:
(1) CD20 nano antibody is respectively placed under condition of different temperatures: 25 DEG C are for 24 hours, and 30 DEG C are for 24 hours, and 37 DEG C are for 24 hours, and 45 DEG C
For 24 hours, 75 DEG C of 1h, 95 DEG C of 1h；(2) CD20 albumen is coated on ELISA Plate after carbonate is dialysed, while does blank well pair
According to (only coating NaHCO3)；(3) the CD20 nano antibody of different disposal is transferred to respectively in the elisa plate through antigen coat,
1h is placed at room temperature；(4) unbonded antibody is washed away with PBST, and primary antibody mouse anti-HA tag antibody is added
(the anti-anti- HA antibody of mouse is purchased from Beijing CoWin Bioscience Co., Ltd.), places 1h at room temperature；(5) it is washed away with PBST
Secondary antibody anti-mouse alkaline phosphatase conjugate(goat-anti-mouse alkaline is added in unbonded antibody
Phosphatase enzyme mark antibody is purchased from Amy victory Science and Technology Ltd.), 1h is placed at room temperature；(6) unbonded resist is washed away with PBST
Body is added alkaline phosphatase developing solution, is placed in ELISA microplate reader, reads absorbance value in 405nm wavelength.As a result such as Fig. 3
Shown, CD20 nano antibody has preferable temperature tolerance, and the high-temperature stability of CD20 nano antibody is also combination after us
Optical electro-chemistry immunosensor carries out high specific and highly sensitive detection provides possibility.
The above is only a preferred embodiment of the present invention, it should be pointed out that: for the ordinary skill people of the art
For member, various improvements and modifications may be made without departing from the principle of the present invention, these improvements and modifications are also answered
It is considered as protection scope of the present invention.
Sequence table
Nanjing Dong Ji Pharmaceutical Technology Co., Ltd
The preparation of anti-CD20 nano antibody
The present invention provides a CD20 nano antibody, and each nano antibody provides skeleton area and complementary determining region, wherein described
The nucleotide and amino acid sequence of skeleton area FR1, FR2, FR3, FR4 and complementary determining region CDR1, CDR2, CDR3 are respectively as follows:
CD20 nano antibody
The nucleotide sequence in skeleton area and complementary determining region:
FR1:CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCCCGGTGCAGTCTGGAGGGTCTCTGAGACTCTCCTGTGC
AGCCTCT
FR2:TGGTTCCGCCAGGCTCCAGGAAAGGAGCGCGAGGGGGTCGCAACT
FR3:GTCTACGCAGACTCCGTGAAGGGCCGATTTACCATCTCCCGAGACGACGCCAAGACGAATCTGTTTCT
GCAAATGAACAGCCTGAAACCTGAGGACAGTGCCATGTACTACTGT
FR4:TGGGGCCAGGGGACCCAGGTCACCGTCTCCTCA
CDR1:GGAAACATCTACAGTAGGCACTCCATGGGC
CDR2:ATTAATCGTGATGGCGAGATA
CDR3:GCCGCTAAACCAGGCTGGATGGCGACCCTGGCGTGGAGCGACTGGTTTTAC
The amino acid sequence in skeleton area and complementary determining region:
FRI:QVQLQESGGGPVQSGGSLRLSCAAS
FR2:WFRQAPGKEREGVAT
FR3:VYADSVKGRFTISRDDAKTNLFLQMNSLKPEDSAMYYC
FR4:WGQGTQVTVSS
CDR1:GNIYSRHSMG
CDR2:INRDGEI
CDR3:AAKPGWMATLAWSDWFY
Whole nucleotide sequence:
CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCCCGGTGCAGTCTGGAGGGTCTCTGAGACTCTCCTGTGCAGCCT
CTGGAAACATCTACAGTAGGCACTCCATGGGCTGGTTCCGCCAGGCTCCAGGAAAGGAGCGCGAGGGGGTCGCAACT
ATTAATCGTGATGGCGAGATAGTCTACGCAGACTCCGTGAAGGGCCGATTTACCATCTCCCGAGACGACGCCAAGAC
GAATCTGTTTCTGCAAATGAACAGCCTGAAACCTGAGGACAGTGCCATGTACTACTGTGCCGCTAAACCAGGCTGGA
TGGCGACCCTGGCGTGGAGCGACTGGTTTTACTGGGGCCAGGGGACCCAGGTCACCGTCTCCTCA
Whole amino acid sequence: QVQLQESGGGPVQSGGSLRLSCAASGNIYSRHSMGWFRQAPGKEREGVATINRDGE
IVYADSVKGRFTISRDDAKTNLFLQ M NSLKPEDSAMYYCAAKPGWMATLAWSDWFYWGQGTQVTVSS
Claims (5)
- The VHH chain of 1.CD20 nano antibody, including framework region FR and complementary determining region CDR, the framework region FR are selected from the group below The amino acid sequence of FR:FR3 shown in FR2 shown in FR1 shown in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO: FR4 shown in 4；The amino acid sequence of the complementary determining region CDR CDR selected from the group below:CDR3 shown in CDR2 shown in CDR1 shown in SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7.
- 2. CD20 heavy chain antibody VHH according to claim 1, it is characterised in that it has ammonia shown in SEQ ID NO:8 Base acid sequence.
