CN109810190A - It can be used for detecting the monoclonal antibody and kit of PPR virus - Google Patents
It can be used for detecting the monoclonal antibody and kit of PPR virus Download PDFInfo
- Publication number
- CN109810190A CN109810190A CN201910275169.0A CN201910275169A CN109810190A CN 109810190 A CN109810190 A CN 109810190A CN 201910275169 A CN201910275169 A CN 201910275169A CN 109810190 A CN109810190 A CN 109810190A
- Authority
- CN
- China
- Prior art keywords
- cdr
- thr
- ser
- seq
- val
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 241000700605 Viruses Species 0.000 title claims abstract description 43
- 238000012360 testing method Methods 0.000 claims abstract description 28
- 208000007634 Peste-des-Petits-Ruminants Diseases 0.000 claims abstract description 23
- 238000009007 Diagnostic Kit Methods 0.000 claims abstract description 21
- 239000012472 biological sample Substances 0.000 claims abstract description 12
- 239000000758 substrate Substances 0.000 claims abstract description 9
- 238000001514 detection method Methods 0.000 claims description 66
- 230000000295 complement effect Effects 0.000 claims description 24
- 241001494479 Pecora Species 0.000 claims description 23
- 210000002966 serum Anatomy 0.000 claims description 22
- 241000283707 Capra Species 0.000 claims description 19
- 210000004369 blood Anatomy 0.000 claims description 5
- 239000008280 blood Substances 0.000 claims description 5
- 238000003745 diagnosis Methods 0.000 claims description 4
- 210000002381 plasma Anatomy 0.000 claims description 4
- 125000003275 alpha amino acid group Chemical group 0.000 claims 24
- 239000000523 sample Substances 0.000 description 35
- 241000283973 Oryctolagus cuniculus Species 0.000 description 34
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 30
- 239000000243 solution Substances 0.000 description 30
- 150000001413 amino acids Chemical group 0.000 description 28
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 27
- 201000010099 disease Diseases 0.000 description 25
- 238000004140 cleaning Methods 0.000 description 24
- 239000000427 antigen Substances 0.000 description 21
- 102000036639 antigens Human genes 0.000 description 21
- 108091007433 antigens Proteins 0.000 description 21
- 239000007788 liquid Substances 0.000 description 21
- 241000880493 Leptailurus serval Species 0.000 description 18
- 239000012510 hollow fiber Substances 0.000 description 18
- 238000000108 ultra-filtration Methods 0.000 description 15
- 238000002360 preparation method Methods 0.000 description 12
- 238000002965 ELISA Methods 0.000 description 10
- 238000000034 method Methods 0.000 description 10
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 9
- 229930006000 Sucrose Natural products 0.000 description 9
- 210000003719 b-lymphocyte Anatomy 0.000 description 9
- 210000004027 cell Anatomy 0.000 description 9
- 208000015181 infectious disease Diseases 0.000 description 9
- 239000013642 negative control Substances 0.000 description 9
- 229920001184 polypeptide Polymers 0.000 description 9
- 108090000765 processed proteins & peptides Proteins 0.000 description 9
- 102000004196 processed proteins & peptides Human genes 0.000 description 9
- 239000005720 sucrose Substances 0.000 description 9
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 9
- 241001465754 Metazoa Species 0.000 description 8
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 6
- 229920001213 Polysorbate 20 Polymers 0.000 description 6
- ZLFHAAGHGQBQQN-GUBZILKMSA-N Val-Ala-Pro Natural products CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O ZLFHAAGHGQBQQN-GUBZILKMSA-N 0.000 description 6
- 238000010521 absorption reaction Methods 0.000 description 6
- 230000003321 amplification Effects 0.000 description 6
- 239000012141 concentrate Substances 0.000 description 6
- 239000013604 expression vector Substances 0.000 description 6
- 230000003053 immunization Effects 0.000 description 6
- 238000003199 nucleic acid amplification method Methods 0.000 description 6
- 102000039446 nucleic acids Human genes 0.000 description 6
- 108020004707 nucleic acids Proteins 0.000 description 6
- 150000007523 nucleic acids Chemical class 0.000 description 6
- 239000002773 nucleotide Substances 0.000 description 6
- 125000003729 nucleotide group Chemical group 0.000 description 6
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 6
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 6
- 102000004169 proteins and genes Human genes 0.000 description 6
- 108090000623 proteins and genes Proteins 0.000 description 6
- 239000008213 purified water Substances 0.000 description 6
- 230000004044 response Effects 0.000 description 6
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 6
- 108010005834 tyrosyl-alanyl-glycine Proteins 0.000 description 6
- HHABWQIFXZPZCK-ACZMJKKPSA-N Cys-Gln-Ser Chemical compound C(CC(=O)N)[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CS)N HHABWQIFXZPZCK-ACZMJKKPSA-N 0.000 description 5
- ZXCAQANTQWBICD-DCAQKATOSA-N Cys-Lys-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CS)N ZXCAQANTQWBICD-DCAQKATOSA-N 0.000 description 5
- VRUFCJZQDACGLH-UVOCVTCTSA-N Thr-Leu-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VRUFCJZQDACGLH-UVOCVTCTSA-N 0.000 description 5
- 108010047857 aspartylglycine Proteins 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- XBGGUPMXALFZOT-UHFFFAOYSA-N glycyl-L-tyrosine hemihydrate Natural products NCC(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 XBGGUPMXALFZOT-UHFFFAOYSA-N 0.000 description 5
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Natural products NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 5
- 108010044311 leucyl-glycyl-glycine Proteins 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- UTYGDAHJBBDPBA-BYULHYEWSA-N Gly-Ile-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)CN UTYGDAHJBBDPBA-BYULHYEWSA-N 0.000 description 4
- ZZWUYQXMIFTIIY-WEDXCCLWSA-N Gly-Thr-Leu Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O ZZWUYQXMIFTIIY-WEDXCCLWSA-N 0.000 description 4
- 108010065920 Insulin Lispro Proteins 0.000 description 4
- VWHGTYCRDRBSFI-ZETCQYMHSA-N Leu-Gly-Gly Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)NCC(O)=O VWHGTYCRDRBSFI-ZETCQYMHSA-N 0.000 description 4
- BRTVHXHCUSXYRI-CIUDSAMLSA-N Leu-Ser-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O BRTVHXHCUSXYRI-CIUDSAMLSA-N 0.000 description 4
- LINKCQUOMUDLKN-KATARQTJSA-N Leu-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC(C)C)N)O LINKCQUOMUDLKN-KATARQTJSA-N 0.000 description 4
- QESXLSQLQHHTIX-RHYQMDGZSA-N Leu-Val-Thr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O QESXLSQLQHHTIX-RHYQMDGZSA-N 0.000 description 4
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 4
- 208000006257 Rinderpest Diseases 0.000 description 4
- MUJQWSAWLLRJCE-KATARQTJSA-N Ser-Leu-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O MUJQWSAWLLRJCE-KATARQTJSA-N 0.000 description 4
- LRZLZIUXQBIWTB-KATARQTJSA-N Ser-Lys-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LRZLZIUXQBIWTB-KATARQTJSA-N 0.000 description 4
- LLJLBRRXKZTTRD-GUBZILKMSA-N Val-Val-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)O)N LLJLBRRXKZTTRD-GUBZILKMSA-N 0.000 description 4
- 108010068265 aspartyltyrosine Proteins 0.000 description 4
- 230000003612 virological effect Effects 0.000 description 4
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 3
- WYPUMLRSQMKIJU-BPNCWPANSA-N Ala-Arg-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O WYPUMLRSQMKIJU-BPNCWPANSA-N 0.000 description 3
- MCKSLROAGSDNFC-ACZMJKKPSA-N Ala-Asp-Gln Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O MCKSLROAGSDNFC-ACZMJKKPSA-N 0.000 description 3
- WNHNMKOFKCHKKD-BFHQHQDPSA-N Ala-Thr-Gly Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O WNHNMKOFKCHKKD-BFHQHQDPSA-N 0.000 description 3
- CREYEAPXISDKSB-FQPOAREZSA-N Ala-Thr-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O CREYEAPXISDKSB-FQPOAREZSA-N 0.000 description 3
- VHAQSYHSDKERBS-XPUUQOCRSA-N Ala-Val-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O VHAQSYHSDKERBS-XPUUQOCRSA-N 0.000 description 3
- DOURAOODTFJRIC-CIUDSAMLSA-N Asn-Ser-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)N)N DOURAOODTFJRIC-CIUDSAMLSA-N 0.000 description 3
- SNDBKTFJWVEVPO-WHFBIAKZSA-N Asp-Gly-Ser Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(O)=O SNDBKTFJWVEVPO-WHFBIAKZSA-N 0.000 description 3
- RKXVTTIQNKPCHU-KKHAAJSZSA-N Asp-Val-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CC(O)=O RKXVTTIQNKPCHU-KKHAAJSZSA-N 0.000 description 3
- 101100245381 Caenorhabditis elegans pbs-6 gene Proteins 0.000 description 3
- DRXOWZZHCSBUOI-YJRXYDGGSA-N Cys-Thr-Tyr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)NC(=O)[C@H](CS)N)O DRXOWZZHCSBUOI-YJRXYDGGSA-N 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- OYTPNWYZORARHL-XHNCKOQMSA-N Gln-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCC(=O)N)N OYTPNWYZORARHL-XHNCKOQMSA-N 0.000 description 3
- STHSGOZLFLFGSS-SUSMZKCASA-N Gln-Thr-Thr Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O STHSGOZLFLFGSS-SUSMZKCASA-N 0.000 description 3
- BKMOHWJHXQLFEX-IRIUXVKKSA-N Glu-Tyr-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CCC(=O)O)N)O BKMOHWJHXQLFEX-IRIUXVKKSA-N 0.000 description 3
- YPHPEHMXOYTEQG-LAEOZQHASA-N Glu-Val-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCC(O)=O YPHPEHMXOYTEQG-LAEOZQHASA-N 0.000 description 3
- LJPIRKICOISLKN-WHFBIAKZSA-N Gly-Ala-Ser Chemical compound NCC(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O LJPIRKICOISLKN-WHFBIAKZSA-N 0.000 description 3
- PABFFPWEJMEVEC-JGVFFNPUSA-N Gly-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)CN)C(=O)O PABFFPWEJMEVEC-JGVFFNPUSA-N 0.000 description 3
- PDUHNKAFQXQNLH-ZETCQYMHSA-N Gly-Lys-Gly Chemical compound NCCCC[C@H](NC(=O)CN)C(=O)NCC(O)=O PDUHNKAFQXQNLH-ZETCQYMHSA-N 0.000 description 3
- TVTZEOHWHUVYCG-KYNKHSRBSA-N Gly-Thr-Thr Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O TVTZEOHWHUVYCG-KYNKHSRBSA-N 0.000 description 3
- CUVBTVWFVIIDOC-YEPSODPASA-N Gly-Thr-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)CN CUVBTVWFVIIDOC-YEPSODPASA-N 0.000 description 3
- BEWFWZRGBDVXRP-PEFMBERDSA-N Ile-Glu-Asn Chemical compound [H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O BEWFWZRGBDVXRP-PEFMBERDSA-N 0.000 description 3
- NUEHSWNAFIEBCQ-NAKRPEOUSA-N Ile-Val-Cys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CS)C(=O)O)N NUEHSWNAFIEBCQ-NAKRPEOUSA-N 0.000 description 3
- PMGDADKJMCOXHX-UHFFFAOYSA-N L-Arginyl-L-glutamin-acetat Natural products NC(=N)NCCCC(N)C(=O)NC(CCC(N)=O)C(O)=O PMGDADKJMCOXHX-UHFFFAOYSA-N 0.000 description 3
- PVMPDMIKUVNOBD-CIUDSAMLSA-N Leu-Asp-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O PVMPDMIKUVNOBD-CIUDSAMLSA-N 0.000 description 3
- WIDZHJTYKYBLSR-DCAQKATOSA-N Leu-Glu-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O WIDZHJTYKYBLSR-DCAQKATOSA-N 0.000 description 3
- QLDHBYRUNQZIJQ-DKIMLUQUSA-N Leu-Ile-Phe Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O QLDHBYRUNQZIJQ-DKIMLUQUSA-N 0.000 description 3
- ILDSIMPXNFWKLH-KATARQTJSA-N Leu-Thr-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O ILDSIMPXNFWKLH-KATARQTJSA-N 0.000 description 3
- LMMBAXJRYSXCOQ-ACRUOGEOSA-N Lys-Tyr-Phe Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(O)=O LMMBAXJRYSXCOQ-ACRUOGEOSA-N 0.000 description 3
- AJHCSUXXECOXOY-UHFFFAOYSA-N N-glycyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)CN)C(O)=O)=CNC2=C1 AJHCSUXXECOXOY-UHFFFAOYSA-N 0.000 description 3
- HXSUFWQYLPKEHF-IHRRRGAJSA-N Phe-Asn-Arg Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N HXSUFWQYLPKEHF-IHRRRGAJSA-N 0.000 description 3
- ODPIUQVTULPQEP-CIUDSAMLSA-N Pro-Gln-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@@H]1CCCN1 ODPIUQVTULPQEP-CIUDSAMLSA-N 0.000 description 3
- HAAQQNHQZBOWFO-LURJTMIESA-N Pro-Gly-Gly Chemical compound OC(=O)CNC(=O)CNC(=O)[C@@H]1CCCN1 HAAQQNHQZBOWFO-LURJTMIESA-N 0.000 description 3
- KDBHVPXBQADZKY-GUBZILKMSA-N Pro-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 KDBHVPXBQADZKY-GUBZILKMSA-N 0.000 description 3
- PCWLNNZTBJTZRN-AVGNSLFASA-N Pro-Pro-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 PCWLNNZTBJTZRN-AVGNSLFASA-N 0.000 description 3
- CXGLFEOYCJFKPR-RCWTZXSCSA-N Pro-Thr-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O CXGLFEOYCJFKPR-RCWTZXSCSA-N 0.000 description 3
- XDKKMRPRRCOELJ-GUBZILKMSA-N Pro-Val-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)[C@@H]1CCCN1 XDKKMRPRRCOELJ-GUBZILKMSA-N 0.000 description 3
- LVVBAKCGXXUHFO-ZLUOBGJFSA-N Ser-Ala-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O LVVBAKCGXXUHFO-ZLUOBGJFSA-N 0.000 description 3
- QVOGDCQNGLBNCR-FXQIFTODSA-N Ser-Arg-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(O)=O QVOGDCQNGLBNCR-FXQIFTODSA-N 0.000 description 3
- ICHZYBVODUVUKN-SRVKXCTJSA-N Ser-Asn-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O ICHZYBVODUVUKN-SRVKXCTJSA-N 0.000 description 3
- YMTLKLXDFCSCNX-BYPYZUCNSA-N Ser-Gly-Gly Chemical compound OC[C@H](N)C(=O)NCC(=O)NCC(O)=O YMTLKLXDFCSCNX-BYPYZUCNSA-N 0.000 description 3
- 239000006180 TBST buffer Substances 0.000 description 3
- UHBPFYOQQPFKQR-JHEQGTHGSA-N Thr-Gln-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O UHBPFYOQQPFKQR-JHEQGTHGSA-N 0.000 description 3
- RCEHMXVEMNXRIW-IRIUXVKKSA-N Thr-Gln-Tyr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)N)O RCEHMXVEMNXRIW-IRIUXVKKSA-N 0.000 description 3
- NCXVJIQMWSGRHY-KXNHARMFSA-N Thr-Leu-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@@H]1C(=O)O)N)O NCXVJIQMWSGRHY-KXNHARMFSA-N 0.000 description 3
- WPSKTVVMQCXPRO-BWBBJGPYSA-N Thr-Ser-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O WPSKTVVMQCXPRO-BWBBJGPYSA-N 0.000 description 3
- ZMYCLHFLHRVOEA-HEIBUPTGSA-N Thr-Thr-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O ZMYCLHFLHRVOEA-HEIBUPTGSA-N 0.000 description 3
- MNYNCKZAEIAONY-XGEHTFHBSA-N Thr-Val-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O MNYNCKZAEIAONY-XGEHTFHBSA-N 0.000 description 3
- KZTLZZQTJMCGIP-ZJDVBMNYSA-N Thr-Val-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KZTLZZQTJMCGIP-ZJDVBMNYSA-N 0.000 description 3
- MBLJBGZWLHTJBH-SZMVWBNQSA-N Trp-Val-Arg Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O)=CNC2=C1 MBLJBGZWLHTJBH-SZMVWBNQSA-N 0.000 description 3
- UEOOXDLMQZBPFR-ZKWXMUAHSA-N Val-Ala-Asn Chemical compound C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](C(C)C)N UEOOXDLMQZBPFR-ZKWXMUAHSA-N 0.000 description 3
- UEXPMFIAZZHEAD-HSHDSVGOSA-N Val-Thr-Trp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](C(C)C)N)O UEXPMFIAZZHEAD-HSHDSVGOSA-N 0.000 description 3
- VVIZITNVZUAEMI-DLOVCJGASA-N Val-Val-Gln Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCC(N)=O VVIZITNVZUAEMI-DLOVCJGASA-N 0.000 description 3
- 230000010530 Virus Neutralization Effects 0.000 description 3
- 108010069020 alanyl-prolyl-glycine Proteins 0.000 description 3
- 108010086434 alanyl-seryl-glycine Proteins 0.000 description 3
- 108010050025 alpha-glutamyltryptophan Proteins 0.000 description 3
- 108010008355 arginyl-glutamine Proteins 0.000 description 3
- 108010006195 arginyl-glycyl-aspartyl-cysteine Proteins 0.000 description 3
- 108010029539 arginyl-prolyl-proline Proteins 0.000 description 3
- 108010059459 arginyl-threonyl-phenylalanine Proteins 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 239000012501 chromatography medium Substances 0.000 description 3
- 238000005352 clarification Methods 0.000 description 3
- 239000002872 contrast media Substances 0.000 description 3
- 238000007796 conventional method Methods 0.000 description 3
- 238000000432 density-gradient centrifugation Methods 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 238000001962 electrophoresis Methods 0.000 description 3
- 230000004907 flux Effects 0.000 description 3
- 238000001641 gel filtration chromatography Methods 0.000 description 3