- 3. the heavy chain antibody VHH of CD20 a kind of, it is characterised in that it is the nano antibody for CD20 surface antigen, including is had The VHH chain of amino acid sequence shown in SEQ ID NO:8.
- 4. a kind of DNA molecular, which is characterized in that it encodes protein selected from the group below: CD20's of any of claims 1 or 2 Heavy chain antibody VHH.
- 5. DNA molecular according to claim 4, which is characterized in that it has DNA sequence dna selected from the group below: SEQ ID NO:9.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201910215825.8A CN110396127A (en) | 2019-03-21 | 2019-03-21 | The preparation of anti-CD20 nano antibody |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201910215825.8A CN110396127A (en) | 2019-03-21 | 2019-03-21 | The preparation of anti-CD20 nano antibody |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN110396127A true CN110396127A (en) | 2019-11-01 |
Family
ID=68322410
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201910215825.8A Withdrawn CN110396127A (en) | 2019-03-21 | 2019-03-21 | The preparation of anti-CD20 nano antibody |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN110396127A (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111574629A (en) * | 2020-06-01 | 2020-08-25 | 宁夏医科大学 | CD 20-resistant nano antibody, encoding gene, recombinant nano antibody, recombinant vector, recombinant strain and application |
| CN114685664A (en) * | 2022-04-12 | 2022-07-01 | 内蒙古农业大学 | Single-domain antibody of anti-human B lymphocyte surface antigen CD20 and application thereof |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN106854244A (en) * | 2015-12-09 | 2017-06-16 | 南京东极生物科技有限公司 | A kind of nano antibody and its clinical practice for HER3 |
-
2019
- 2019-03-21 CN CN201910215825.8A patent/CN110396127A/en not_active Withdrawn
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN106854244A (en) * | 2015-12-09 | 2017-06-16 | 南京东极生物科技有限公司 | A kind of nano antibody and its clinical practice for HER3 |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111574629A (en) * | 2020-06-01 | 2020-08-25 | 宁夏医科大学 | CD 20-resistant nano antibody, encoding gene, recombinant nano antibody, recombinant vector, recombinant strain and application |
| CN111574629B (en) * | 2020-06-01 | 2021-07-20 | 宁夏医科大学 | CD 20-resistant nano antibody, encoding gene, recombinant nano antibody, recombinant vector, recombinant strain and application |
| CN114685664A (en) * | 2022-04-12 | 2022-07-01 | 内蒙古农业大学 | Single-domain antibody of anti-human B lymphocyte surface antigen CD20 and application thereof |
| CN114685664B (en) * | 2022-04-12 | 2023-10-20 | 内蒙古农业大学 | Single-domain antibody for resisting human B lymphocyte surface antigen CD20 and application thereof |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN107216389A (en) | Anti- PD-L1 nano antibodies and its coded sequence and purposes | |
| CN103421115B (en) | CD38 nanometer antibody and application | |
| CN103864927B (en) | Retinol conjugated protein (RBP) single domain antibody encoding sequence and application thereof | |
| CN110372793A (en) | The nano antibody of PD-L1 and its clinical application | |
| CN103396482B (en) | A kind of prealbumin nano antibody, its coded sequence and application | |
| CN110423277B (en) | Nano antibody of PD-1 and clinical application thereof | |
| CN110396127A (en) | The preparation of anti-CD20 nano antibody | |
| CN106478818A (en) | A kind of monoclonal antibody of specific binding tumor endothelial marker 8 and its application | |
| CN106854244B (en) | Nano antibody aiming at HER3 and clinical application thereof | |
| CN105524173B (en) | Nano antibody aiming at humanized antibody Fc fragment and application thereof | |
| CN110396128A (en) | The preparation of anti-CD19 nano antibody | |
| CN106928363B (en) | FAP nano antibody Nb12 | |
| CN103342750A (en) | Apolipoprotein B nano antibody and coding sequence and application thereof | |
| CN103833851B (en) | Be directed to single domain antibody and the application thereof of Apolipoprotein A1 | |
| CN109734804B (en) | Nano antibody aiming at H3K64Ac/H3K64 fragment and application thereof | |
| CN112321709A (en) | Macadamia nut allergen Vicilin specific nano antibody and application thereof | |
| CN107827981B (en) | The nano antibody of anti Bacillus pyocyaneu Flugge exotoxin A and its application | |
| CN106928355B (en) | CD105 nano antibody Nb184 | |
| CN106928358B (en) | CD105 nano antibody Nb168 | |
| CN115286715A (en) | CD 3-resistant nano antibody or antigen binding part thereof and preparation method thereof | |
| CN104479015A (en) | Nano antibody aiming at NGAL epitope and application thereof | |
| CN106754740A (en) | The monoclonal antibodies of mouse anti human MDR 1 and secrete the hybridoma cell strain of the monoclonal antibody | |
| CN106854246A (en) | A kind of nano antibody and its clinical practice for PI3K | |
| CN106928360B (en) | CD105 nano antibody Nb68 | |
| CN106928359B (en) | CD105 nano antibody Nb59 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WW01 | Invention patent application withdrawn after publication | ||
| WW01 | Invention patent application withdrawn after publication |
Application publication date: 20191101 |