- 108010062266 glycyl-glycyl-argininal Proteins 0.000 description 3
- 108010050475 glycyl-leucyl-tyrosine Proteins 0.000 description 3
- 108010010147 glycylglutamine Proteins 0.000 description 3
- 108010015792 glycyllysine Proteins 0.000 description 3
- 108010084389 glycyltryptophan Proteins 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 238000003384 imaging method Methods 0.000 description 3
- 210000003000 inclusion body Anatomy 0.000 description 3
- 238000011068 loading method Methods 0.000 description 3
- 238000005374 membrane filtration Methods 0.000 description 3
- 210000004400 mucous membrane Anatomy 0.000 description 3
- 210000005259 peripheral blood Anatomy 0.000 description 3
- 239000011886 peripheral blood Substances 0.000 description 3
- 239000002574 poison Substances 0.000 description 3
- 231100000614 poison Toxicity 0.000 description 3
- 230000001376 precipitating effect Effects 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 108010020755 prolyl-glycyl-glycine Proteins 0.000 description 3
- 108010093296 prolyl-prolyl-alanine Proteins 0.000 description 3
- 108010090894 prolylleucine Proteins 0.000 description 3
- 108010053725 prolylvaline Proteins 0.000 description 3
- 238000001742 protein purification Methods 0.000 description 3
- 238000003908 quality control method Methods 0.000 description 3
- 239000012898 sample dilution Substances 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 108010048397 seryl-lysyl-leucine Proteins 0.000 description 3
- 239000007790 solid phase Substances 0.000 description 3
- 208000003265 stomatitis Diseases 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 108010061238 threonyl-glycine Proteins 0.000 description 3
- 238000010200 validation analysis Methods 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- 238000009736 wetting Methods 0.000 description 3
- QMOQBVOBWVNSNO-UHFFFAOYSA-N 2-[[2-[[2-[(2-azaniumylacetyl)amino]acetyl]amino]acetyl]amino]acetate Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(O)=O QMOQBVOBWVNSNO-UHFFFAOYSA-N 0.000 description 2
- MPLOSMWGDNJSEV-WHFBIAKZSA-N Ala-Gly-Asp Chemical compound [H]N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O MPLOSMWGDNJSEV-WHFBIAKZSA-N 0.000 description 2
- LTSBJNNXPBBNDT-HGNGGELXSA-N Ala-His-Gln Chemical compound N[C@@H](C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)O LTSBJNNXPBBNDT-HGNGGELXSA-N 0.000 description 2
- DYJJJCHDHLEFDW-FXQIFTODSA-N Ala-Pro-Cys Chemical compound C[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)O)N DYJJJCHDHLEFDW-FXQIFTODSA-N 0.000 description 2
- XWFWAXPOLRTDFZ-FXQIFTODSA-N Ala-Pro-Ser Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O XWFWAXPOLRTDFZ-FXQIFTODSA-N 0.000 description 2
- GCTANJIJJROSLH-GVARAGBVSA-N Ala-Tyr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](C)N GCTANJIJJROSLH-GVARAGBVSA-N 0.000 description 2
- BEXGZLUHRXTZCC-CIUDSAMLSA-N Arg-Gln-Ser Chemical compound C(C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CO)C(=O)O)N)CN=C(N)N BEXGZLUHRXTZCC-CIUDSAMLSA-N 0.000 description 2
- PHHRSPBBQUFULD-UWVGGRQHSA-N Arg-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CCCN=C(N)N)N PHHRSPBBQUFULD-UWVGGRQHSA-N 0.000 description 2
- ICRHGPYYXMWHIE-LPEHRKFASA-N Arg-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O ICRHGPYYXMWHIE-LPEHRKFASA-N 0.000 description 2
- LJUOLNXOWSWGKF-ACZMJKKPSA-N Asn-Asn-Glu Chemical compound C(CC(=O)O)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)N)N LJUOLNXOWSWGKF-ACZMJKKPSA-N 0.000 description 2
- ZPMNECSEJXXNBE-CIUDSAMLSA-N Asn-Cys-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(O)=O ZPMNECSEJXXNBE-CIUDSAMLSA-N 0.000 description 2
- RCFGLXMZDYNRSC-CIUDSAMLSA-N Asn-Lys-Ala Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O RCFGLXMZDYNRSC-CIUDSAMLSA-N 0.000 description 2
- KRXIWXCXOARFNT-ZLUOBGJFSA-N Asp-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O KRXIWXCXOARFNT-ZLUOBGJFSA-N 0.000 description 2
- RYEWQKQXRJCHIO-SRVKXCTJSA-N Asp-Asn-Tyr Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 RYEWQKQXRJCHIO-SRVKXCTJSA-N 0.000 description 2
- OMMIEVATLAGRCK-BYPYZUCNSA-N Asp-Gly-Gly Chemical compound OC(=O)C[C@H](N)C(=O)NCC(=O)NCC(O)=O OMMIEVATLAGRCK-BYPYZUCNSA-N 0.000 description 2
- KLYPOCBLKMPBIQ-GHCJXIJMSA-N Asp-Ile-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CC(=O)O)N KLYPOCBLKMPBIQ-GHCJXIJMSA-N 0.000 description 2
- DONWIPDSZZJHHK-HJGDQZAQSA-N Asp-Lys-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)N)O DONWIPDSZZJHHK-HJGDQZAQSA-N 0.000 description 2
- AHWRSSLYSGLBGD-CIUDSAMLSA-N Asp-Pro-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O AHWRSSLYSGLBGD-CIUDSAMLSA-N 0.000 description 2
- YIDFBWRHIYOYAA-LKXGYXEUSA-N Asp-Ser-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O YIDFBWRHIYOYAA-LKXGYXEUSA-N 0.000 description 2
- RSMZEHCMIOKNMW-GSSVUCPTSA-N Asp-Thr-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O RSMZEHCMIOKNMW-GSSVUCPTSA-N 0.000 description 2
- YUELDQUPTAYEGM-XIRDDKMYSA-N Asp-Trp-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)[C@H](CC(=O)O)N YUELDQUPTAYEGM-XIRDDKMYSA-N 0.000 description 2
- SFJUYBCDQBAYAJ-YDHLFZDLSA-N Asp-Val-Phe Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 SFJUYBCDQBAYAJ-YDHLFZDLSA-N 0.000 description 2
- GUKYYUFHWYRMEU-WHFBIAKZSA-N Cys-Gly-Asp Chemical compound [H]N[C@@H](CS)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O GUKYYUFHWYRMEU-WHFBIAKZSA-N 0.000 description 2
- KSMSFCBQBQPFAD-GUBZILKMSA-N Cys-Pro-Pro Chemical compound SC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 KSMSFCBQBQPFAD-GUBZILKMSA-N 0.000 description 2
- AZDQAZRURQMSQD-XPUUQOCRSA-N Cys-Val-Gly Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O AZDQAZRURQMSQD-XPUUQOCRSA-N 0.000 description 2
- ALTQTAKGRFLRLR-GUBZILKMSA-N Cys-Val-Val Chemical compound CC(C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)O)NC(=O)[C@H](CS)N ALTQTAKGRFLRLR-GUBZILKMSA-N 0.000 description 2
- 206010011732 Cyst Diseases 0.000 description 2
- 206010012735 Diarrhoea Diseases 0.000 description 2
- UZMWDBOHAOSCCH-ACZMJKKPSA-N Gln-Cys-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@@H](N)CCC(N)=O UZMWDBOHAOSCCH-ACZMJKKPSA-N 0.000 description 2
- NVEASDQHBRZPSU-BQBZGAKWSA-N Gln-Gln-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O NVEASDQHBRZPSU-BQBZGAKWSA-N 0.000 description 2
- MADFVRSKEIEZHZ-DCAQKATOSA-N Gln-Gln-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCC(=O)N)N MADFVRSKEIEZHZ-DCAQKATOSA-N 0.000 description 2
- MFORDNZDKAVNSR-SRVKXCTJSA-N Gln-Pro-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCC(N)=O MFORDNZDKAVNSR-SRVKXCTJSA-N 0.000 description 2
- YPFFHGRJCUBXPX-NHCYSSNCSA-N Gln-Pro-Val Chemical compound CC(C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCC(N)=O)C(O)=O YPFFHGRJCUBXPX-NHCYSSNCSA-N 0.000 description 2
- OACPJRQRAHMQEQ-NHCYSSNCSA-N Gln-Val-Arg Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O OACPJRQRAHMQEQ-NHCYSSNCSA-N 0.000 description 2
- ITYRYNUZHPNCIK-GUBZILKMSA-N Glu-Ala-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O ITYRYNUZHPNCIK-GUBZILKMSA-N 0.000 description 2
- SBCYJMOOHUDWDA-NUMRIWBASA-N Glu-Asp-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SBCYJMOOHUDWDA-NUMRIWBASA-N 0.000 description 2
- XHWLNISLUFEWNS-CIUDSAMLSA-N Glu-Gln-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O XHWLNISLUFEWNS-CIUDSAMLSA-N 0.000 description 2
- FBEJIDRSQCGFJI-GUBZILKMSA-N Glu-Leu-Ser Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O FBEJIDRSQCGFJI-GUBZILKMSA-N 0.000 description 2
- SWRVAQHFBRZVNX-GUBZILKMSA-N Glu-Lys-Asn Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O SWRVAQHFBRZVNX-GUBZILKMSA-N 0.000 description 2
- ZIYGTCDTJJCDDP-JYJNAYRXSA-N Glu-Phe-Lys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N ZIYGTCDTJJCDDP-JYJNAYRXSA-N 0.000 description 2
- KRRMJKMGWWXWDW-STQMWFEESA-N Gly-Arg-Phe Chemical compound NC(=N)NCCC[C@H](NC(=O)CN)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 KRRMJKMGWWXWDW-STQMWFEESA-N 0.000 description 2
- INLIXXRWNUKVCF-JTQLQIEISA-N Gly-Gly-Tyr Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 INLIXXRWNUKVCF-JTQLQIEISA-N 0.000 description 2
- AAHSHTLISQUZJL-QSFUFRPTSA-N Gly-Ile-Ile Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O AAHSHTLISQUZJL-QSFUFRPTSA-N 0.000 description 2
- VBOBNHSVQKKTOT-YUMQZZPRSA-N Gly-Lys-Ala Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O VBOBNHSVQKKTOT-YUMQZZPRSA-N 0.000 description 2
- SOEGEPHNZOISMT-BYPYZUCNSA-N Gly-Ser-Gly Chemical compound NCC(=O)N[C@@H](CO)C(=O)NCC(O)=O SOEGEPHNZOISMT-BYPYZUCNSA-N 0.000 description 2
- DBUNZBWUWCIELX-JHEQGTHGSA-N Gly-Thr-Glu Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O DBUNZBWUWCIELX-JHEQGTHGSA-N 0.000 description 2
- RIYIFUFFFBIOEU-KBPBESRZSA-N Gly-Tyr-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CC1=CC=C(O)C=C1 RIYIFUFFFBIOEU-KBPBESRZSA-N 0.000 description 2
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 2
- WMKXFMUJRCEGRP-SRVKXCTJSA-N His-Asn-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N WMKXFMUJRCEGRP-SRVKXCTJSA-N 0.000 description 2
- UAVQIQOOBXFKRC-BYULHYEWSA-N Ile-Asn-Gly Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O UAVQIQOOBXFKRC-BYULHYEWSA-N 0.000 description 2
- GYAFMRQGWHXMII-IUKAMOBKSA-N Ile-Asp-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N GYAFMRQGWHXMII-IUKAMOBKSA-N 0.000 description 2
- JZNVOBUNTWNZPW-GHCJXIJMSA-N Ile-Ser-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)O)N JZNVOBUNTWNZPW-GHCJXIJMSA-N 0.000 description 2
- OGCQGUIWMSBHRZ-CIUDSAMLSA-N Leu-Asn-Ser Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O OGCQGUIWMSBHRZ-CIUDSAMLSA-N 0.000 description 2
- OGUUKPXUTHOIAV-SDDRHHMPSA-N Leu-Glu-Pro Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N1CCC[C@@H]1C(=O)O)N OGUUKPXUTHOIAV-SDDRHHMPSA-N 0.000 description 2
- LLBQJYDYOLIQAI-JYJNAYRXSA-N Leu-Glu-Tyr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O LLBQJYDYOLIQAI-JYJNAYRXSA-N 0.000 description 2
- QJUWBDPGGYVRHY-YUMQZZPRSA-N Leu-Gly-Cys Chemical compound CC(C)C[C@@H](C(=O)NCC(=O)N[C@@H](CS)C(=O)O)N QJUWBDPGGYVRHY-YUMQZZPRSA-N 0.000 description 2
- NRFGTHFONZYFNY-MGHWNKPDSA-N Leu-Ile-Tyr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 NRFGTHFONZYFNY-MGHWNKPDSA-N 0.000 description 2
- AUNMOHYWTAPQLA-XUXIUFHCSA-N Leu-Met-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O AUNMOHYWTAPQLA-XUXIUFHCSA-N 0.000 description 2
- WMIOEVKKYIMVKI-DCAQKATOSA-N Leu-Pro-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O WMIOEVKKYIMVKI-DCAQKATOSA-N 0.000 description 2
- GZRABTMNWJXFMH-UVOCVTCTSA-N Leu-Thr-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O GZRABTMNWJXFMH-UVOCVTCTSA-N 0.000 description 2
- YQFZRHYZLARWDY-IHRRRGAJSA-N Leu-Val-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCCCN YQFZRHYZLARWDY-IHRRRGAJSA-N 0.000 description 2
- KWUKZRFFKPLUPE-HJGDQZAQSA-N Lys-Asp-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KWUKZRFFKPLUPE-HJGDQZAQSA-N 0.000 description 2
- FHIAJWBDZVHLAH-YUMQZZPRSA-N Lys-Gly-Ser Chemical compound NCCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O FHIAJWBDZVHLAH-YUMQZZPRSA-N 0.000 description 2
- DLCAXBGXGOVUCD-PPCPHDFISA-N Lys-Thr-Ile Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O DLCAXBGXGOVUCD-PPCPHDFISA-N 0.000 description 2
- RMOKGALPSPOYKE-KATARQTJSA-N Lys-Thr-Ser Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O RMOKGALPSPOYKE-KATARQTJSA-N 0.000 description 2
- CAVRAQIDHUPECU-UVOCVTCTSA-N Lys-Thr-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CAVRAQIDHUPECU-UVOCVTCTSA-N 0.000 description 2
- HMZPYMSEAALNAE-ULQDDVLXSA-N Lys-Val-Tyr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O HMZPYMSEAALNAE-ULQDDVLXSA-N 0.000 description 2
- GWADARYJIJDYRC-XGEHTFHBSA-N Met-Thr-Ser Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O GWADARYJIJDYRC-XGEHTFHBSA-N 0.000 description 2
- 108010079364 N-glycylalanine Proteins 0.000 description 2
- CDNPIRSCAFMMBE-SRVKXCTJSA-N Phe-Asn-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O CDNPIRSCAFMMBE-SRVKXCTJSA-N 0.000 description 2
- UEHNWRNADDPYNK-DLOVCJGASA-N Phe-Cys-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CC1=CC=CC=C1)N UEHNWRNADDPYNK-DLOVCJGASA-N 0.000 description 2
- NAXPHWZXEXNDIW-JTQLQIEISA-N Phe-Gly-Gly Chemical compound OC(=O)CNC(=O)CNC(=O)[C@@H](N)CC1=CC=CC=C1 NAXPHWZXEXNDIW-JTQLQIEISA-N 0.000 description 2
- BWTKUQPNOMMKMA-FIRPJDEBSA-N Phe-Ile-Phe Chemical compound C([C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 BWTKUQPNOMMKMA-FIRPJDEBSA-N 0.000 description 2
- KNYPNEYICHHLQL-ACRUOGEOSA-N Phe-Leu-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 KNYPNEYICHHLQL-ACRUOGEOSA-N 0.000 description 2
- KAJLHCWRWDSROH-BZSNNMDCSA-N Phe-Phe-Asp Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(O)=O)C(O)=O)C1=CC=CC=C1 KAJLHCWRWDSROH-BZSNNMDCSA-N 0.000 description 2
- WWPAHTZOWURIMR-ULQDDVLXSA-N Phe-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC1=CC=CC=C1 WWPAHTZOWURIMR-ULQDDVLXSA-N 0.000 description 2
- NJJBATPLUQHRBM-IHRRRGAJSA-N Phe-Pro-Ser Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CC2=CC=CC=C2)N)C(=O)N[C@@H](CO)C(=O)O NJJBATPLUQHRBM-IHRRRGAJSA-N 0.000 description 2
- HFZNNDWPHBRNPV-KZVJFYERSA-N Pro-Ala-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O HFZNNDWPHBRNPV-KZVJFYERSA-N 0.000 description 2
- OOLOTUZJUBOMAX-GUBZILKMSA-N Pro-Ala-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(O)=O OOLOTUZJUBOMAX-GUBZILKMSA-N 0.000 description 2
- NXEYSLRNNPWCRN-SRVKXCTJSA-N Pro-Glu-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O NXEYSLRNNPWCRN-SRVKXCTJSA-N 0.000 description 2
- LGSANCBHSMDFDY-GARJFASQSA-N Pro-Glu-Pro Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CCC(=O)O)C(=O)N2CCC[C@@H]2C(=O)O LGSANCBHSMDFDY-GARJFASQSA-N 0.000 description 2
- VPEVBAUSTBWQHN-NHCYSSNCSA-N Pro-Glu-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O VPEVBAUSTBWQHN-NHCYSSNCSA-N 0.000 description 2
- JMVQDLDPDBXAAX-YUMQZZPRSA-N Pro-Gly-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 JMVQDLDPDBXAAX-YUMQZZPRSA-N 0.000 description 2
- KWMUAKQOVYCQJQ-ZPFDUUQYSA-N Pro-Ile-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@@H]1CCCN1 KWMUAKQOVYCQJQ-ZPFDUUQYSA-N 0.000 description 2
- ULWBBFKQBDNGOY-RWMBFGLXSA-N Pro-Lys-Pro Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CCCCN)C(=O)N2CCC[C@@H]2C(=O)O ULWBBFKQBDNGOY-RWMBFGLXSA-N 0.000 description 2
- JLMZKEQFMVORMA-SRVKXCTJSA-N Pro-Pro-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 JLMZKEQFMVORMA-SRVKXCTJSA-N 0.000 description 2
- CGSOWZUPLOKYOR-AVGNSLFASA-N Pro-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 CGSOWZUPLOKYOR-AVGNSLFASA-N 0.000 description 2
- GOMUXSCOIWIJFP-GUBZILKMSA-N Pro-Ser-Arg Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O GOMUXSCOIWIJFP-GUBZILKMSA-N 0.000 description 2
- PRKWBYCXBBSLSK-GUBZILKMSA-N Pro-Ser-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O PRKWBYCXBBSLSK-GUBZILKMSA-N 0.000 description 2
- 206010037660 Pyrexia Diseases 0.000 description 2
- 241000711897 Rinderpest morbillivirus Species 0.000 description 2
- 241000282849 Ruminantia Species 0.000 description 2
- OYEDZGNMSBZCIM-XGEHTFHBSA-N Ser-Arg-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OYEDZGNMSBZCIM-XGEHTFHBSA-N 0.000 description 2
- ULVMNZOKDBHKKI-ACZMJKKPSA-N Ser-Gln-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O ULVMNZOKDBHKKI-ACZMJKKPSA-N 0.000 description 2
- FMDHKPRACUXATF-ACZMJKKPSA-N Ser-Gln-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O FMDHKPRACUXATF-ACZMJKKPSA-N 0.000 description 2
- GZFAWAQTEYDKII-YUMQZZPRSA-N Ser-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CO GZFAWAQTEYDKII-YUMQZZPRSA-N 0.000 description 2
- XXXAXOWMBOKTRN-XPUUQOCRSA-N Ser-Gly-Val Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O XXXAXOWMBOKTRN-XPUUQOCRSA-N 0.000 description 2
- UIPXCLNLUUAMJU-JBDRJPRFSA-N Ser-Ile-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O UIPXCLNLUUAMJU-JBDRJPRFSA-N 0.000 description 2
- GZSZPKSBVAOGIE-CIUDSAMLSA-N Ser-Lys-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O GZSZPKSBVAOGIE-CIUDSAMLSA-N 0.000 description 2
- XUDRHBPSPAPDJP-SRVKXCTJSA-N Ser-Lys-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CO XUDRHBPSPAPDJP-SRVKXCTJSA-N 0.000 description 2
- PTWIYDNFWPXQSD-GARJFASQSA-N Ser-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)N)C(=O)O PTWIYDNFWPXQSD-GARJFASQSA-N 0.000 description 2
- XQJCEKXQUJQNNK-ZLUOBGJFSA-N Ser-Ser-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O XQJCEKXQUJQNNK-ZLUOBGJFSA-N 0.000 description 2
- PYTKULIABVRXSC-BWBBJGPYSA-N Ser-Ser-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O PYTKULIABVRXSC-BWBBJGPYSA-N 0.000 description 2
- VGQVAVQWKJLIRM-FXQIFTODSA-N Ser-Ser-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O VGQVAVQWKJLIRM-FXQIFTODSA-N 0.000 description 2
- SOACHCFYJMCMHC-BWBBJGPYSA-N Ser-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CO)N)O SOACHCFYJMCMHC-BWBBJGPYSA-N 0.000 description 2
- VLMIUSLQONKLDV-HEIBUPTGSA-N Ser-Thr-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VLMIUSLQONKLDV-HEIBUPTGSA-N 0.000 description 2
- BDMWLJLPPUCLNV-XGEHTFHBSA-N Ser-Thr-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O BDMWLJLPPUCLNV-XGEHTFHBSA-N 0.000 description 2
- STIAINRLUUKYKM-WFBYXXMGSA-N Ser-Trp-Ala Chemical compound C1=CC=C2C(C[C@@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@@H](N)CO)=CNC2=C1 STIAINRLUUKYKM-WFBYXXMGSA-N 0.000 description 2
- RTXKJFWHEBTABY-IHPCNDPISA-N Ser-Trp-Tyr Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)O)NC(=O)[C@H](CO)N RTXKJFWHEBTABY-IHPCNDPISA-N 0.000 description 2
- BEBVVQPDSHHWQL-NRPADANISA-N Ser-Val-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O BEBVVQPDSHHWQL-NRPADANISA-N 0.000 description 2
- ANOQEBQWIAYIMV-AEJSXWLSSA-N Ser-Val-Pro Chemical compound CC(C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CO)N ANOQEBQWIAYIMV-AEJSXWLSSA-N 0.000 description 2
- MQCPGOZXFSYJPS-KZVJFYERSA-N Thr-Ala-Arg Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O MQCPGOZXFSYJPS-KZVJFYERSA-N 0.000 description 2
- TZKPNGDGUVREEB-FOHZUACHSA-N Thr-Asn-Gly Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O TZKPNGDGUVREEB-FOHZUACHSA-N 0.000 description 2
- ODSAPYVQSLDRSR-LKXGYXEUSA-N Thr-Cys-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(O)=O ODSAPYVQSLDRSR-LKXGYXEUSA-N 0.000 description 2
- NRBUKAHTWRCUEQ-XGEHTFHBSA-N Thr-Cys-Met Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCSC)C(O)=O NRBUKAHTWRCUEQ-XGEHTFHBSA-N 0.000 description 2
- MMTOHPRBJKEZHT-BWBBJGPYSA-N Thr-Cys-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(O)=O MMTOHPRBJKEZHT-BWBBJGPYSA-N 0.000 description 2
- LAFLAXHTDVNVEL-WDCWCFNPSA-N Thr-Gln-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCCCN)C(=O)O)N)O LAFLAXHTDVNVEL-WDCWCFNPSA-N 0.000 description 2
- OQCXTUQTKQFDCX-HTUGSXCWSA-N Thr-Glu-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N)O OQCXTUQTKQFDCX-HTUGSXCWSA-N 0.000 description 2
- WPAKPLPGQNUXGN-OSUNSFLBSA-N Thr-Ile-Arg Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O WPAKPLPGQNUXGN-OSUNSFLBSA-N 0.000 description 2
- PAXANSWUSVPFNK-IUKAMOBKSA-N Thr-Ile-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H]([C@@H](C)O)N PAXANSWUSVPFNK-IUKAMOBKSA-N 0.000 description 2
- BVOVIGCHYNFJBZ-JXUBOQSCSA-N Thr-Leu-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O BVOVIGCHYNFJBZ-JXUBOQSCSA-N 0.000 description 2
- DXPURPNJDFCKKO-RHYQMDGZSA-N Thr-Lys-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)[C@@H](C)O)C(O)=O DXPURPNJDFCKKO-RHYQMDGZSA-N 0.000 description 2
- QHUWWSQZTFLXPQ-FJXKBIBVSA-N Thr-Met-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)NCC(O)=O QHUWWSQZTFLXPQ-FJXKBIBVSA-N 0.000 description 2
- WTMPKZWHRCMMMT-KZVJFYERSA-N Thr-Pro-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O WTMPKZWHRCMMMT-KZVJFYERSA-N 0.000 description 2
- KERCOYANYUPLHJ-XGEHTFHBSA-N Thr-Pro-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O KERCOYANYUPLHJ-XGEHTFHBSA-N 0.000 description 2
- XHWCDRUPDNSDAZ-XKBZYTNZSA-N Thr-Ser-Glu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N)O XHWCDRUPDNSDAZ-XKBZYTNZSA-N 0.000 description 2
- SGAOHNPSEPVAFP-ZDLURKLDSA-N Thr-Ser-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)NCC(O)=O SGAOHNPSEPVAFP-ZDLURKLDSA-N 0.000 description 2
- YOPQYBJJNSIQGZ-JNPHEJMOSA-N Thr-Tyr-Tyr Chemical compound C([C@H](NC(=O)[C@@H](N)[C@H](O)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 YOPQYBJJNSIQGZ-JNPHEJMOSA-N 0.000 description 2
- UKINEYBQXPMOJO-UBHSHLNASA-N Trp-Asn-Ser Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)O)N UKINEYBQXPMOJO-UBHSHLNASA-N 0.000 description 2
- XZLHHHYSWIYXHD-XIRDDKMYSA-N Trp-Gln-Arg Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O XZLHHHYSWIYXHD-XIRDDKMYSA-N 0.000 description 2
- ZPZNQAZHMCLTOA-PXDAIIFMSA-N Trp-Tyr-Ile Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CC=C(O)C=C1 ZPZNQAZHMCLTOA-PXDAIIFMSA-N 0.000 description 2
- PCXFIOFKIMNHGR-UHFFFAOYSA-N Tyr Trp Gly Ser Chemical compound C=1NC2=CC=CC=C2C=1CC(C(=O)NCC(=O)NC(CO)C(O)=O)NC(=O)C(N)CC1=CC=C(O)C=C1 PCXFIOFKIMNHGR-UHFFFAOYSA-N 0.000 description 2
- DLZKEQQWXODGGZ-KWQFWETISA-N Tyr-Ala-Gly Chemical compound OC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 DLZKEQQWXODGGZ-KWQFWETISA-N 0.000 description 2
- PZXUIGWOEWWFQM-SRVKXCTJSA-N Tyr-Asn-Asn Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O PZXUIGWOEWWFQM-SRVKXCTJSA-N 0.000 description 2
- JXGUUJMPCRXMSO-HJOGWXRNSA-N Tyr-Phe-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=C(O)C=C1 JXGUUJMPCRXMSO-HJOGWXRNSA-N 0.000 description 2
- YYLHVUCSTXXKBS-IHRRRGAJSA-N Tyr-Pro-Ser Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O YYLHVUCSTXXKBS-IHRRRGAJSA-N 0.000 description 2
- MQGGXGKQSVEQHR-KKUMJFAQSA-N Tyr-Ser-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 MQGGXGKQSVEQHR-KKUMJFAQSA-N 0.000 description 2
- MWUYSCVVPVITMW-IGNZVWTISA-N Tyr-Tyr-Ala Chemical compound C([C@@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 MWUYSCVVPVITMW-IGNZVWTISA-N 0.000 description 2
- REJBPZVUHYNMEN-LSJOCFKGSA-N Val-Ala-His Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](C(C)C)N REJBPZVUHYNMEN-LSJOCFKGSA-N 0.000 description 2
- ZLFHAAGHGQBQQN-AEJSXWLSSA-N Val-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](C(C)C)N ZLFHAAGHGQBQQN-AEJSXWLSSA-N 0.000 description 2
- DNOOLPROHJWCSQ-RCWTZXSCSA-N Val-Arg-Thr Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O DNOOLPROHJWCSQ-RCWTZXSCSA-N 0.000 description 2
- TZVUSFMQWPWHON-NHCYSSNCSA-N Val-Asp-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C(C)C)N TZVUSFMQWPWHON-NHCYSSNCSA-N 0.000 description 2
- SCBITHMBEJNRHC-LSJOCFKGSA-N Val-Asp-Val Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C(C)C)C(=O)O)N SCBITHMBEJNRHC-LSJOCFKGSA-N 0.000 description 2
- JXGWQYWDUOWQHA-DZKIICNBSA-N Val-Gln-Phe Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N JXGWQYWDUOWQHA-DZKIICNBSA-N 0.000 description 2
- RKIGNDAHUOOIMJ-BQFCYCMXSA-N Val-Glu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)C(C)C)C(O)=O)=CNC2=C1 RKIGNDAHUOOIMJ-BQFCYCMXSA-N 0.000 description 2
- SBJCTAZFSZXWSR-AVGNSLFASA-N Val-Met-His Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N SBJCTAZFSZXWSR-AVGNSLFASA-N 0.000 description 2
- VHIZXDZMTDVFGX-DCAQKATOSA-N Val-Ser-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)N VHIZXDZMTDVFGX-DCAQKATOSA-N 0.000 description 2
- PZTZYZUTCPZWJH-FXQIFTODSA-N Val-Ser-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O)N PZTZYZUTCPZWJH-FXQIFTODSA-N 0.000 description 2
- NZYNRRGJJVSSTJ-GUBZILKMSA-N Val-Ser-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O NZYNRRGJJVSSTJ-GUBZILKMSA-N 0.000 description 2
- WUFHZIRMAZZWRS-OSUNSFLBSA-N Val-Thr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C(C)C)N WUFHZIRMAZZWRS-OSUNSFLBSA-N 0.000 description 2
- HTONZBWRYUKUKC-RCWTZXSCSA-N Val-Thr-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O HTONZBWRYUKUKC-RCWTZXSCSA-N 0.000 description 2
- MIAZWUMFUURQNP-YDHLFZDLSA-N Val-Tyr-Asn Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N MIAZWUMFUURQNP-YDHLFZDLSA-N 0.000 description 2
- AOILQMZPNLUXCM-AVGNSLFASA-N Val-Val-Lys Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCCCN AOILQMZPNLUXCM-AVGNSLFASA-N 0.000 description 2
- 108010081404 acein-2 Proteins 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 108010041407 alanylaspartic acid Proteins 0.000 description 2
- 108010005233 alanylglutamic acid Proteins 0.000 description 2
- 108010087924 alanylproline Proteins 0.000 description 2
- 108010013835 arginine glutamate Proteins 0.000 description 2
- 108010040443 aspartyl-aspartic acid Proteins 0.000 description 2
- 208000031513 cyst Diseases 0.000 description 2
- 108010004073 cysteinylcysteine Proteins 0.000 description 2
- 210000002919 epithelial cell Anatomy 0.000 description 2
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 2
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 2
- 108010089804 glycyl-threonine Proteins 0.000 description 2
- 108010081551 glycylphenylalanine Proteins 0.000 description 2
- 108010037850 glycylvaline Proteins 0.000 description 2
- 230000003902 lesion Effects 0.000 description 2
- 108010034529 leucyl-lysine Proteins 0.000 description 2
- 108010057821 leucylproline Proteins 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 108010038320 lysylphenylalanine Proteins 0.000 description 2
- 108010017391 lysylvaline Proteins 0.000 description 2
- 210000004379 membrane Anatomy 0.000 description 2
- 208000013435 necrotic lesion Diseases 0.000 description 2
- 230000008520 organization Effects 0.000 description 2
- 108010077112 prolyl-proline Proteins 0.000 description 2
- 108010031719 prolyl-serine Proteins 0.000 description 2
- 108010025432 tyrosyl-alanyl-phenylalanyl-glycine Proteins 0.000 description 2
- 108010051110 tyrosyl-lysine Proteins 0.000 description 2
- 229960005486 vaccine Drugs 0.000 description 2
- 208000002874 Acne Vulgaris Diseases 0.000 description 1
- MBWYUTNBYSSUIQ-HERUPUMHSA-N Ala-Asn-Trp Chemical compound C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)N MBWYUTNBYSSUIQ-HERUPUMHSA-N 0.000 description 1
- OBVSBEYOMDWLRJ-BFHQHQDPSA-N Ala-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](C)N OBVSBEYOMDWLRJ-BFHQHQDPSA-N 0.000 description 1
- OYJCVIGKMXUVKB-GARJFASQSA-N Ala-Leu-Pro Chemical compound C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@@H]1C(=O)O)N OYJCVIGKMXUVKB-GARJFASQSA-N 0.000 description 1
- WQLDNOCHHRISMS-NAKRPEOUSA-N Ala-Pro-Ile Chemical compound [H]N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(O)=O WQLDNOCHHRISMS-NAKRPEOUSA-N 0.000 description 1
- RTZCUEHYUQZIDE-WHFBIAKZSA-N Ala-Ser-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O RTZCUEHYUQZIDE-WHFBIAKZSA-N 0.000 description 1
- BHFOJPDOQPWJRN-XDTLVQLUSA-N Ala-Tyr-Gln Chemical compound C[C@H](N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(N)=O)C(O)=O BHFOJPDOQPWJRN-XDTLVQLUSA-N 0.000 description 1
- MZRBYBIQTIKERR-GUBZILKMSA-N Arg-Glu-Gln Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O MZRBYBIQTIKERR-GUBZILKMSA-N 0.000 description 1
- YNSGXDWWPCGGQS-YUMQZZPRSA-N Arg-Gly-Gln Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O YNSGXDWWPCGGQS-YUMQZZPRSA-N 0.000 description 1
- KZXPVYVSHUJCEO-ULQDDVLXSA-N Arg-Phe-Lys Chemical compound NC(=N)NCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(O)=O)CC1=CC=CC=C1 KZXPVYVSHUJCEO-ULQDDVLXSA-N 0.000 description 1
- YCYXHLZRUSJITQ-SRVKXCTJSA-N Arg-Pro-Pro Chemical compound NC(=N)NCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 YCYXHLZRUSJITQ-SRVKXCTJSA-N 0.000 description 1
- ASQKVGRCKOFKIU-KZVJFYERSA-N Arg-Thr-Ala Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N)O ASQKVGRCKOFKIU-KZVJFYERSA-N 0.000 description 1
- INOIAEUXVVNJKA-XGEHTFHBSA-N Arg-Thr-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O INOIAEUXVVNJKA-XGEHTFHBSA-N 0.000 description 1
- NVPHRWNWTKYIST-BPNCWPANSA-N Arg-Tyr-Ala Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](C)C(O)=O)CC1=CC=C(O)C=C1 NVPHRWNWTKYIST-BPNCWPANSA-N 0.000 description 1
- OLVIPTLKNSAYRJ-YUMQZZPRSA-N Asn-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CC(=O)N)N OLVIPTLKNSAYRJ-YUMQZZPRSA-N 0.000 description 1
- GOKCTAJWRPSCHP-VHWLVUOQSA-N Asn-Ile-Trp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CC(=O)N)N GOKCTAJWRPSCHP-VHWLVUOQSA-N 0.000 description 1
- GLWFAWNYGWBMOC-SRVKXCTJSA-N Asn-Leu-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O GLWFAWNYGWBMOC-SRVKXCTJSA-N 0.000 description 1
- PUUPMDXIHCOPJU-HJGDQZAQSA-N Asn-Thr-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)N)N)O PUUPMDXIHCOPJU-HJGDQZAQSA-N 0.000 description 1
- CBWCQCANJSGUOH-ZKWXMUAHSA-N Asn-Val-Ala Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O CBWCQCANJSGUOH-ZKWXMUAHSA-N 0.000 description 1
- BUVNWKQBMZLCDW-UGYAYLCHSA-N Asp-Asn-Ile Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O BUVNWKQBMZLCDW-UGYAYLCHSA-N 0.000 description 1
- XACXDSRQIXRMNS-OLHMAJIHSA-N Asp-Asn-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)O)N)O XACXDSRQIXRMNS-OLHMAJIHSA-N 0.000 description 1
- NAPNAGZWHQHZLG-ZLUOBGJFSA-N Asp-Asp-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)N NAPNAGZWHQHZLG-ZLUOBGJFSA-N 0.000 description 1
- LKIYSIYBKYLKPU-BIIVOSGPSA-N Asp-Asp-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)N)C(=O)O LKIYSIYBKYLKPU-BIIVOSGPSA-N 0.000 description 1
- PDIYGFYAMZZFCW-JIOCBJNQSA-N Asp-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC(=O)O)N)O PDIYGFYAMZZFCW-JIOCBJNQSA-N 0.000 description 1
- ZUNMTUPRQMWMHX-LSJOCFKGSA-N Asp-Val-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O ZUNMTUPRQMWMHX-LSJOCFKGSA-N 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 206010057248 Cell death Diseases 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 206010011224 Cough Diseases 0.000 description 1
- ZJBWJHQDOIMVLM-WHFBIAKZSA-N Cys-Cys-Gly Chemical compound SC[C@H](N)C(=O)N[C@@H](CS)C(=O)NCC(O)=O ZJBWJHQDOIMVLM-WHFBIAKZSA-N 0.000 description 1
- BVFQOPGFOQVZTE-ACZMJKKPSA-N Cys-Gln-Ala Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(O)=O BVFQOPGFOQVZTE-ACZMJKKPSA-N 0.000 description 1
- OHLLDUNVMPPUMD-DCAQKATOSA-N Cys-Leu-Val Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](C(C)C)C(=O)O)NC(=O)[C@H](CS)N OHLLDUNVMPPUMD-DCAQKATOSA-N 0.000 description 1
- WZJLBUPPZRZNTO-CIUDSAMLSA-N Cys-Ser-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CS)N WZJLBUPPZRZNTO-CIUDSAMLSA-N 0.000 description 1
- XOKGKOQWADCLFQ-GARJFASQSA-N Gln-Arg-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCC(=O)N)N)C(=O)O XOKGKOQWADCLFQ-GARJFASQSA-N 0.000 description 1
- DHNWZLGBTPUTQQ-QEJZJMRPSA-N Gln-Asp-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)N)N DHNWZLGBTPUTQQ-QEJZJMRPSA-N 0.000 description 1
- ORYMMTRPKVTGSJ-XVKPBYJWSA-N Gln-Gly-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CCC(N)=O ORYMMTRPKVTGSJ-XVKPBYJWSA-N 0.000 description 1
- AQPZYBSRDRZBAG-AVGNSLFASA-N Gln-Phe-Asn Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)N)N AQPZYBSRDRZBAG-AVGNSLFASA-N 0.000 description 1
- SXFPZRRVWSUYII-KBIXCLLPSA-N Gln-Ser-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)N)N SXFPZRRVWSUYII-KBIXCLLPSA-N 0.000 description 1
- OTQSTOXRUBVWAP-NRPADANISA-N Gln-Ser-Val Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O OTQSTOXRUBVWAP-NRPADANISA-N 0.000 description 1
- VXAIXLOYBPMZPT-JBACZVJFSA-N Gln-Trp-Tyr Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)O)NC(=O)[C@H](CCC(=O)N)N VXAIXLOYBPMZPT-JBACZVJFSA-N 0.000 description 1
- MXOODARRORARSU-ACZMJKKPSA-N Glu-Ala-Ser Chemical compound C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CCC(=O)O)N MXOODARRORARSU-ACZMJKKPSA-N 0.000 description 1
- NTBDVNJIWCKURJ-ACZMJKKPSA-N Glu-Asp-Asn Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O NTBDVNJIWCKURJ-ACZMJKKPSA-N 0.000 description 1
- HTTSBEBKVNEDFE-AUTRQRHGSA-N Glu-Gln-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCC(=O)O)N HTTSBEBKVNEDFE-AUTRQRHGSA-N 0.000 description 1
- MUSGDMDGNGXULI-DCAQKATOSA-N Glu-Glu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCC(O)=O MUSGDMDGNGXULI-DCAQKATOSA-N 0.000 description 1
- QDMVXRNLOPTPIE-WDCWCFNPSA-N Glu-Lys-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O QDMVXRNLOPTPIE-WDCWCFNPSA-N 0.000 description 1
- SYAYROHMAIHWFB-KBIXCLLPSA-N Glu-Ser-Ile Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O SYAYROHMAIHWFB-KBIXCLLPSA-N 0.000 description 1
- ZNOHKCPYDAYYDA-BPUTZDHNSA-N Glu-Trp-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCC(N)=O)C(O)=O ZNOHKCPYDAYYDA-BPUTZDHNSA-N 0.000 description 1
- YQPFCZVKMUVZIN-AUTRQRHGSA-N Glu-Val-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O YQPFCZVKMUVZIN-AUTRQRHGSA-N 0.000 description 1
- SOYWRINXUSUWEQ-DLOVCJGASA-N Glu-Val-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCC(O)=O SOYWRINXUSUWEQ-DLOVCJGASA-N 0.000 description 1
- XBWMTPAIUQIWKA-BYULHYEWSA-N Gly-Asp-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)CN XBWMTPAIUQIWKA-BYULHYEWSA-N 0.000 description 1
- TZOVVRJYUDETQG-RCOVLWMOSA-N Gly-Asp-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)CN TZOVVRJYUDETQG-RCOVLWMOSA-N 0.000 description 1
- UQJNXZSSGQIPIQ-FBCQKBJTSA-N Gly-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)CN UQJNXZSSGQIPIQ-FBCQKBJTSA-N 0.000 description 1
- OOCFXNOVSLSHAB-IUCAKERBSA-N Gly-Pro-Pro Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 OOCFXNOVSLSHAB-IUCAKERBSA-N 0.000 description 1
- HAOUOFNNJJLVNS-BQBZGAKWSA-N Gly-Pro-Ser Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O HAOUOFNNJJLVNS-BQBZGAKWSA-N 0.000 description 1
- LCRDMSSAKLTKBU-ZDLURKLDSA-N Gly-Ser-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)CN LCRDMSSAKLTKBU-ZDLURKLDSA-N 0.000 description 1
- NVTPVQLIZCOJFK-FOHZUACHSA-N Gly-Thr-Asp Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O NVTPVQLIZCOJFK-FOHZUACHSA-N 0.000 description 1
- HUFUVTYGPOUCBN-MBLNEYKQSA-N Gly-Thr-Ile Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O HUFUVTYGPOUCBN-MBLNEYKQSA-N 0.000 description 1
- GJHWILMUOANXTG-WPRPVWTQSA-N Gly-Val-Arg Chemical compound [H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O GJHWILMUOANXTG-WPRPVWTQSA-N 0.000 description 1
- NGRPGJGKJMUGDM-XVKPBYJWSA-N Gly-Val-Gln Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O NGRPGJGKJMUGDM-XVKPBYJWSA-N 0.000 description 1
- LYSVCKOXIDKEEL-SRVKXCTJSA-N His-Asn-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CC1=CN=CN1 LYSVCKOXIDKEEL-SRVKXCTJSA-N 0.000 description 1
- HIAHVKLTHNOENC-HGNGGELXSA-N His-Glu-Ala Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O HIAHVKLTHNOENC-HGNGGELXSA-N 0.000 description 1
- ZVKDCQVQTGYBQT-LSJOCFKGSA-N His-Pro-Ala Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O ZVKDCQVQTGYBQT-LSJOCFKGSA-N 0.000 description 1
- YPWHUFAAMNHMGS-QSFUFRPTSA-N Ile-Ala-His Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N YPWHUFAAMNHMGS-QSFUFRPTSA-N 0.000 description 1
- HERITAGIPLEJMT-GVARAGBVSA-N Ile-Ala-Tyr Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 HERITAGIPLEJMT-GVARAGBVSA-N 0.000 description 1
- QYZYJFXHXYUZMZ-UGYAYLCHSA-N Ile-Asn-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)N)C(=O)O)N QYZYJFXHXYUZMZ-UGYAYLCHSA-N 0.000 description 1
- UAELWXJFLZBKQS-WHOFXGATSA-N Ile-Phe-Gly Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(O)=O UAELWXJFLZBKQS-WHOFXGATSA-N 0.000 description 1
- JHNJNTMTZHEDLJ-NAKRPEOUSA-N Ile-Ser-Arg Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O JHNJNTMTZHEDLJ-NAKRPEOUSA-N 0.000 description 1
- VGSPNSSCMOHRRR-BJDJZHNGSA-N Ile-Ser-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)O)N VGSPNSSCMOHRRR-BJDJZHNGSA-N 0.000 description 1
- PXKACEXYLPBMAD-JBDRJPRFSA-N Ile-Ser-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O)N PXKACEXYLPBMAD-JBDRJPRFSA-N 0.000 description 1
- JZBVBOKASHNXAD-NAKRPEOUSA-N Ile-Val-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)O)N JZBVBOKASHNXAD-NAKRPEOUSA-N 0.000 description 1
- RCFDOSNHHZGBOY-UHFFFAOYSA-N L-isoleucyl-L-alanine Natural products CCC(C)C(N)C(=O)NC(C)C(O)=O RCFDOSNHHZGBOY-UHFFFAOYSA-N 0.000 description 1
- WSGXUIQTEZDVHJ-GARJFASQSA-N Leu-Ala-Pro Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@@H]1C(O)=O WSGXUIQTEZDVHJ-GARJFASQSA-N 0.000 description 1
- HXWALXSAVBLTPK-NUTKFTJISA-N Leu-Ala-Trp Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CC(C)C)N HXWALXSAVBLTPK-NUTKFTJISA-N 0.000 description 1
- KSZCCRIGNVSHFH-UWVGGRQHSA-N Leu-Arg-Gly Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O KSZCCRIGNVSHFH-UWVGGRQHSA-N 0.000 description 1
- FEHQLKKBVJHSEC-SZMVWBNQSA-N Leu-Glu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC(C)C)C(O)=O)=CNC2=C1 FEHQLKKBVJHSEC-SZMVWBNQSA-N 0.000 description 1
- BTNXKBVLWJBTNR-SRVKXCTJSA-N Leu-His-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(O)=O BTNXKBVLWJBTNR-SRVKXCTJSA-N 0.000 description 1
- YOKVEHGYYQEQOP-QWRGUYRKSA-N Leu-Leu-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O YOKVEHGYYQEQOP-QWRGUYRKSA-N 0.000 description 1
- VULJUQZPSOASBZ-SRVKXCTJSA-N Leu-Pro-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O VULJUQZPSOASBZ-SRVKXCTJSA-N 0.000 description 1
- SVBJIZVVYJYGLA-DCAQKATOSA-N Leu-Ser-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O SVBJIZVVYJYGLA-DCAQKATOSA-N 0.000 description 1
- AEDWWMMHUGYIFD-HJGDQZAQSA-N Leu-Thr-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(O)=O AEDWWMMHUGYIFD-HJGDQZAQSA-N 0.000 description 1
- VUBIPAHVHMZHCM-KKUMJFAQSA-N Leu-Tyr-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CO)C(O)=O)CC1=CC=C(O)C=C1 VUBIPAHVHMZHCM-KKUMJFAQSA-N 0.000 description 1
- IXHKPDJKKCUKHS-GARJFASQSA-N Lys-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCCCN)N IXHKPDJKKCUKHS-GARJFASQSA-N 0.000 description 1
- MWVUEPNEPWMFBD-SRVKXCTJSA-N Lys-Cys-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@H](C(O)=O)CCCCN MWVUEPNEPWMFBD-SRVKXCTJSA-N 0.000 description 1
- DUTMKEAPLLUGNO-JYJNAYRXSA-N Lys-Glu-Phe Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O DUTMKEAPLLUGNO-JYJNAYRXSA-N 0.000 description 1
- NNKLKUUGESXCBS-KBPBESRZSA-N Lys-Gly-Tyr Chemical compound [H]N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O NNKLKUUGESXCBS-KBPBESRZSA-N 0.000 description 1
- IPSDPDAOSAEWCN-RHYQMDGZSA-N Lys-Met-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O IPSDPDAOSAEWCN-RHYQMDGZSA-N 0.000 description 1
- PDIDTSZKKFEDMB-UWVGGRQHSA-N Lys-Pro-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O PDIDTSZKKFEDMB-UWVGGRQHSA-N 0.000 description 1
- JOSAKOKSPXROGQ-BJDJZHNGSA-N Lys-Ser-Ile Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O JOSAKOKSPXROGQ-BJDJZHNGSA-N 0.000 description 1
- DJBCKVNHEIJLQA-GMOBBJLQSA-N Met-Ile-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCSC)N DJBCKVNHEIJLQA-GMOBBJLQSA-N 0.000 description 1
- SPSSJSICDYYTQN-HJGDQZAQSA-N Met-Thr-Gln Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCC(N)=O SPSSJSICDYYTQN-HJGDQZAQSA-N 0.000 description 1
- 241000712045 Morbillivirus Species 0.000 description 1
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 1
- 241000282943 Odocoileus Species 0.000 description 1
- KIEPQOIQHFKQLK-PCBIJLKTSA-N Phe-Asn-Ile Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O KIEPQOIQHFKQLK-PCBIJLKTSA-N 0.000 description 1
- YDUGVDGFKNXFPL-IXOXFDKPSA-N Phe-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N)O YDUGVDGFKNXFPL-IXOXFDKPSA-N 0.000 description 1
- FGWUALWGCZJQDJ-URLPEUOOSA-N Phe-Thr-Ile Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O FGWUALWGCZJQDJ-URLPEUOOSA-N 0.000 description 1
- KLYYKKGCPOGDPE-OEAJRASXSA-N Phe-Thr-Leu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O KLYYKKGCPOGDPE-OEAJRASXSA-N 0.000 description 1
- SJRQWEDYTKYHHL-SLFFLAALSA-N Phe-Tyr-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CC3=CC=CC=C3)N)C(=O)O SJRQWEDYTKYHHL-SLFFLAALSA-N 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- UIMCLYYSUCIUJM-UWVGGRQHSA-N Pro-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 UIMCLYYSUCIUJM-UWVGGRQHSA-N 0.000 description 1
- AFXCXDQNRXTSBD-FJXKBIBVSA-N Pro-Gly-Thr Chemical compound [H]N1CCC[C@H]1C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(O)=O AFXCXDQNRXTSBD-FJXKBIBVSA-N 0.000 description 1
- HFNPOYOKIPGAEI-SRVKXCTJSA-N Pro-Leu-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1 HFNPOYOKIPGAEI-SRVKXCTJSA-N 0.000 description 1
- ZLXKLMHAMDENIO-DCAQKATOSA-N Pro-Lys-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O ZLXKLMHAMDENIO-DCAQKATOSA-N 0.000 description 1
- WOIFYRZPIORBRY-AVGNSLFASA-N Pro-Lys-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O WOIFYRZPIORBRY-AVGNSLFASA-N 0.000 description 1
- RFWXYTJSVDUBBZ-DCAQKATOSA-N Pro-Pro-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 RFWXYTJSVDUBBZ-DCAQKATOSA-N 0.000 description 1
- KWMZPPWYBVZIER-XGEHTFHBSA-N Pro-Ser-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KWMZPPWYBVZIER-XGEHTFHBSA-N 0.000 description 1
- RMJZWERKFFNNNS-XGEHTFHBSA-N Pro-Thr-Ser Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O RMJZWERKFFNNNS-XGEHTFHBSA-N 0.000 description 1
- YDTUEBLEAVANFH-RCWTZXSCSA-N Pro-Val-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H]1CCCN1 YDTUEBLEAVANFH-RCWTZXSCSA-N 0.000 description 1
- RDFQNDHEHVSONI-ZLUOBGJFSA-N Ser-Asn-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O RDFQNDHEHVSONI-ZLUOBGJFSA-N 0.000 description 1
- TYYBJUYSTWJHGO-ZKWXMUAHSA-N Ser-Asn-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O TYYBJUYSTWJHGO-ZKWXMUAHSA-N 0.000 description 1
- QPFJSHSJFIYDJZ-GHCJXIJMSA-N Ser-Asp-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CO QPFJSHSJFIYDJZ-GHCJXIJMSA-N 0.000 description 1
- BQWCDDAISCPDQV-XHNCKOQMSA-N Ser-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CO)N)C(=O)O BQWCDDAISCPDQV-XHNCKOQMSA-N 0.000 description 1
- VQBCMLMPEWPUTB-ACZMJKKPSA-N Ser-Glu-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O VQBCMLMPEWPUTB-ACZMJKKPSA-N 0.000 description 1
- AEGUWTFAQQWVLC-BQBZGAKWSA-N Ser-Gly-Arg Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O AEGUWTFAQQWVLC-BQBZGAKWSA-N 0.000 description 1
- UIGMAMGZOJVTDN-WHFBIAKZSA-N Ser-Gly-Ser Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O UIGMAMGZOJVTDN-WHFBIAKZSA-N 0.000 description 1
- SFTZWNJFZYOLBD-ZDLURKLDSA-N Ser-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CO SFTZWNJFZYOLBD-ZDLURKLDSA-N 0.000 description 1
- KQNDIKOYWZTZIX-FXQIFTODSA-N Ser-Ser-Arg Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCNC(N)=N KQNDIKOYWZTZIX-FXQIFTODSA-N 0.000 description 1
- SRSPTFBENMJHMR-WHFBIAKZSA-N Ser-Ser-Gly Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O SRSPTFBENMJHMR-WHFBIAKZSA-N 0.000 description 1
- JCLAFVNDBJMLBC-JBDRJPRFSA-N Ser-Ser-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O JCLAFVNDBJMLBC-JBDRJPRFSA-N 0.000 description 1
- SQHKXWODKJDZRC-LKXGYXEUSA-N Ser-Thr-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(O)=O SQHKXWODKJDZRC-LKXGYXEUSA-N 0.000 description 1
- FLMYSKVSDVHLEW-SVSWQMSJSA-N Ser-Thr-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O FLMYSKVSDVHLEW-SVSWQMSJSA-N 0.000 description 1
- NADLKBTYNKUJEP-KATARQTJSA-N Ser-Thr-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O NADLKBTYNKUJEP-KATARQTJSA-N 0.000 description 1
- RCOUFINCYASMDN-GUBZILKMSA-N Ser-Val-Met Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCSC)C(O)=O RCOUFINCYASMDN-GUBZILKMSA-N 0.000 description 1
- JGUWRQWULDWNCM-FXQIFTODSA-N Ser-Val-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O JGUWRQWULDWNCM-FXQIFTODSA-N 0.000 description 1
- 244000273618 Sphenoclea zeylanica Species 0.000 description 1
- CAJFZCICSVBOJK-SHGPDSBTSA-N Thr-Ala-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CAJFZCICSVBOJK-SHGPDSBTSA-N 0.000 description 1
- PZVGOVRNGKEFCB-KKHAAJSZSA-N Thr-Asn-Val Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](C(C)C)C(=O)O)N)O PZVGOVRNGKEFCB-KKHAAJSZSA-N 0.000 description 1
- MFEBUIFJVPNZLO-OLHMAJIHSA-N Thr-Asp-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O MFEBUIFJVPNZLO-OLHMAJIHSA-N 0.000 description 1
- OHAJHDJOCKKJLV-LKXGYXEUSA-N Thr-Asp-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O OHAJHDJOCKKJLV-LKXGYXEUSA-N 0.000 description 1
- DCLBXIWHLVEPMQ-JRQIVUDYSA-N Thr-Asp-Tyr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 DCLBXIWHLVEPMQ-JRQIVUDYSA-N 0.000 description 1
- KWQBJOUOSNJDRR-XAVMHZPKSA-N Thr-Cys-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)N1CCC[C@@H]1C(=O)O)N)O KWQBJOUOSNJDRR-XAVMHZPKSA-N 0.000 description 1
- DSLHSTIUAPKERR-XGEHTFHBSA-N Thr-Cys-Val Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](C(C)C)C(O)=O DSLHSTIUAPKERR-XGEHTFHBSA-N 0.000 description 1
- LGNBRHZANHMZHK-NUMRIWBASA-N Thr-Glu-Asp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N)O LGNBRHZANHMZHK-NUMRIWBASA-N 0.000 description 1
- AHOLTQCAVBSUDP-PPCPHDFISA-N Thr-Ile-Lys Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](N)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(O)=O AHOLTQCAVBSUDP-PPCPHDFISA-N 0.000 description 1
- FQPDRTDDEZXCEC-SVSWQMSJSA-N Thr-Ile-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O FQPDRTDDEZXCEC-SVSWQMSJSA-N 0.000 description 1
- RFKVQLIXNVEOMB-WEDXCCLWSA-N Thr-Leu-Gly Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)O)N)O RFKVQLIXNVEOMB-WEDXCCLWSA-N 0.000 description 1
- FIFDDJFLNVAVMS-RHYQMDGZSA-N Thr-Leu-Met Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(O)=O FIFDDJFLNVAVMS-RHYQMDGZSA-N 0.000 description 1
- JMBRNXUOLJFURW-BEAPCOKYSA-N Thr-Phe-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N2CCC[C@@H]2C(=O)O)N)O JMBRNXUOLJFURW-BEAPCOKYSA-N 0.000 description 1
- XKWABWFMQXMUMT-HJGDQZAQSA-N Thr-Pro-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O XKWABWFMQXMUMT-HJGDQZAQSA-N 0.000 description 1
- BJJRNAVDQGREGC-HOUAVDHOSA-N Thr-Trp-Asn Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CC(=O)N)C(=O)O)N)O BJJRNAVDQGREGC-HOUAVDHOSA-N 0.000 description 1
- NDLHSJWPCXKOGG-VLCNGCBASA-N Thr-Trp-Tyr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)O)N)O NDLHSJWPCXKOGG-VLCNGCBASA-N 0.000 description 1
- OGOYMQWIWHGTGH-KZVJFYERSA-N Thr-Val-Ala Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O OGOYMQWIWHGTGH-KZVJFYERSA-N 0.000 description 1
- FYBFTPLPAXZBOY-KKHAAJSZSA-N Thr-Val-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O FYBFTPLPAXZBOY-KKHAAJSZSA-N 0.000 description 1
- AKHDFZHUPGVFEJ-YEPSODPASA-N Thr-Val-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O AKHDFZHUPGVFEJ-YEPSODPASA-N 0.000 description 1
- OBAMASZCXDIXSS-SZMVWBNQSA-N Trp-Glu-Lys Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)N OBAMASZCXDIXSS-SZMVWBNQSA-N 0.000 description 1
- UIRVSEPRMWDVEW-RNXOBYDBSA-N Trp-Tyr-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CC3=CNC4=CC=CC=C43)N UIRVSEPRMWDVEW-RNXOBYDBSA-N 0.000 description 1
- SGFIXFAHVWJKTD-KJEVXHAQSA-N Tyr-Arg-Thr Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SGFIXFAHVWJKTD-KJEVXHAQSA-N 0.000 description 1
- QOIKZODVIPOPDD-AVGNSLFASA-N Tyr-Cys-Gln Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(O)=O QOIKZODVIPOPDD-AVGNSLFASA-N 0.000 description 1
- QUILOGWWLXMSAT-IHRRRGAJSA-N Tyr-Gln-Gln Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O QUILOGWWLXMSAT-IHRRRGAJSA-N 0.000 description 1
- GGXUDPQWAWRINY-XEGUGMAKSA-N Tyr-Ile-Gly Chemical compound OC(=O)CNC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 GGXUDPQWAWRINY-XEGUGMAKSA-N 0.000 description 1
- SINRIKQYQJRGDQ-MEYUZBJRSA-N Tyr-Lys-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 SINRIKQYQJRGDQ-MEYUZBJRSA-N 0.000 description 1
- UPODKYBYUBTWSV-BZSNNMDCSA-N Tyr-Phe-Cys Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CS)C(O)=O)C1=CC=C(O)C=C1 UPODKYBYUBTWSV-BZSNNMDCSA-N 0.000 description 1
- SCZJKZLFSSPJDP-ACRUOGEOSA-N Tyr-Phe-Leu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(O)=O SCZJKZLFSSPJDP-ACRUOGEOSA-N 0.000 description 1
- QPOUERMDWKKZEG-HJPIBITLSA-N Tyr-Ser-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 QPOUERMDWKKZEG-HJPIBITLSA-N 0.000 description 1
- NHOVZGFNTGMYMI-KKUMJFAQSA-N Tyr-Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 NHOVZGFNTGMYMI-KKUMJFAQSA-N 0.000 description 1
- RIVVDNTUSRVTQT-IRIUXVKKSA-N Tyr-Thr-Gln Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N)O RIVVDNTUSRVTQT-IRIUXVKKSA-N 0.000 description 1
- XFEMMSGONWQACR-KJEVXHAQSA-N Tyr-Thr-Met Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N)O XFEMMSGONWQACR-KJEVXHAQSA-N 0.000 description 1
- JIODCDXKCJRMEH-NHCYSSNCSA-N Val-Arg-Gln Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N JIODCDXKCJRMEH-NHCYSSNCSA-N 0.000 description 1
- CGGVNFJRZJUVAE-BYULHYEWSA-N Val-Asp-Asn Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N CGGVNFJRZJUVAE-BYULHYEWSA-N 0.000 description 1
- BMGOFDMKDVVGJG-NHCYSSNCSA-N Val-Asp-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)N BMGOFDMKDVVGJG-NHCYSSNCSA-N 0.000 description 1
- CELJCNRXKZPTCX-XPUUQOCRSA-N Val-Gly-Ala Chemical compound CC(C)[C@H](N)C(=O)NCC(=O)N[C@@H](C)C(O)=O CELJCNRXKZPTCX-XPUUQOCRSA-N 0.000 description 1
- FMQGYTMERWBMSI-HJWJTTGWSA-N Val-Phe-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](C(C)C)N FMQGYTMERWBMSI-HJWJTTGWSA-N 0.000 description 1
- VCIYTVOBLZHFSC-XHSDSOJGSA-N Val-Phe-Pro Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N2CCC[C@@H]2C(=O)O)N VCIYTVOBLZHFSC-XHSDSOJGSA-N 0.000 description 1
- KSFXWENSJABBFI-ZKWXMUAHSA-N Val-Ser-Asn Chemical compound [H]N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O KSFXWENSJABBFI-ZKWXMUAHSA-N 0.000 description 1
- RYHUIHUOYRNNIE-NRPADANISA-N Val-Ser-Gln Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N RYHUIHUOYRNNIE-NRPADANISA-N 0.000 description 1
- UGFMVXRXULGLNO-XPUUQOCRSA-N Val-Ser-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O UGFMVXRXULGLNO-XPUUQOCRSA-N 0.000 description 1
- BZDGLJPROOOUOZ-XGEHTFHBSA-N Val-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](C(C)C)N)O BZDGLJPROOOUOZ-XGEHTFHBSA-N 0.000 description 1
- YQYFYUSYEDNLSD-YEPSODPASA-N Val-Thr-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O YQYFYUSYEDNLSD-YEPSODPASA-N 0.000 description 1
- ZLNYBMWGPOKSLW-LSJOCFKGSA-N Val-Val-Asp Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O ZLNYBMWGPOKSLW-LSJOCFKGSA-N 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 206010000496 acne Diseases 0.000 description 1
- 108010070944 alanylhistidine Proteins 0.000 description 1
- 208000002399 aphthous stomatitis Diseases 0.000 description 1
- 230000036528 appetite Effects 0.000 description 1
- 235000019789 appetite Nutrition 0.000 description 1
- 108010069205 aspartyl-phenylalanine Proteins 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000018044 dehydration Effects 0.000 description 1
- 238000006297 dehydration reaction Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 210000002249 digestive system Anatomy 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 210000003608 fece Anatomy 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 210000001739 intranuclear inclusion body Anatomy 0.000 description 1
- 108010044374 isoleucyl-tyrosine Proteins 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 210000003563 lymphoid tissue Anatomy 0.000 description 1
- 108010064235 lysylglycine Proteins 0.000 description 1
- 108010005942 methionylglycine Proteins 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 210000003097 mucus Anatomy 0.000 description 1
- 210000002445 nipple Anatomy 0.000 description 1
- 210000003254 palate Anatomy 0.000 description 1
- 108010070409 phenylalanyl-glycyl-glycine Proteins 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 108010070643 prolylglutamic acid Proteins 0.000 description 1
- 230000001902 propagating effect Effects 0.000 description 1
- 206010039083 rhinitis Diseases 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 108010026333 seryl-proline Proteins 0.000 description 1
- 238000003307 slaughter Methods 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 210000000438 stratum basale Anatomy 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000002381 testicular Effects 0.000 description 1
- 108010033670 threonyl-aspartyl-tyrosine Proteins 0.000 description 1
- 108010080629 tryptophan-leucine Proteins 0.000 description 1
- 108010038745 tryptophylglycine Proteins 0.000 description 1
- 108010044292 tryptophyltyrosine Proteins 0.000 description 1
- 108010003137 tyrosyltyrosine Proteins 0.000 description 1
- 108010073969 valyllysine Proteins 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
- 108010027345 wheylin-1 peptide Proteins 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1027—Paramyxoviridae, e.g. respiratory syncytial virus
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/577—Immunoassay; Biospecific binding assay; Materials therefor involving monoclonal antibodies binding reaction mechanisms characterised by the use of monoclonal antibodies; monoclonal antibodies per se are classified with their corresponding antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/115—Paramyxoviridae, e.g. parainfluenza virus
- G01N2333/12—Mumps virus; Measles virus
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Virology (AREA)
- Urology & Nephrology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Pathology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- General Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Organic Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pulmonology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention relates to the monoclonal antibodies and kit that can be used for detecting PPR virus.Monoclonal antibody of the invention can specifically bind PPR virus.Peste des petits ruminants diagnostic kit of the invention includes substrate and the monoclonal antibody of the invention that is fixed in the substrate, be can be used in the biological sample of test object biological source with the presence or absence of PPR virus.
Description
Technical field
The invention belongs to biological detection and technical field of medical detection, and in particular to one kind can be used for detecting peste des petits ruminants
The monoclonal antibody and kit of virus.
Background technique
Peste des petits ruminants (peste des petits ruminants, PPR) is commonly called as sheep pest also known as false rinderpest
(pseudorinderpest), the compound disease (stomatitis- of pneumoenteritis (pneumoenteritis), stomatitis pneumoenteritis
Pneumoenteritis complex), it is a kind of acute viral infectious disease as caused by PPR virus, it is main to feel
Small ruminant is contaminated, characterized by fever, stomatitis, diarrhea, pneumonia.
Nineteen forty-two, this disease occurred in the Ivory Coast for the first time, and thereafter, African Senegal, Ghana, Togo, Benin etc. have this
Disease is reported, this disease also has occurred in the sheep and goat of Nigeria, and cause heavy losses.Some countries in Asia also report
This disease of road, according to World Organization for Animal Health (OIE) 1993 " world animal health " reports, the goat of Bangladesh had this
The disease of similar rinderpest has occurred in disease generation, India De Labang and some areas sheep of horse Harrar Shi Telabang, it is last true
It examines as peste des petits ruminants, hereafter, safe Mir's ladd nation is also infected report.1993, Israel's first time report had small
Epizootic disease is ruminated, source of infection is unknown, and to prevent this disease from propagating, Israel is vaccinated with the sheep and goat of its northern territory
Rinderpest vaccines.1992, this disease-specific antibody was had found in the sheep and goat of Jordan, 1993, there are 11 farms to occur
Clinical case, more than 100 sheep and goat death.1993, Saudi Arabia found 133 cases for the first time.In July, 2007,
The epidemic disease is passed to China Tibet region for the first time.
PPR virus category paramyxovirus section Morbillivirus.There is similar physical chemistry with rinderpest virus and is immunized
Learn characteristic.Virus is in pleomorphism, usually coarse spherical shape.Virion is big compared with rinderpest virus, and nucleocapsid is spiral hollow stem
Shape simultaneously has characteristic subunit, there is cyst membrane.Virus can be in tire sheep renal, testicular cell, the Vero cell of tire sheep and newborn sheep
Upper proliferation, and cytopathy (CPE) is generated, form plasomidum.
The small ruminants such as this disease main infection goat, sheep, U.S. white-tailed deer are popular in African western, middle part and Asia
The some areas in continent.In epidemic-stricken area, this disease is that fragmentary generation can happening and prevelence when susceptible animal increases.This disease mainly passes through
Immediate contagion, the secretion and excreta of ill domestic animal are the infections sources, and the sick sheep for facing the type of examining in Asia is especially dangerous.It is small to ruminate beast
Epidemic disease incubation period is 4-5 days, longest 21 days.Natural occurrence is detected in goat and sheep.Goat morbidity is serious, and sheep also occasionally has seriously
Case occurs.The lip of some rehabilitation goats forms aphtha sample lesion.Infection animal clinical symptom is similar to rinderpest infected cattle.It is acute
Type body temperature can rise to 41 DEG C, and continue 3~5 days.Infection animal is had the fidgets, and dorsal body setae is unglazed, and mouth and nose are dry, appetite stimulator.
Mucus purulent rhinorrhea is flowed, foul gas is breathed out.At first 4 days of fever, mucous membrane of mouth was congested, cheek mucous membrane progressive popularity damage
Evil leads to polysialia, gangrenosum acne lesion then occurs, starts mucous membrane of mouth and small coarse red superficial necrotic lesion occurs, with
After become pink, infection site includes lower lip, lower gums etc..The visible necrotic lesion of several cases involves tooth pad, palate, cheek
And its nipple, tongue etc..There is band blood watery diarrhea in later period, and serious dehydration is thin, therewith temperature decline.There is cough, exhale
It inhales abnormal.Disease incidence is up to 100%, and when seriously breaking out, the death rate 100%, in slight occur, the death rate is no more than
50%.Growing animal morbidity severe morbidity and dead all very high, a kind of disease delimited for China.
Because this virus has special affinity to gastrointestinal lymphoid cell and epithelial cell, therefore feature venereal disease can be caused
Become.Generally occur acidophilia cytoplasmic inclusions and multinucleate giant cell in infection cell.In lymphoid tissue, peste des petits ruminants disease
Poison can cause lymphocyte downright bad.Spleen, tonsillotome, lymph node cells are destroyed.The multicore of the cytoplasmic inclusions containing acidophilia is huge
Cell occurs, rarely intranuclear inclusion.In digestive system, it is bad that virus causes the epithelial cell in Ma Erjishi layer depth portion to occur
Extremely, infection cell generates karyopycnosis and karyorrhexis, and it is big and small to form the multicore containing acidophilia cytoplasmic inclusions in stratum germinativum epidermidis
Born of the same parents.
Currently, effective ways there is no to treat peste des petits ruminants, vaccine inoculation, epidemic situation can only be taken to slaughter and periodically after occurring
The method of sero monitoring is controlled.
Currently, peste des petits ruminants is mainly to be examined by the PPR virus antibody in detection biological sample
It is disconnected.World Organization for Animal Health recommends the PPR virus antibody detection method used mainly to have virus neutralization tests
(VNT) and enzyme-linked immunosorbent assay (ELISA).Wherein, the testing result of virus neutralization tests method is accurate, and being that detection is small ruminates beast
The goldstandard of epidemic disease poison, but this method detection time is long and is unsuitable for detecting great amount of samples.In contrast, enzyme-linked immunosorbent assay
Specificity and sensibility are higher, detection time is shorter than virus neutralization tests and therefore the suitable a large amount of samples of detection are widely used
In the detection of PPR virus antibody.
But in the presence of for PPR virus antibody, simultaneously nontarget organism suffers from peste des petits ruminants in biological sample
Positive evidence, this is the intrinsic deficiency that the diagnostic method of peste des petits ruminants is diagnosed by detection antibody.Thus, it is desirable to have directly
Detect the ELISA method of the PPR virus in biological sample.
But ELISA method is both needed to using monoclonal antibody, and just it has been observed that PPR virus is a kind of cyst membrane
Virus, the monoclonal antibody that can be used for ELISA method detection PPR virus are not readily available.
Summary of the invention
In view of above-mentioned problems of the prior art, the purpose of the present invention is to provide one kind can be specific and small anti-
The monoclonal antibody that hay epizootic disease virus combines, and the specificity of the monoclonal antibody is utilized and high small of sensibility ruminates beast
Epidemic disease diagnostic kit.
Inventor has made intensive studies to solve above-mentioned technical problem, and house is immunized with purified PPR virus
Rabbit is prepared for rabbit-anti PPR virus monoclonal antibody (code name: NMS-1-2H3L2), the rabbit-anti PPR virus list
Clonal antibody can specifically combine PPR virus, and can be used in preparing and ruminate beast based on the small of ELISA principle
Epidemic disease diagnostic kit.
That is, the present invention includes:
A kind of monoclonal antibody can be used for detecting PPR virus, it includes three complementary determining region of heavy chain
(CDR-H1, CDR-H2 and CDR-H3) and three complementary determining region of light chain (CDR-L1, CDR-L2 and CDR-L3), in which:
(a) amino acid sequence of CDR-H1 is as shown in SEQ ID NO:1;
(b) amino acid sequence of CDR-H2 is as shown in SEQ ID NO:2;
(c) amino acid sequence of CDR-H3 is as shown in SEQ ID NO:3;
(d) amino acid sequence of CDR-L1 is as shown in SEQ ID NO:4;
(e) amino acid sequence of CDR-L2 is as shown in SEQ ID NO:5;And
(f) amino acid sequence of CDR-L3 is as shown in SEQ ID NO:6;
Wherein,
SEQ ID NO:1:GIDLNSAT (one-letter symbol of amino acid, similarly hereinafter)
SEQ ID NO:2:IVSGSTN
SEQ ID NO:3:ARYAGTIAYQWYFNI
SEQ ID NO:4:ESISSI
SEQ ID NO:5:RTS
SEQ ID NO:6:QQGVSNSNVDNI;
Or include three complementary determining region of heavy chain (CDR-H4, CDR-H5 and CDR-H6) and three complementary determining region of light chain
(CDR-L4, CDR-L5 and CDR-L6), in which:
(g) amino acid sequence of CDR-H4 is as shown in SEQ ID NO:9;
(h) amino acid sequence of CDR-H5 is as shown in SEQ ID NO:10;
(i) amino acid sequence of CDR-H6 is as shown in SEQ ID NO:11;
(j) amino acid sequence of CDR-L4 is as shown in SEQ ID NO:12;
(k) amino acid sequence of CDR-L5 is as shown in SEQ ID NO:13;And
(l) amino acid sequence of CDR-L6 is as shown in SEQ ID NO:14;
Wherein,
SEQ ID NO:9:GIDLGGYA
SEQ ID NO:10:IDTTDS
SEQ ID NO:11:ARYAGDGGGGYFFDY
SEQ ID NO:12:QSVYNNNC
SEQ ID NO:13:GAS
SEQ ID NO:14:VGAYIGSNYA;
Or include three complementary determining region of heavy chain (CDR-H7, CDR-H8 and CDR-H9) and three complementary determining region of light chain
(CDR-L7, CDR-L8 and CDR-L9), in which:
(m) amino acid sequence of CDR-H7 is as shown in SEQ ID NO:17;
(n) amino acid sequence of CDR-H8 is as shown in SEQ ID NO:18;
(o) amino acid sequence of CDR-H9 is as shown in SEQ ID NO:19;
(p) amino acid sequence of CDR-L7 is as shown in SEQ ID NO:10;
(q) amino acid sequence of CDR-L8 is as shown in SEQ ID NO:21;And
(r) amino acid sequence of CDR-L9 is as shown in SEQ ID NO:22;
Wherein,
SEQ ID NO:17:GIDLGGYA
SEQ ID NO:18:IDTTDS
SEQ ID NO:19:ARYAGDGGGGYFFDY
SEQ ID NO:10:QSIYNN
SEQ ID NO:21:EAS
SEQ ID NO:22:QQGYSITNVDNT.
Above-mentioned monoclonal antibody, it includes heavy chains and light chain, wherein
The amino acid sequence such as SEQ of heavy chain comprising three complementary determining region of heavy chain (CDR-H1, CDR-H2 and CDR-H3)
Shown in ID NO:7;
The amino acid sequence such as SEQ of light chain comprising three complementary determining region of light chain (CDR-L1, CDR-L2 and CDR-L3)
Shown in ID NO:8;
Wherein,
SEQ ID NO:7:
CQSLEESGGRLVTPGGSLTLTCTVSGIDLNSATVGWVRQAPGKGLEWIGDIVSGSTNTDYANWASGRFT
ISKTSSTTVDLKMTSLTTEDTATYFCARYAGTIAYQWYFNIWGPGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTL
GCLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVAPSTCSK
PTCPPPELLGGPSVFIFPPKPKDTLMISRTPEVTCVVVDVSQDDPEVQFTWYINNEQVRTARPPLREQQFNSTIRVV
STLPIAHQDWLRGKEFKCKVHNKALPAPIEKTISKARGQPLEPKVYTMGPPREELSSRSVSLTCMINGFYPSDISVE
WEKNGKAEDNYKTTPAVLDSDGSYFLYSKLSVPTSEWQRGDVFTCSVMHEALHNHYTQKSISRSPGK
SEQ ID NO:8:
DVVMTQTPASVEVAVGGTVTIKCQASESISSILAWYQQKPGQRPNLLMYRTSTLASGVSSRFKGSGSGT
DFTLTISGVQCDDAATYYCQQGVSNSNVDNIFGGGTEVVVTGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDV
TVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC
The amino acid sequence such as SEQ of heavy chain comprising three complementary determining region of heavy chain (CDR-H4, CDR-H5 and CDR-H6)
Shown in ID NO:15;
The amino acid sequence such as SEQ of light chain comprising three complementary determining region of light chain (CDR-L4, CDR-L5 and CDR-L6)
Shown in ID NO:16;
Wherein,
SEQ ID NO:15:
CQSLEESGGRLVTPGGSLTLTCTVSGIDLGGYAVGWVRQAPGKGLEYIGIIDTTDSTYYASWAKGRFTS
SKTSSTTVDLKMTSLTTEDTATYFCARYAGDGGGGYFFDYWGSGTLVTITSGQPKAPSVFPLAPCCGDTPSSTVTLG
CLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVAPSTCSKP
TCPPPELLGGPSVFIFPPKPKDTLMISRTPEVTCVVVDVSQDDPEVQFTWYINNEQVRTARPPLREQQFNSTIRVVS
TLPIAHQDWLRGKEFKCKVHNKALPAPIEKTISKARGQPLEPKVYTMGPPREELSSRSVSLTCMINGFYPSDISVEW
EKNGKAEDNYKTTPAVLDSDGSYFLYSKLSVPTSEWQRGDVFTCSVMHEALHNHYTQKSISRSPGK
SEQ ID NO:16:
AAVLTQTPSPISAAVGGTVTINCQSSQSVYNNNCLSWYQQKPGQPPKFLIYGASTLASGVPSRFKGSGS
GTEFTLTISDVQCADAATYYCVGAYIGSNYAFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDV
TVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC
The amino acid sequence such as SEQ of heavy chain comprising three complementary determining region of heavy chain (CDR-H7, CDR-H8 and CDR-H9)
Shown in ID NO:23;
The amino acid sequence such as SEQ of light chain comprising three complementary determining region of light chain (CDR-L7, CDR-L8 and CDR-L9)
Shown in ID NO:24;
Wherein,
SEQ ID NO:23:
CQSLEESGGRLVTPGGSLTLTCTVSGIDLGGYAVGWVRQAPGKGLEYIGIIDTTDSTYYASWAKGRFTS
SKTSSTTVDLKMTSLTTEDTATYFCARYAGDGGGGYFFDYWGSGTLVTITSGQPKAPSVFPLAPCCGDTPSSTVTLG
CLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVAPSTCSKP
TCPPPELLGGPSVFIFPPKPKDTLMISRTPEVTCVVVDVSQDDPEVQFTWYINNEQVRTARPPLREQQFNSTIRVVS
TLPIAHQDWLRGKEFKCKVHNKALPAPIEKTISKARGQPLEPKVYTMGPPREELSSRSVSLTCMINGFYPSDISVEW
EKNGKAEDNYKTTPAVLDSDGSYFLYSKLSVPTSEWQRGDVFTCSVMHEALHNHYTQKSISRSPGK
SEQ ID NO:24:
AAVLTQTPSPISAAVGGTVTINCQSSQSVYNNNCLSWYQQKPGQPPKFLIYGASTLASGVPSRFKGSG
SGTEFTLTISDVQCADAATYYCVGAYIGSNYAFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFP
DVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC。
A kind of detection device comprising substrate and the said monoclonal antibody being fixed in the substrate.
Above-mentioned detection device is used in the biological sample of test object biological source with the presence or absence of peste des petits ruminants disease
Poison.
Above-mentioned detection device, wherein the object organisms are goat or sheep.
Above-mentioned detection device, wherein the biological sample is whole blood, blood plasma or serum.
Whether a kind of peste des petits ruminants diagnostic kit is used in the biological sample by test object biological source deposit
In PPR virus, diagnose whether object organisms suffer from peste des petits ruminants.
Above-mentioned peste des petits ruminants diagnostic kit, wherein the object organisms are goat or sheep.
Above-mentioned peste des petits ruminants diagnostic kit, wherein the biological sample is whole blood, blood plasma or serum.
The specific embodiment of invention
Embodiment 1 is used as the purifying of the PPR virus of antigen
1.1 purifying concentration systems: desk-top membrane filtration system, AKTA Pure Protein purification chromatographic system, high speed refrigerated centrifuge
Machine, superspeed refrigerated centrifuge, 500K hollow fiber column, 100kd ultra-filtration centrifuge tube.
1.2 main agents: 0.02mol/L PBS, 0.5N NaOH solution sephrose 6FF chromatography media, sucrose.
The preparation of 1.3 antigens and clarification
Under aseptic condition, 2000mL PPR virus antigen, 4 DEG C, 5000rpm centrifugation 30min are taken.Precipitating is abandoned, is taken
Supernatant is for being concentrated by ultrafiltration.
1.4 concentrating and purifying
1.4.1,500K hollow fiber column and pipeline, then the hollow fiber column with 2%NaOH lye wash cycles 500K are installed
And soaked overnight, then to neutrality and water flux is surveyed with residual lye in purified water washing hollow-fiber column.It is flat with sterile PBS liquid
Weigh hollow fiber column.
1.4.2 the feed liquor of sterile connection hollow fiber column and concentration is carried out after returning liquid, when processing keeps pump revolution to exist
Between 10%~15%.Sample detection when every batch of sample distinguishes cycles of concentration to 6 times, with sterile PBS 6 times of concentrates of continuous filter wash
4 times, liquid is gone out with filter wash and calculates filter wash number (i.e. filter wash, which goes out when liquid volume is 5 times 2 times of concentrate, terminates filter wash), is taken respectively
Sample at least five after each filter wash.
1.4.3 gel filtration chromatography
It takes 24mL PPR that liquid is concentrated by ultrafiltration, carries out loading according to 5mL/min volume flow rate, use 0.02mol/L PBS (pH
=7.4, Cond=18.0ms/cm) it is eluted, it is collected according to 280 ultraviolet absorption peak of UV.
1.4.4 100KD ultrafiltration membrane is concentrated
Using Merck-Mi Libo 100KD ultra-filtration centrifuge tube, 5 times of concentrations are carried out to 1# absorption peak.
1.4.5 sucrose density gradient centrifugation
1mL sample is added in discontinuous sucrose density gradient (15%-80%) w/v solution, 35000rpm/min, 4 DEG C
It is centrifuged 3h, every 0.5mL collects 1 pipe, totally 23 pipe, number consecutively 1-23.Every pipe takes 70uL to carry out SDS-PAGE detection.
1.5 detection
No. 1-23 is managed, every pipe takes 70uL to carry out the detection of SDS-PAGE protein electrophoresis.Testing result shows 11-14
Protein concentration highest in number pipe.Therefore, merge the sample in 11-14 pipe, as immune antigen.
2 antigen of embodiment is immune, B cell is screened and the preparation of monoclonal antibody
Biotechnology Co., Ltd is insulted in antigen immunizing rabbit, B cell screening and the preparation of monoclonal antibody commission Hangzhou hundred
It completes.With the immune use antigen immunizing rabbit prepared in above-described embodiment 1, screened from the peripheral blood for completing the rabbit after being immunized
The single B cell of anti-PPR virus monoclonal antibody is secreted, and obtains the coding core of the monoclonal antibody by sequencing
Nucleotide sequence (so as to know the amino acid sequence of the monoclonal antibody, referring to SEQ ID NO:1-8).By by the coding
Nucleotide sequence is cloned into expression vector appropriate, and the expression vector is imported suitable host cell and carries out expression and pure
Change, to obtain monoclonal antibody NMS-1-2H3L2.
The preparation and application of 3 peste des petits ruminants diagnostic kit of embodiment (detection device)
Using conventional method on conventional ELISA solid phase carrier point sample said monoclonal antibody NMS-1-2H3L2
Solution, in addition one PB point of point sample is prepared for detection device (diagnostic kit) as negative Quality Control point.
Detecting step (antibody sandwich)
(1), with purified water by 20 × concentrated cleaning solutions (TBST:0.4M Tris-HCl, 2.74MNaCl, 2%Tween20,
PH7.2 ± 0.2) it is diluted by 1:20, obtain cleaning solution.It, will about 200 with liquid-transfering gun to make to detect device surface complete wetting
μ L cleaning solution is added to detection device surface, and impregnates detection device certain time.
It (2), will with Sample dilution (0.05MPBS, 1%BSA, 0.2%PVP, 0.5%Tween20, pH7.2 ± 0.2)
Test serum sample is diluted according to 1:50.
(3), for having discarded the detection device of cleaning solution, in the state that surface is completely wet, after drawing 200 μ L dilution
Serum sample be added to detection device on.
(4), it will test device in constant-temperature table with 150 revs/min to be incubated for 30 minutes, temperature is room temperature.
(5), serum sample is discarded, the surface of detection device is cleaned with cleaning solution.
(6), after cleaning, the molten of the monoclonal antibody NMS-1-2H3L2 of the HRP label of 200 μ L is added on detection device
Liquid will test device in constant-temperature table with 150 revs/min and be incubated for 30 minutes, and temperature is room temperature.
(7), enzyme labelled antibody solution is discarded, device surface is will test with cleaning solution and cleans up.
(8), after the completion of cleaning, luminous substrate liquid (Thermo, the Prod# of 20 μ L are uniformly sprawled on detection device surface
37074)。
(9), chemiluminescence imaging will be carried out to detection device with gel imager, and determines result.
(10), result judgement: for every a serum, the monoclonal antibody NMS-1- on the detection device is counted respectively
Whether 2H3L2 has response (that is, signal-to-noise ratio (SNR) is more than or equal to 2), and is determined.That is,
When detecting that monoclonal antibody NMS-1-2H3L2 has response, it is determined as the PPR virus positive;Conversely,
It is determined as feminine gender.
Wherein, signal-to-noise ratio=(polypeptide point signal value-negative control point signal value)/negative control point signal value.Polypeptide point
Signal value refers to the chemiluminescence intensity value for the polypeptide point that software is read, and negative control point signal value refers to the feminine gender that software is read
The chemiluminescence intensity value of control point.
For 800 parts of goats and sheep serum sample from China regions, be respectively adopted above-mentioned diagnostic kit with
And viral nucleic acid amplification is detected, testing result is as follows.
1 800 portions of goats of table and sheep serum pattern detection result
Sensibility=493/560*100%=88%
Specificity=224/240=93%
As known from the above, the sensibility and specificity of the diagnostic kit (and is using nucleic acid amplification 85% or more
Method validation is not the verifying of other contrast agents cassette methods), fully meet the requirement of disease diagnosis.
Embodiment 4 is used as the purifying of the PPR virus of antigen
1.1 purifying concentration systems: desk-top membrane filtration system, AKTA Pure Protein purification chromatographic system, high speed refrigerated centrifuge
Machine, superspeed refrigerated centrifuge, 500K hollow fiber column, 100kd ultra-filtration centrifuge tube.
1.2 main agents: 0.02mol/L PBS, 0.5N NaOH solution sephrose 6FF chromatography media, sucrose.
The preparation of 1.3 antigens and clarification
Under aseptic condition, 2000mL PPR virus antigen, 4 DEG C, 5000rpm centrifugation 30min are taken.Precipitating is abandoned, is taken
Supernatant is for being concentrated by ultrafiltration.
1.4 concentrating and purifying
1.4.1,500K hollow fiber column and pipeline, then the hollow fiber column with 2%NaOH lye wash cycles 500K are installed
And soaked overnight, then to neutrality and water flux is surveyed with residual lye in purified water washing hollow-fiber column.It is flat with sterile PBS liquid
Weigh hollow fiber column.
1.4.2 the feed liquor of sterile connection hollow fiber column and concentration is carried out after returning liquid, when processing keeps pump revolution to exist
Between 10%~15%.Sample detection when every batch of sample distinguishes cycles of concentration to 6 times, with sterile PBS 6 times of concentrates of continuous filter wash
4 times, liquid is gone out with filter wash and calculates filter wash number (i.e. filter wash, which goes out when liquid volume is 5 times 2 times of concentrate, terminates filter wash), is taken respectively
Sample at least five after each filter wash.
1.4.3 gel filtration chromatography
It takes 24mL PPR that liquid is concentrated by ultrafiltration, carries out loading according to 5mL/min volume flow rate, use 0.02mol/L PBS (pH
=7.4, Cond=18.0ms/cm) it is eluted, it is collected according to 280 ultraviolet absorption peak of UV.
1.4.4 100KD ultrafiltration membrane is concentrated
Using Merck-Mi Libo 100KD ultra-filtration centrifuge tube, 5 times of concentrations are carried out to 1# absorption peak.
1.4.5 sucrose density gradient centrifugation
1mL sample is added in discontinuous sucrose density gradient (15%-80%) w/v solution, 35000rpm/min, 4 DEG C
It is centrifuged 3h, every 0.5mL collects 1 pipe, totally 23 pipe, number consecutively 1-23.Every pipe takes 70uL to carry out SDS-PAGE detection.
1.5 detection
No. 1-23 is managed, every pipe takes 70uL to carry out the detection of SDS-PAGE protein electrophoresis.Testing result shows 11-14
Protein concentration highest in number pipe.Therefore, merge the sample in 11-14 pipe, as immune antigen.
5 antigen of embodiment is immune, B cell is screened and the preparation of monoclonal antibody
Biotechnology Co., Ltd is insulted in antigen immunizing rabbit, B cell screening and the preparation of monoclonal antibody commission Hangzhou hundred
It completes.With the immune use antigen immunizing rabbit prepared in above-described embodiment 4, screened from the peripheral blood for completing the rabbit after being immunized
The single B cell of anti-PPR virus monoclonal antibody is secreted, and obtains the coding core of the monoclonal antibody by sequencing
Nucleotide sequence (so as to know the amino acid sequence of the monoclonal antibody, referring to SEQ ID NO:9-16).By by the volume
Code nucleotide sequence is cloned into expression vector appropriate, and the expression vector is imported suitable host cell and carries out expression and pure
Change, to obtain monoclonal antibody NMS-1-17H6L3.
The preparation and application of 6 peste des petits ruminants diagnostic kit of embodiment (detection device)
Using conventional method on conventional ELISA solid phase carrier point sample said monoclonal antibody NMS-1-17H6L3
Solution, in addition one PB point of point sample is prepared for detection device (diagnostic kit) as negative Quality Control point.
Detecting step (antibody sandwich)
(1), with purified water by 20 × concentrated cleaning solutions (TBST:0.4M Tris-HCl, 2.74MNaCl, 2%Tween20,
PH7.2 ± 0.2) it is diluted by 1:20, obtain cleaning solution.It, will about 200 with liquid-transfering gun to make to detect device surface complete wetting
μ L cleaning solution is added to detection device surface, and impregnates detection device certain time.
It (2), will with Sample dilution (0.05MPBS, 1%BSA, 0.2%PVP, 0.5%Tween20, pH7.2 ± 0.2)
Test serum sample is diluted according to 1:50.
(3), for having discarded the detection device of cleaning solution, in the state that surface is completely wet, after drawing 200 μ L dilution
Serum sample be added to detection device on.
(4), it will test device in constant-temperature table with 150 revs/min to be incubated for 30 minutes, temperature is room temperature.
(5), serum sample is discarded, the surface of detection device is cleaned with cleaning solution.
(6), after cleaning, the molten of the monoclonal antibody NMS-1-17H6L3 of the HRP label of 200 μ L is added on detection device
Liquid will test device in constant-temperature table with 150 revs/min and be incubated for 30 minutes, and temperature is room temperature.
(7), enzyme labelled antibody solution is discarded, device surface is will test with cleaning solution and cleans up.
(8), after the completion of cleaning, luminous substrate liquid (Thermo, the Prod# of 20 μ L are uniformly sprawled on detection device surface
37074)。
(9), chemiluminescence imaging will be carried out to detection device with gel imager, and determines result.
(10), result judgement: for every a serum, the monoclonal antibody NMS-1- on the detection device is counted respectively
Whether 17H6L3 has response (that is, signal-to-noise ratio (SNR) is more than or equal to 2), and is determined.That is,
When detecting that monoclonal antibody NMS-1-17H6L3 has response, it is determined as the PPR virus positive;Conversely,
It is determined as feminine gender.
Wherein, signal-to-noise ratio=(polypeptide point signal value-negative control point signal value)/negative control point signal value.Polypeptide point
Signal value refers to the chemiluminescence intensity value for the polypeptide point that software is read, and negative control point signal value refers to the feminine gender that software is read
The chemiluminescence intensity value of control point.
For 800 parts of goats and sheep serum sample from China regions, be respectively adopted above-mentioned diagnostic kit with
And viral nucleic acid amplification is detected, testing result is as follows.
2 800 portions of goats of table and sheep serum pattern detection result
Sensibility=505/560*100%=90%
Specificity=226/240=94%
As known from the above, the sensibility and specificity of the diagnostic kit (and is using nucleic acid amplification 85% or more
Method validation is not the verifying of other contrast agents cassette methods), fully meet the requirement of disease diagnosis.
Embodiment 7 is used as the purifying of the PPR virus of antigen
1.1 purifying concentration systems: desk-top membrane filtration system, AKTA Pure Protein purification chromatographic system, high speed refrigerated centrifuge
Machine, superspeed refrigerated centrifuge, 500K hollow fiber column, 100kd ultra-filtration centrifuge tube.
1.2 main agents: 0.02mol/L PBS, 0.5N NaOH solution sephrose 6FF chromatography media, sucrose.
The preparation of 1.3 antigens and clarification
Under aseptic condition, 2000mL PPR virus antigen, 4 DEG C, 5000rpm centrifugation 30min are taken.Precipitating is abandoned, is taken
Supernatant is for being concentrated by ultrafiltration.
1.4 concentrating and purifying
1.4.1,500K hollow fiber column and pipeline, then the hollow fiber column with 2%NaOH lye wash cycles 500K are installed
And soaked overnight, then to neutrality and water flux is surveyed with residual lye in purified water washing hollow-fiber column.It is flat with sterile PBS liquid
Weigh hollow fiber column.
1.4.2 the feed liquor of sterile connection hollow fiber column and concentration is carried out after returning liquid, when processing keeps pump revolution to exist
Between 10%~15%.Sample detection when every batch of sample distinguishes cycles of concentration to 6 times, with sterile PBS 6 times of concentrates of continuous filter wash
4 times, liquid is gone out with filter wash and calculates filter wash number (i.e. filter wash, which goes out when liquid volume is 5 times 2 times of concentrate, terminates filter wash), is taken respectively
Sample at least five after each filter wash.
1.4.3 gel filtration chromatography
It takes 24mL PPR that liquid is concentrated by ultrafiltration, carries out loading according to 5mL/min volume flow rate, use 0.02mol/L PBS (pH
=7.4, Cond=18.0ms/cm) it is eluted, it is collected according to 280 ultraviolet absorption peak of UV.
1.4.4 100KD ultrafiltration membrane is concentrated
Using Merck-Mi Libo 100KD ultra-filtration centrifuge tube, 5 times of concentrations are carried out to 1# absorption peak.
1.4.5 sucrose density gradient centrifugation
1mL sample is added in discontinuous sucrose density gradient (15%-80%) w/v solution, 35000rpm/min, 4 DEG C
It is centrifuged 3h, every 0.5mL collects 1 pipe, totally 23 pipe, number consecutively 1-23.Every pipe takes 70uL to carry out SDS-PAGE detection.
1.5 detection
No. 1-23 is managed, every pipe takes 70uL to carry out the detection of SDS-PAGE protein electrophoresis.Testing result shows 11-14
Protein concentration highest in number pipe.Therefore, merge the sample in 11-14 pipe, as immune antigen.
8 antigen of embodiment is immune, B cell is screened and the preparation of monoclonal antibody
Biotechnology Co., Ltd is insulted in antigen immunizing rabbit, B cell screening and the preparation of monoclonal antibody commission Hangzhou hundred
It completes.With the immune use antigen immunizing rabbit prepared in above-described embodiment 7, screened from the peripheral blood for completing the rabbit after being immunized
The single B cell of anti-PPR virus monoclonal antibody is secreted, and obtains the coding core of the monoclonal antibody by sequencing
Nucleotide sequence (so as to know the amino acid sequence of the monoclonal antibody, referring to SEQ ID NO:17-24).By by the volume
Code nucleotide sequence is cloned into expression vector appropriate, and the expression vector is imported suitable host cell and carries out expression and pure
Change, to obtain monoclonal antibody NMS-1-21H1L3.
The preparation and application of 9 peste des petits ruminants diagnostic kit of embodiment (detection device)
Using conventional method on conventional ELISA solid phase carrier point sample said monoclonal antibody NMS-1-21H1L3
Solution, in addition one PB point of point sample is prepared for detection device (diagnostic kit) as negative Quality Control point.
Detecting step (antibody sandwich)
(1), with purified water by 20 × concentrated cleaning solutions (TBST:0.4M Tris-HCl, 2.74MNaCl, 2%Tween20,
PH7.2 ± 0.2) it is diluted by 1:20, obtain cleaning solution.It, will about 200 with liquid-transfering gun to make to detect device surface complete wetting
μ L cleaning solution is added to detection device surface, and impregnates detection device certain time.
It (2), will with Sample dilution (0.05MPBS, 1%BSA, 0.2%PVP, 0.5%Tween20, pH7.2 ± 0.2)
Test serum sample is diluted according to 1:50.
(3), for having discarded the detection device of cleaning solution, in the state that surface is completely wet, after drawing 200 μ L dilution
Serum sample be added to detection device on.
(4), it will test device in constant-temperature table with 150 revs/min to be incubated for 30 minutes, temperature is room temperature.
(5), serum sample is discarded, the surface of detection device is cleaned with cleaning solution.
(6), after cleaning, the molten of the monoclonal antibody NMS-1-21H1L3 of the HRP label of 200 μ L is added on detection device
Liquid will test device in constant-temperature table with 150 revs/min and be incubated for 30 minutes, and temperature is room temperature.
(7), enzyme labelled antibody solution is discarded, device surface is will test with cleaning solution and cleans up.
(8), after the completion of cleaning, luminous substrate liquid (Thermo, the Prod# of 20 μ L are uniformly sprawled on detection device surface
37074)。
(9), chemiluminescence imaging will be carried out to detection device with gel imager, and determines result.
(10), result judgement: for every a serum, the monoclonal antibody NMS-1- on the detection device is counted respectively
Whether 21H1L3 has response (that is, signal-to-noise ratio (SNR) is more than or equal to 2), and is determined.That is,
When detecting that monoclonal antibody NMS-1-21H1L3 has response, it is determined as the PPR virus positive;Conversely,
It is determined as feminine gender.
Wherein, signal-to-noise ratio=(polypeptide point signal value-negative control point signal value)/negative control point signal value.Polypeptide point
Signal value refers to the chemiluminescence intensity value for the polypeptide point that software is read, and negative control point signal value refers to the feminine gender that software is read
The chemiluminescence intensity value of control point.
For 800 parts of goats and sheep serum sample from China regions, be respectively adopted above-mentioned diagnostic kit with
And viral nucleic acid amplification is detected, testing result is as follows.
The testing result of table 3 800 portions of goats and sheep serum sample
Sensibility=487/560*100%=87%
Specificity=221/240=92%
As known from the above, the sensibility and specificity of the diagnostic kit (and is using nucleic acid amplification 85% or more
Method validation is not the verifying of other contrast agents cassette methods), fully meet the requirement of disease diagnosis.
The above is only presently preferred embodiments of the present invention, is not intended to limit the invention in any way, it is all according to the present invention
Technical spirit any simple modification, change and equivalence change to the above embodiments, still fall within the technology of the present invention side
In the protection scope of case.
Sequence table
<110>Suzhou Institute of Nano-tech. and Nano-bionics, Chinese Academy of Sciences
<120>it can be used for detecting the monoclonal antibody and kit of PPR virus
<141> 2019-04-08
<150> CN201810932611.8
<151> 2018-08-16
<150> CN201810932595.2
<151> 2018-08-16
<150> CN201810932679.6
<151> 2018-08-16
<160> 24
<170> SIPOSequenceListing 1.0
<210> 1
<211> 8
<212> PRT
<213> Oryctolagus cuniculus
<400> 1
Gly Ile Asp Leu Asn Ser Ala Thr
1 5
<210> 2
<211> 7
<212> PRT
<213> Oryctolagus cuniculus
<400> 2
Ile Val Ser Gly Ser Thr Asn
1 5
<210> 3
<211> 15
<212> PRT
<213> Oryctolagus cuniculus
<400> 3
Ala Arg Tyr Ala Gly Thr Ile Ala Tyr Gln Trp Tyr Phe Asn Ile
1 5 10 15
<210> 4
<211> 6
<212> PRT
<213> Oryctolagus cuniculus
<400> 4
Glu Ser Ile Ser Ser Ile
1 5
<210> 5
<211> 3
<212> PRT
<213> Oryctolagus cuniculus
<400> 5
Arg Thr Ser
1
<210> 6
<211> 12
<212> PRT
<213> Oryctolagus cuniculus
<400> 6
Gln Gln Gly Val Ser Asn Ser Asn Val Asp Asn Ile
1 5 10
<210> 7
<211> 444
<212> PRT
<213> Oryctolagus cuniculus
<400> 7
Cys Gln Ser Leu Glu Glu Ser Gly Gly Arg Leu Val Thr Pro Gly Gly
1 5 10 15
Ser Leu Thr Leu Thr Cys Thr Val Ser Gly Ile Asp Leu Asn Ser Ala
20 25 30
Thr Val Gly Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile
35 40 45
Gly Asp Ile Val Ser Gly Ser Thr Asn Thr Asp Tyr Ala Asn Trp Ala
50 55 60
Ser Gly Arg Phe Thr Ile Ser Lys Thr Ser Ser Thr Thr Val Asp Leu
65 70 75 80
Lys Met Thr Ser Leu Thr Thr Glu Asp Thr Ala Thr Tyr Phe Cys Ala
85 90 95
Arg Tyr Ala Gly Thr Ile Ala Tyr Gln Trp Tyr Phe Asn Ile Trp Gly
100 105 110
Pro Gly Thr Leu Val Thr Val Ser Ser Gly Gln Pro Lys Ala Pro Ser
115 120 125
Val Phe Pro Leu Ala Pro Cys Cys Gly Asp Thr Pro Ser Ser Thr Val
130 135 140
Thr Leu Gly Cys Leu Val Lys Gly Tyr Leu Pro Glu Pro Val Thr Val
145 150 155 160
Thr Trp Asn Ser Gly Thr Leu Thr Asn Gly Val Arg Thr Phe Pro Ser
165 170 175
Val Arg Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Ser Val
180 185 190
Thr Ser Ser Ser Gln Pro Val Thr Cys Asn Val Ala His Pro Ala Thr
195 200 205
Asn Thr Lys Val Asp Lys Thr Val Ala Pro Ser Thr Cys Ser Lys Pro
210 215 220
Thr Cys Pro Pro Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Ile Phe
225 230 235 240
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val
245 250 255
Thr Cys Val Val Val Asp Val Ser Gln Asp Asp Pro Glu Val Gln Phe
260 265 270
Thr Trp Tyr Ile Asn Asn Glu Gln Val Arg Thr Ala Arg Pro Pro Leu
275 280 285
Arg Glu Gln Gln Phe Asn Ser Thr Ile Arg Val Val Ser Thr Leu Pro
290 295 300
Ile Ala His Gln Asp Trp Leu Arg Gly Lys Glu Phe Lys Cys Lys Val
305 310 315 320
His Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala
325 330 335
Arg Gly Gln Pro Leu Glu Pro Lys Val Tyr Thr Met Gly Pro Pro Arg
340 345 350
Glu Glu Leu Ser Ser Arg Ser Val Ser Leu Thr Cys Met Ile Asn Gly
355 360 365
Phe Tyr Pro Ser Asp Ile Ser Val Glu Trp Glu Lys Asn Gly Lys Ala
370 375 380
Glu Asp Asn Tyr Lys Thr Thr Pro Ala Val Leu Asp Ser Asp Gly Ser
385 390 395 400
Tyr Phe Leu Tyr Ser Lys Leu Ser Val Pro Thr Ser Glu Trp Gln Arg
405 410 415
Gly Asp Val Phe Thr Cys Ser Val Met His Glu Ala Leu His Asn His
420 425 430
Tyr Thr Gln Lys Ser Ile Ser Arg Ser Pro Gly Lys
435 440
<210> 8
<211> 214
<212> PRT
<213> Oryctolagus cuniculus
<400> 8
Asp Val Val Met Thr Gln Thr Pro Ala Ser Val Glu Val Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Lys Cys Gln Ala Ser Glu Ser Ile Ser Ser Ile
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Arg Pro Asn Leu Leu Met
35 40 45
Tyr Arg Thr Ser Thr Leu Ala Ser Gly Val Ser Ser Arg Phe Lys Gly
50 55 60
Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Gly Val Gln Cys
65 70 75 80
Asp Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Gly Val Ser Asn Ser Asn
85 90 95
Val Asp Asn Ile Phe Gly Gly Gly Thr Glu Val Val Val Thr Gly Asp
100 105 110
Pro Val Ala Pro Thr Val Leu Ile Phe Pro Pro Ala Ala Asp Gln Val
115 120 125
Ala Thr Gly Thr Val Thr Ile Val Cys Val Ala Asn Lys Tyr Phe Pro
130 135 140
Asp Val Thr Val Thr Trp Glu Val Asp Gly Thr Thr Gln Thr Thr Gly
145 150 155 160
Ile Glu Asn Ser Lys Thr Pro Gln Asn Ser Ala Asp Cys Thr Tyr Asn
165 170 175
Leu Ser Ser Thr Leu Thr Leu Thr Ser Thr Gln Tyr Asn Ser His Lys
180 185 190
Glu Tyr Thr Cys Lys Val Thr Gln Gly Thr Thr Ser Val Val Gln Ser
195 200 205
Phe Asn Arg Gly Asp Cys
210
<210> 9
<211> 8
<212> PRT
<213> Oryctolagus cuniculus
<400> 9
Gly Ile Asp Leu Gly Gly Tyr Ala
1 5
<210> 10
<211> 6
<212> PRT
<213> Oryctolagus cuniculus
<400> 10
Ile Asp Thr Thr Asp Ser
1 5
<210> 11
<211> 15
<212> PRT
<213> Oryctolagus cuniculus
<400> 11
Ala Arg Tyr Ala Gly Asp Gly Gly Gly Gly Tyr Phe Phe Asp Tyr
1 5 10 15
<210> 12
<211> 8
<212> PRT
<213> Oryctolagus cuniculus
<400> 12
Gln Ser Val Tyr Asn Asn Asn Cys
1 5
<210> 13
<211> 3
<212> PRT
<213> Oryctolagus cuniculus
<400> 13
Gly Ala Ser
1
<210> 14
<211> 10
<212> PRT
<213> Oryctolagus cuniculus
<400> 14
Val Gly Ala Tyr Ile Gly Ser Asn Tyr Ala
1 5 10
<210> 15
<211> 443
<212> PRT
<213> Oryctolagus cuniculus
<400> 15
Cys Gln Ser Leu Glu Glu Ser Gly Gly Arg Leu Val Thr Pro Gly Gly
1 5 10 15
Ser Leu Thr Leu Thr Cys Thr Val Ser Gly Ile Asp Leu Gly Gly Tyr
20 25 30
Ala Val Gly Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Tyr Ile
35 40 45
Gly Ile Ile Asp Thr Thr Asp Ser Thr Tyr Tyr Ala Ser Trp Ala Lys
50 55 60
Gly Arg Phe Thr Ser Ser Lys Thr Ser Ser Thr Thr Val Asp Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Thr Glu Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
Tyr Ala Gly Asp Gly Gly Gly Gly Tyr Phe Phe Asp Tyr Trp Gly Ser
100 105 110
Gly Thr Leu Val Thr Ile Thr Ser Gly Gln Pro Lys Ala Pro Ser Val
115 120 125
Phe Pro Leu Ala Pro Cys Cys Gly Asp Thr Pro Ser Ser Thr Val Thr
130 135 140
Leu Gly Cys Leu Val Lys Gly Tyr Leu Pro Glu Pro Val Thr Val Thr
145 150 155 160
Trp Asn Ser Gly Thr Leu Thr Asn Gly Val Arg Thr Phe Pro Ser Val
165 170 175
Arg Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Ser Val Thr
180 185 190
Ser Ser Ser Gln Pro Val Thr Cys Asn Val Ala His Pro Ala Thr Asn
195 200 205
Thr Lys Val Asp Lys Thr Val Ala Pro Ser Thr Cys Ser Lys Pro Thr
210 215 220
Cys Pro Pro Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Ile Phe Pro
225 230 235 240
Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
245 250 255
Cys Val Val Val Asp Val Ser Gln Asp Asp Pro Glu Val Gln Phe Thr
260 265 270
Trp Tyr Ile Asn Asn Glu Gln Val Arg Thr Ala Arg Pro Pro Leu Arg
275 280 285
Glu Gln Gln Phe Asn Ser Thr Ile Arg Val Val Ser Thr Leu Pro Ile
290 295 300
Ala His Gln Asp Trp Leu Arg Gly Lys Glu Phe Lys Cys Lys Val His
305 310 315 320
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Arg
325 330 335
Gly Gln Pro Leu Glu Pro Lys Val Tyr Thr Met Gly Pro Pro Arg Glu
340 345 350
Glu Leu Ser Ser Arg Ser Val Ser Leu Thr Cys Met Ile Asn Gly Phe
355 360 365
Tyr Pro Ser Asp Ile Ser Val Glu Trp Glu Lys Asn Gly Lys Ala Glu
370 375 380
Asp Asn Tyr Lys Thr Thr Pro Ala Val Leu Asp Ser Asp Gly Ser Tyr
385 390 395 400
Phe Leu Tyr Ser Lys Leu Ser Val Pro Thr Ser Glu Trp Gln Arg Gly
405 410 415
Asp Val Phe Thr Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
420 425 430
Thr Gln Lys Ser Ile Ser Arg Ser Pro Gly Lys
435 440
<210> 16
<211> 214
<212> PRT
<213> Oryctolagus cuniculus
<400> 16
Ala Ala Val Leu Thr Gln Thr Pro Ser Pro Ile Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ser Ser Gln Ser Val Tyr Asn Asn
20 25 30
Asn Cys Leu Ser Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Phe
35 40 45
Leu Ile Tyr Gly Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe
50 55 60
Lys Gly Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Asp Val
65 70 75 80
Gln Cys Ala Asp Ala Ala Thr Tyr Tyr Cys Val Gly Ala Tyr Ile Gly
85 90 95
Ser Asn Tyr Ala Phe Gly Gly Gly Thr Glu Val Val Val Lys Gly Asp
100 105 110
Pro Val Ala Pro Thr Val Leu Ile Phe Pro Pro Ala Ala Asp Gln Val
115 120 125
Ala Thr Gly Thr Val Thr Ile Val Cys Val Ala Asn Lys Tyr Phe Pro
130 135 140
Asp Val Thr Val Thr Trp Glu Val Asp Gly Thr Thr Gln Thr Thr Gly
145 150 155 160
Ile Glu Asn Ser Lys Thr Pro Gln Asn Ser Ala Asp Cys Thr Tyr Asn
165 170 175
Leu Ser Ser Thr Leu Thr Leu Thr Ser Thr Gln Tyr Asn Ser His Lys
180 185 190
Glu Tyr Thr Cys Lys Val Thr Gln Gly Thr Thr Ser Val Val Gln Ser
195 200 205
Phe Asn Arg Gly Asp Cys
210
<210> 17
<211> 8
<212> PRT
<213> Oryctolagus cuniculus
<400> 17
Gly Ile Asp Leu Gly Gly Tyr Ala
1 5
<210> 18
<211> 6
<212> PRT
<213> Oryctolagus cuniculus
<400> 18
Ile Asp Thr Thr Asp Asn
1 5
<210> 19
<211> 15
<212> PRT
<213> Oryctolagus cuniculus
<400> 19
Ala Arg Tyr Ala Gly Asp Gly Gly Gly Gly Tyr Phe Phe Asp Tyr
1 5 10 15
<210> 20
<211> 6
<212> PRT
<213> Oryctolagus cuniculus
<400> 20
Gln Ser Ile Tyr Asn Asn
1 5
<210> 21
<211> 3
<212> PRT
<213> Oryctolagus cuniculus
<400> 21
Glu Ala Ser
1
<210> 22
<211> 12
<212> PRT
<213> Oryctolagus cuniculus
<400> 22
Gln Gln Gly Tyr Ser Ile Thr Asn Val Asp Asn Thr
1 5 10
<210> 23
<211> 443
<212> PRT
<213> Oryctolagus cuniculus
<400> 23
Cys Gln Ser Leu Glu Glu Ser Gly Gly Arg Leu Val Thr Pro Gly Gly
1 5 10 15
Ser Leu Thr Leu Thr Cys Thr Val Ser Gly Ile Asp Leu Gly Gly Tyr
20 25 30
Ala Val Gly Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Tyr Ile
35 40 45
Gly Ile Ile Asp Thr Thr Asp Ser Thr Tyr Tyr Ala Ser Trp Ala Lys
50 55 60
Gly Arg Phe Thr Ser Ser Lys Thr Ser Ser Thr Thr Val Asp Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Thr Glu Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
Tyr Ala Gly Asp Gly Gly Gly Gly Tyr Phe Phe Asp Tyr Trp Gly Ser
100 105 110
Gly Thr Leu Val Thr Ile Thr Ser Gly Gln Pro Lys Ala Pro Ser Val
115 120 125
Phe Pro Leu Ala Pro Cys Cys Gly Asp Thr Pro Ser Ser Thr Val Thr
130 135 140
Leu Gly Cys Leu Val Lys Gly Tyr Leu Pro Glu Pro Val Thr Val Thr
145 150 155 160
Trp Asn Ser Gly Thr Leu Thr Asn Gly Val Arg Thr Phe Pro Ser Val
165 170 175
Arg Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Ser Val Thr
180 185 190
Ser Ser Ser Gln Pro Val Thr Cys Asn Val Ala His Pro Ala Thr Asn
195 200 205
Thr Lys Val Asp Lys Thr Val Ala Pro Ser Thr Cys Ser Lys Pro Thr
210 215 220
Cys Pro Pro Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Ile Phe Pro
225 230 235 240
Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
245 250 255
Cys Val Val Val Asp Val Ser Gln Asp Asp Pro Glu Val Gln Phe Thr
260 265 270
Trp Tyr Ile Asn Asn Glu Gln Val Arg Thr Ala Arg Pro Pro Leu Arg
275 280 285
Glu Gln Gln Phe Asn Ser Thr Ile Arg Val Val Ser Thr Leu Pro Ile
290 295 300
Ala His Gln Asp Trp Leu Arg Gly Lys Glu Phe Lys Cys Lys Val His
305 310 315 320
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Arg
325 330 335
Gly Gln Pro Leu Glu Pro Lys Val Tyr Thr Met Gly Pro Pro Arg Glu
340 345 350
Glu Leu Ser Ser Arg Ser Val Ser Leu Thr Cys Met Ile Asn Gly Phe
355 360 365
Tyr Pro Ser Asp Ile Ser Val Glu Trp Glu Lys Asn Gly Lys Ala Glu
370 375 380
Asp Asn Tyr Lys Thr Thr Pro Ala Val Leu Asp Ser Asp Gly Ser Tyr
385 390 395 400
Phe Leu Tyr Ser Lys Leu Ser Val Pro Thr Ser Glu Trp Gln Arg Gly
405 410 415
Asp Val Phe Thr Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
420 425 430
Thr Gln Lys Ser Ile Ser Arg Ser Pro Gly Lys
435 440
<210> 24
<211> 214
<212> PRT
<213> Oryctolagus cuniculus
<400> 24
Ala Ala Val Leu Thr Gln Thr Pro Ser Pro Ile Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ser Ser Gln Ser Val Tyr Asn Asn
20 25 30
Asn Cys Leu Ser Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Phe
35 40 45
Leu Ile Tyr Gly Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe
50 55 60
Lys Gly Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Asp Val
65 70 75 80
Gln Cys Ala Asp Ala Ala Thr Tyr Tyr Cys Val Gly Ala Tyr Ile Gly
85 90 95
Ser Asn Tyr Ala Phe Gly Gly Gly Thr Glu Val Val Val Lys Gly Asp
100 105 110
Pro Val Ala Pro Thr Val Leu Ile Phe Pro Pro Ala Ala Asp Gln Val
115 120 125
Ala Thr Gly Thr Val Thr Ile Val Cys Val Ala Asn Lys Tyr Phe Pro
130 135 140
Asp Val Thr Val Thr Trp Glu Val Asp Gly Thr Thr Gln Thr Thr Gly
145 150 155 160
Ile Glu Asn Ser Lys Thr Pro Gln Asn Ser Ala Asp Cys Thr Tyr Asn
165 170 175
Leu Ser Ser Thr Leu Thr Leu Thr Ser Thr Gln Tyr Asn Ser His Lys
180 185 190
Glu Tyr Thr Cys Lys Val Thr Gln Gly Thr Thr Ser Val Val Gln Ser
195 200 205
Phe Asn Arg Gly Asp Cys
210
Claims (9)
1. a kind of monoclonal antibody that can be used for detecting PPR virus, it includes three complementary determining region of heavy chain (CDR-
H1, CDR-H2 and CDR-H3) and three complementary determining region of light chain (CDR-L1, CDR-L2 and CDR-L3), in which:
(a) amino acid sequence of CDR-H1 is as shown in SEQ ID NO:1;
(b) amino acid sequence of CDR-H2 is as shown in SEQ ID NO:2;
(c) amino acid sequence of CDR-H3 is as shown in SEQ ID NO:3;
(d) amino acid sequence of CDR-L1 is as shown in SEQ ID NO:4;
(e) amino acid sequence of CDR-L2 is as shown in SEQ ID NO:5;And
(f) amino acid sequence of CDR-L3 is as shown in SEQ ID NO:6;
Or include three complementary determining region of heavy chain (CDR-H4, CDR-H5 and CDR-H6) and three complementary determining region of light chain
(CDR-L4, CDR-L5 and CDR-L6), in which:
(g) amino acid sequence of CDR-H4 is as shown in SEQ ID NO:9;
(h) amino acid sequence of CDR-H5 is as shown in SEQ ID NO:10;
(i) amino acid sequence of CDR-H6 is as shown in SEQ ID NO:11;
(j) amino acid sequence of CDR-L4 is as shown in SEQ ID NO:12;
(k) amino acid sequence of CDR-L5 is as shown in SEQ ID NO:13;And
(l) amino acid sequence of CDR-L6 is as shown in SEQ ID NO:14;
Or include three complementary determining region of heavy chain (CDR-H7, CDR-H8 and CDR-H9) and three complementary determining region of light chain
(CDR-L7, CDR-L8 and CDR-L9), in which:
(m) amino acid sequence of CDR-H7 is as shown in SEQ ID NO:17;
(n) amino acid sequence of CDR-H8 is as shown in SEQ ID NO:18;
(o) amino acid sequence of CDR-H9 is as shown in SEQ ID NO:19;
(p) amino acid sequence of CDR-L7 is as shown in SEQ ID NO:10;
(q) amino acid sequence of CDR-L8 is as shown in SEQ ID NO:21;And
(r) amino acid sequence of CDR-L9 is as shown in SEQ ID NO:22.
2. monoclonal antibody according to claim 1, it includes heavy chains and light chain, wherein
The amino acid sequence of heavy chain comprising three complementary determining region of heavy chain (CDR-H1, CDR-H2 and CDR-H3) such as SEQ ID
Shown in NO:7;
The amino acid sequence of light chain comprising three complementary determining region of light chain (CDR-L1, CDR-L2 and CDR-L3) such as SEQ ID
Shown in NO:8;
The amino acid sequence of heavy chain comprising three complementary determining region of heavy chain (CDR-H4, CDR-H5 and CDR-H6) such as SEQ ID
Shown in NO:15;
The amino acid sequence of light chain comprising three complementary determining region of light chain (CDR-L4, CDR-L5 and CDR-L6) such as SEQ ID
Shown in NO:16;
The amino acid sequence of heavy chain comprising three complementary determining region of heavy chain (CDR-H7, CDR-H8 and CDR-H9) such as SEQ ID
Shown in NO:23;
The amino acid sequence of light chain comprising three complementary determining region of light chain (CDR-L7, CDR-L8 and CDR-L9) such as SEQ ID
Shown in NO:24.
3. a kind of detection device comprising substrate and the monoclonal of any of claims 1 or 2 being fixed in the substrate
Antibody.
4. detection device according to claim 3 is used in the biological sample of test object biological source whether there is
PPR virus.
5. detection device according to claim 4, wherein the object organisms are goat or sheep.
6. detection device according to claim 4, wherein the biological sample is whole blood, blood plasma or serum.
7. a kind of peste des petits ruminants diagnostic kit is used to whether there is in the biological sample by test object biological source
Whether PPR virus, diagnosis object organisms suffer from peste des petits ruminants.
8. peste des petits ruminants diagnostic kit according to claim 7, wherein the object organisms are goat or sheep.
9. peste des petits ruminants diagnostic kit according to claim 7, wherein the biological sample be whole blood, blood plasma or
Serum.
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202011011141.5A CN112321706B (en) | 2018-08-16 | 2019-04-08 | Monoclonal antibody and diagnostic kit for diagnosing Peste des petits ruminants |
CN202011011137.9A CN112321705B (en) | 2018-08-16 | 2019-04-08 | Monoclonal antibody and diagnostic kit for diagnosing Peste des petits ruminants |
Applications Claiming Priority (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201810932595 | 2018-08-16 | ||
CN201810932611 | 2018-08-16 | ||
CN201810932679 | 2018-08-16 | ||
CN2018109325952 | 2018-08-16 | ||
CN2018109326118 | 2018-08-16 | ||
CN2018109326796 | 2018-08-16 |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202011011141.5A Division CN112321706B (en) | 2018-08-16 | 2019-04-08 | Monoclonal antibody and diagnostic kit for diagnosing Peste des petits ruminants |
CN202011011137.9A Division CN112321705B (en) | 2018-08-16 | 2019-04-08 | Monoclonal antibody and diagnostic kit for diagnosing Peste des petits ruminants |
Publications (2)
Publication Number | Publication Date |
---|---|
CN109810190A true CN109810190A (en) | 2019-05-28 |
CN109810190B CN109810190B (en) | 2020-12-22 |
Family
ID=66611513
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202011011141.5A Active CN112321706B (en) | 2018-08-16 | 2019-04-08 | Monoclonal antibody and diagnostic kit for diagnosing Peste des petits ruminants |
CN201910275169.0A Active CN109810190B (en) | 2018-08-16 | 2019-04-08 | Monoclonal antibody and kit for detecting peste des petits ruminants virus |
CN202011011137.9A Active CN112321705B (en) | 2018-08-16 | 2019-04-08 | Monoclonal antibody and diagnostic kit for diagnosing Peste des petits ruminants |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202011011141.5A Active CN112321706B (en) | 2018-08-16 | 2019-04-08 | Monoclonal antibody and diagnostic kit for diagnosing Peste des petits ruminants |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202011011137.9A Active CN112321705B (en) | 2018-08-16 | 2019-04-08 | Monoclonal antibody and diagnostic kit for diagnosing Peste des petits ruminants |
Country Status (1)
Country | Link |
---|---|
CN (3) | CN112321706B (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN102419369A (en) * | 2011-08-18 | 2012-04-18 | 云南出入境检验检疫局检验检疫技术中心 | Kit for detecting antibody against Peste des petits ruminants virus b-ELISA and preparation method thereof |
CN103308678A (en) * | 2013-05-31 | 2013-09-18 | 艾军 | Sandwiched ELISA (Enzyme-Linked Immunoassay) detection reagent for detecting peste des petits ruminant viruses as well as preparation and use methods of reagent |
Family Cites Families (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR100593213B1 (en) * | 2004-11-05 | 2006-06-28 | 대한민국 | Rapid Diagnostic Methods of Peste-des-Petits-Ruminants Using Recombinant Nucleocapsid Protein Expressed in Insect Cells and Monoclonal Antibody |
CN105017416A (en) * | 2015-07-07 | 2015-11-04 | 杨俊兴 | Peste des petitis ruminants virus N protein monoclonal antibody, test strip comprising same and preparation method thereof |
CN107586783A (en) * | 2016-07-06 | 2018-01-16 | 华中农业大学 | Anti- PPR virus N protein monoclonal antibody and its application |
CN106086240B (en) * | 2016-07-08 | 2019-12-13 | 中国农业科学院兰州兽医研究所 | immunomagnetic bead kit for detecting peste des petits ruminants virus antigen and application thereof |
CN106086239B (en) * | 2016-07-08 | 2020-03-27 | 中国农业科学院兰州兽医研究所 | Immunomagnetic bead kit for detecting peste des petits ruminants virus antigen and application thereof |
CN107238702B (en) * | 2017-06-22 | 2019-02-01 | 中国动物疫病预防控制中心 | Detect the enzyme linked immunological kit of PPR virus antibody |
CN107937352B (en) * | 2017-08-02 | 2020-09-29 | 北京世纪元亨动物防疫技术有限公司 | Colloidal gold immunochromatographic test strip for detecting peste des petits ruminants virus H protein antibody |
-
2019
- 2019-04-08 CN CN202011011141.5A patent/CN112321706B/en active Active
- 2019-04-08 CN CN201910275169.0A patent/CN109810190B/en active Active
- 2019-04-08 CN CN202011011137.9A patent/CN112321705B/en active Active
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN102419369A (en) * | 2011-08-18 | 2012-04-18 | 云南出入境检验检疫局检验检疫技术中心 | Kit for detecting antibody against Peste des petits ruminants virus b-ELISA and preparation method thereof |
CN103308678A (en) * | 2013-05-31 | 2013-09-18 | 艾军 | Sandwiched ELISA (Enzyme-Linked Immunoassay) detection reagent for detecting peste des petits ruminant viruses as well as preparation and use methods of reagent |
Non-Patent Citations (1)
Title |
---|
刘晓慧等: "小反刍兽疫病毒竞争ELISA检测试剂盒生产工艺研究", 《中国畜牧兽医》 * |
Also Published As
Publication number | Publication date |
---|---|
CN112321705B (en) | 2022-03-15 |
CN112321706A (en) | 2021-02-05 |
CN109810190B (en) | 2020-12-22 |
CN112321705A (en) | 2021-02-05 |
CN112321706B (en) | 2022-03-15 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN104407137B (en) | A kind of CSFV velogen strain and low virulent strain differentiate Test paper | |
CN105675873B (en) | A kind of detection kit and its application | |
AiHua et al. | A sensitive and specific IgM-ELISA for the serological diagnosis of human leptospirosis using a rLipL32/1-LipL21-OmpL1/2 fusion protein | |
CN111925436B (en) | Monoclonal antibody of African swine fever virus P30 protein and application thereof | |
CN104459144B (en) | A kind of PRV velogen strain and vaccine strain differentiate Test paper | |
CN113248579B (en) | Novel coronavirus (2019-ncov) epitope, antibody and application thereof | |
CN103059109B (en) | Mycoplasma pneumonia antigen, preparation method and immunodetection kit | |
CN105418738A (en) | A-type antigen polypeptide, fusion antigen polypeptide and vaccine of foot and mouth disease virus | |
CN106632619A (en) | Influenza A virus recombinant protein and preparation of monoclonal antibody thereof | |
CN106546742A (en) | A kind of gold mark detection test paper bar based on goat capripoxviruses and preparation method thereof | |
CN106018831B (en) | The mark GP50 of coenosis and the kit for diagnosing coenosis | |
CN110483625A (en) | A kind of Mycoplasma bovis imagination albumen MbovP732 and its application | |
CN109320606B (en) | Monoclonal antibody specifically binding to foot-and-mouth disease non-structural protein and application thereof | |
CN111848748B (en) | African swine fever virus truncated protein and application thereof in preparation of ELISA (enzyme-linked immunosorbent assay) detection kit | |
CN113092755A (en) | Colloidal gold test strip for detecting brucella antigen by sandwich method | |
CN106226520A (en) | Antigen of mycobacterium tuberculosis albumen Rv0865 and the application of B cell epitope peptide thereof | |
CN109810190A (en) | It can be used for detecting the monoclonal antibody and kit of PPR virus | |
CN102435732A (en) | Toxoplasma IgM antibody immunoblotting kit and preparation method thereof | |
CN102033128A (en) | Edwardsiella tarda rapid detection test paper as well as rapid detection method and application | |
US6593080B1 (en) | Diagnosis, prevention and treatment of calicivirus infection in humans | |
CN114989295A (en) | anti-MERS-CoV monoclonal antibody and application thereof | |
CN110346565A (en) | PPR virus antibody assay kit | |
CN112213493B (en) | Peste des petits ruminants detection kit capable of being used for distinguishing vaccine immunity from natural infection | |
CN113866428A (en) | Diagnostic reagent for screening children virus influenza by MxA and SAA | |
CN107064488A (en) | A kind of total antibody solid phase of CSFV serum blocks the preparation method of antigen used in ELISA kit |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |