CN109517799A - A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and CD22 and its application - Google Patents

A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and CD22 and its application Download PDF

Info

Publication number
CN109517799A
CN109517799A CN201811460000.4A CN201811460000A CN109517799A CN 109517799 A CN109517799 A CN 109517799A CN 201811460000 A CN201811460000 A CN 201811460000A CN 109517799 A CN109517799 A CN 109517799A
Authority
CN
China
Prior art keywords
gly
ser
leu
amino acid
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
CN201811460000.4A
Other languages
Chinese (zh)
Other versions
CN109517799B (en
Inventor
李俊芳
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Beijing American Kinge Biotech Co Ltd
Original Assignee
Beijing American Kinge Biotech Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Beijing American Kinge Biotech Co Ltd filed Critical Beijing American Kinge Biotech Co Ltd
Priority to CN201811460000.4A priority Critical patent/CN109517799B/en
Publication of CN109517799A publication Critical patent/CN109517799A/en
Priority to PCT/CN2019/122162 priority patent/WO2020108644A1/en
Application granted granted Critical
Publication of CN109517799B publication Critical patent/CN109517799B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/461—Cellular immunotherapy characterised by the cell type used
    • A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/463—Cellular immunotherapy characterised by recombinant expression
    • A61K39/4631—Chimeric Antigen Receptors [CAR]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464402—Receptors, cell surface antigens or cell surface determinants
    • A61K39/464411—Immunoglobulin superfamily
    • A61K39/464412—CD19 or B4
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464402—Receptors, cell surface antigens or cell surface determinants
    • A61K39/464411—Immunoglobulin superfamily
    • A61K39/464413—CD22, BL-CAM, siglec-2 or sialic acid binding Ig-related lectin 2
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A61P35/02—Antineoplastic agents specific for leukemia
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70517—CD8
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70521—CD28, CD152
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70575—NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3061—Blood cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86—Viral vectors
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C12N5/0602—Vertebrate cells
    • C12N5/0634—Cells from the blood or the immune system
    • C12N5/0636—T lymphocytes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
    • C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
    • C12N9/6472—Cysteine endopeptidases (3.4.22)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/22—Cysteine endopeptidases (3.4.22)
    • C12Y304/22062—Caspase-9 (3.4.22.62)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
    • A61K2239/48—Blood cells, e.g. leukemia or lymphoma
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15021—Viruses as such, e.g. new isolates, mutants or their genomic sequences
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15041—Use of virus, viral particle or viral elements as a vector
    • C12N2740/15043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/16011—Human Immunodeficiency Virus, HIV
    • C12N2740/16041—Use of virus, viral particle or viral elements as a vector
    • C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Abstract

The immunocyte and its application, the dual Chimeric antigen receptor for the dual Chimeric antigen receptor gene modification based on CD19 and CD22 that the present invention relates to a kind of include Chimeric antigen receptor CD19 and Chimeric antigen receptor CD22.The Chimeric antigen receptor includes that antigen-binding domains, transmembrane domain, costimulatory signal conducting region and CD3 ζ signal transduction structural domain and inducible suicide Fusion domain are connected in series.Identification the tumor surface antigen CD19 and CD22 of Chimeric antigen receptor energy specificity of the invention, compared to using other single Chimeric antigen receptor T cells, two kinds of antigen targeting CAR-T cells, which are used in combination, makes therapeutic effect more preferable, is not susceptible to CD19 escape, it is easier to alleviate disease.

Description

A kind of dual Chimeric antigen receptor gene modification based on CD19 and CD22 it is immune thin Born of the same parents and its application
Technical field
The present invention relates to the cellular immunotherapy fields of tumour more particularly to a kind of dual chimeric based on CD19 and CD22 The immunocyte of antigen receptor gene modification and its application, it is chimeric specially based on tomour specific target spot CD19 and CD22 The construction method of antigen receptor T (CAR-T) cell technology and its application in antineoplaston.
Background technique
With the development of tumour immunity theory and clinical technology, Chimeric antigen receptor T cell therapy (Chimeric Antigen receptor T-cell immunotherapy, CAR-T) become tumour immunity treatment most promising at present One of method.Generally, Chimeric antigen receptor CAR is by a tumor associated antigen combined area, extracellular hinge area, trans-membrane region and born of the same parents Interior signal transduction district's groups at.In general, the single-chain fragment that CAR includes antibody can be changed (Single chain fragment Variable, scFv) area or to tumor associated antigen (tumor associated antigen, TAA) have specificity knot Structural domain is closed, is coupled by the cytoplasmic domains of hinge and transmembrane region and T cell signal transduction molecule.The most common lymph is thin Born of the same parents' activated partial includes the T cell costimulation structural domain with T cell effector function triggering (such as CD3 ζ) sections in series.CAR The T cell that the adoptive immunotherapy of mediation allows CAR- to transplant is on non-HLA restrictive one Direct Recognition target tumour cell TAA.
It is most of with B cell malignant tumour (including B cell acute lymphatic leukemia (B cell acute Lymphocytic leukemia, leukemia, B-ALL) and chronic lymphocytic leukemia (chronic Lymphocytic leukemia, CLL) patient will be dead due to its disease.It is logical for treating a kind of method of these patients The expression for crossing CAR carries out genetic modification to T cell to target the antigen expressed on tumour cell.CAR is that be designed to people white Cellular antigens (human leukocyte antigen, HLA) dependent/non-dependent mode identifies the antigen receptor of cell surface antigen. It attempts to have been achieved for promising success using the genetically modified cell of expression CAR to treat the patient of these types.
CD19 molecule is the hot spot treated in the potential target spot of bone-marrow-derived lymphocyte system tumour and CAR research, the table of CD19 It is the CAR target for safety test accepted extensively up to normal and malignant B cell is confined to.Target the chimeric of CD19 molecule The T cell (CD19 CAR-T) of antigen receptor gene modification is on treating multiple, intractable B-lineage Acute Lymphocyte Leukemia Immense success is obtained, and in the treatment of the chronic bone-marrow-derived lymphocyte leukaemia of intractable, recurrent and bone-marrow-derived lymphocyte system lymthoma Curative effect is obviously poor.
104788573 A of CN has disclosed a kind of Chimeric antigen receptor hCD19scFv-CD8 α-CD28-CD3 ζ and its use On the way, the second generation Chimeric antigen receptor by anti human CD 19 monoclonal antibody HI19a light chain and heavy chain variable region (hCD19scFv), People CD8 α hinge area, people CD28 transmembrane region and intracellular region and people's CD3 ζ intracellular region structures in series are constituted, the CD19 in the patent After carrying out a CAR-T cell and feeding back, the expression quantity of CD19 can be reduced, and be easy to escape from immunologic mechanism, and second generation CART Immune factor storm it is big, have the hidden worry of safety.
In addition, according to this center with the actual count of forth generation CD19 Chimeric antigen receptor treatment lymthoma, in 9 patients In the middle, wherein there is the patient of 4 tumor tissues immunohistochemical staining CD19 strong positives, receiving the treatment of CD19 Chimeric antigen receptor All reach complete incidence graph afterwards, in addition the patient of 5 CD19 weak expressions, only 1 reaches alleviation after the treatment, remaining 2 only Part is alleviated, the stabilization of 1 maintenance disease, 1 disease has progressed, this bearing reaction is single with CD19 is embedding and antigen receptor treatment Predicament.
Therefore, for the recurrence of CD19 feminine gender and the B cell tumour of CD19 low expression, combine another potential chimeric Antigen receptor is able to solve the easily mutation problem low with expression quantity existing for CD19 and is particularly important.In addition to CD19, CD22 is also It is the potentiality target spot for treating malignant B cell tumour, the CD22 cell surface of expression in B cell system as CD19.According to elder generation The studies have shown that CD22 of preceding anti-CD22 antibody clinical test has been evaluated and has been confirmed as the good for the treatment of B cell malignant tumour Target.
Therefore, a kind of strong specific, high targeting is found, the Chimeric antigen receptor of CART therapeutic effect can be effectively improved Just it is particularly important.
Summary of the invention
For in current CAR-T technology treatment tumour single targeting long-term effect is not very ideal and tumour micro-loop Border influences the case where CAR-T technology therapeutic effect, and the present invention provides a kind of dual Chimeric antigen receptor based on CD19 and CD22 The immunocyte of gene modification and its application, combined needle has strong special the dual tumor targets of CD19 and CD22 to the present invention for the first time The effect of CART treatment can effectively be improved and be extended to the characteristics of anisotropic, high targeting, for surface antigen CD19 and CD22 Positive leukaemia or B cell lymphoma has better therapeutic effect, is effectively prevented from the escape of missing the target of single target spot.
To achieve this purpose, the present invention adopts the following technical scheme:
On the one hand, the present invention provides a kind of the immune thin of the dual Chimeric antigen receptor gene modification based on CD19 and CD22 Born of the same parents, the dual Chimeric antigen receptor include Chimeric antigen receptor CD19 and Chimeric antigen receptor CD22.
In the present invention, by by antigen-binding domains combination tumor surface antigen CD19 and CD22, then pass through slow virus Carrier modifies T cell, so that the combination that tumor surface antigen CD19 and CD22 can be special is in the embedding of the application It closes on antigen receptor, CAR-T cell can eliminate the tumour cell of CD19 and CD22 simultaneously, effectively avoid tumor-cell antigen table It escapes up to reduction, while enhancing the permanent immunity effect of CAR-T cell.
In the present invention, the dual Chimeric antigen receptor can be individual CD19 Chimeric antigen receptor and individual CD22 When Chimeric antigen receptor is used in combination, it is also possible to join CD19 Chimeric antigen receptor and CD22 Chimeric antigen receptor Conjunction is expressed as dual Chimeric antigen receptor, i.e. antigen-binding domains are that can combine tumor surface antigen CD19 and CD22, this The combination therapy of two kinds of Chimeric antigen receptors either way may be implemented.
According to the present invention, the Chimeric antigen receptor includes antigen-binding domains, transmembrane domain, costimulatory signal biography It leads area, CD3 ζ signal transduction structural domain and can induce suicide Fusion domain and be connected in series.
Preferably, the antigen-binding domains are for the single-chain antibody of tumor surface antigen CD19 and for tumour table The single-chain antibody of face antigens c D22.
According to the present invention, the T cell Chimerical receptor (CAR) and be directed to CD19 and CD22 antigen that the gene modification is transformed It is described below for the single-chain antibody (scFv) of binding structural domain.
In a specific embodiment, the amino acid sequence tool of the single-chain antibody for tumor surface antigen CD19 There is any one in amino acid sequence shown in (I), (II) or (III):
(I) there is the amino acid sequence as shown in SEQ ID NO.1；
(II) with amino acid sequence shown in SEQ ID NO.1 with >=90%, preferably >=95%, more preferably >=98%, most It is preferred that the amino acid sequence of >=99% homology；
(III) it modified with amino acid sequence shown in SEQ ID NO.1, replace, miss or add one or several ammonia The amino acid sequence that base acid obtains；
The amino acid sequence has the activity of the single-chain antibody for tumor surface antigen CD19；
It is as follows for the amino acid sequence (SEQ ID NO.1) of the single-chain antibody of tumor surface antigen CD19: DIQMTQTT SSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIA TYFCQQGNTLPYTFGGGTKLEITGSTSGSGKPGSGEGSTKGEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVS WIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWG QGTSVTVSS.
According to the present invention, it is described its have 90% or more homology amino acid sequence or through modification, substitution, lack or add The amino acid sequence for adding one or several amino acid to obtain can be substituted by other single-chain antibodies or humanization CD19 single-chain antibody, Its amino acid mutants still has the function of CD19 single-chain antibody.
In a specific embodiment, the amino acid sequence tool of the single-chain antibody for tumor surface antigen CD22 There is any one in amino acid sequence shown in (I), (II) or (III):
(I) there is the amino acid sequence as shown in SEQ ID NO.2；
(II) with amino acid sequence shown in SEQ ID NO.2 with >=90%, preferably >=95%, more preferably >=98%, most It is preferred that the amino acid sequence of >=99% homology；
(III) it modified with amino acid sequence shown in SEQ ID NO.2, replace, miss or add one or several ammonia The amino acid sequence that base acid obtains；
The amino acid sequence has the activity of the single-chain antibody for tumor surface antigen CD22；
It is as follows for the amino acid sequence (SEQ ID NO.2) of tumor surface antigen CD22 single-chain antibody:
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSILHSGVPSRFSGSGSG TDYSLTISNLEQEDFATYFCQQGNTLPWTFGGGTKLEIKGSTSGSGKPGSSEGSTKGEVQLVESGGGLVKPGGSLK LSCAASGFAFSIYDMSWVRQTPEKRLEWVAYISSGGGTTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYY CARHSGYGTHWGVLFAYWGQGTLVTVSA.
According to the present invention, it is described its have 90% or more homology amino acid sequence or through modification, substitution, lack or add The amino acid sequence for adding one or several amino acid to obtain can be substituted by other single-chain antibodies or humanization CD22 single-chain antibody, Its amino acid mutants still has the function of CD22 single-chain antibody.
According to the present invention, the Chimeric antigen receptor by slow virus carrier to T cell carry out genetic modification, CD19 and It is stronger to kill tumor effect in conjunction with tumor surface antigen CD19 and CD22 for the dual CAR-T cell of CD22.
According to the present invention, the transmembrane domain is CD28 transmembrane domain and/or CD8 α transmembrane domain, in some tools In body embodiment, transmembrane domain can be selected or modified by amino acid substitution.
According to the present invention, the costimulatory signal conducting region is CD28 signal transduction structural domain, CD27 signal transduction structure In domain or CD137 signal transduction structural domain any one or at least two combination, the CD28 signal transduction structural domain, The arrangement of CD27 signal transduction structural domain and CD137 signal transduction structural domain, those skilled in the art can according to need progress Adjustment, the arrangement different with CD137 signal transduction structural domain with CD27 signal transduction structural domain of CD28 signal transduction structural domain is not The Chimeric antigen receptor can be had an impact, the application is combined using the sequence of CD28-CD27.
According to the present invention, the forth generation CAR is to include 9 structure of Caspase with can induce suicide Fusion domain Domain, for amino acid sequence as shown in SEQ ID NO.3, amino acid sequence shown in the SEQ ID NO.3 is as follows:
GSGATNFSLLKQAGDVEENPGPMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKVDSSRDRNKP FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEGGGGSGGGGSGAMV GALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLA LLELARQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQ KDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETL DDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTSAS.
According to the present invention, the inducible suicide Fusion domain is mutually gone here and there by 2A sequence with CD3 ζ signal transduction structural domain Connection, the 2A sequence can make the albumen and the Chimeric antigen receptor chopping up proteins of the inducible suicide Fusion domain expression It opens, so that the Chimeric antigen receptor can play a role, and by injection activator, melt so that can induce suicide Structural domain activation is closed, the T cell so as to cause expression Chimeric antigen receptor is dead and ineffective.
According to the present invention, the Chimeric antigen receptor further includes signal peptide, and the signal peptide is that can instruct chimeric antigen The signal peptide of receptor transmembrane transfer, those skilled in the art can according to need the signal peptide of selection this field routine, the letter Number peptide is Secretory signal peptide, and the Secretory signal peptide is the signal peptide of GMCSFR gene, and amino acid sequence can With as follows as shown in SEQ ID NO.8: MLLLVTSLLLCELPHPAFLLIP.
Preferably, the Secretory signal peptide is the signal peptide of CD8a gene, the ammonia of the Secretory signal peptide Base acid sequence is as follows as shown in SEQ ID NO.9: MALPVTALLLPLALLLHAARP.
Chimeric antigen receptor of the invention can also include hinge area, and described hinge area those skilled in the art can basis Actual conditions are selected, and do not do particular determination herein, the presence of hinge area will not be to the property of Chimeric antigen receptor of the invention It can have an impact.
According to the present invention, the Chimeric antigen receptor includes signal peptide, antigen-binding domains, transmembrane domain, altogether thorn Energizing signal conducting region, CD3 ζ signal transduction structural domain, 2A sequence and inducible suicide Fusion domain are connected in series.
As optimal technical scheme, the Chimeric antigen receptor is Secretory signal peptide, CD19 antigen-binding domains And/or CD22 antigen-binding domains, CD8 α and/or CD28 transmembrane domain, CD28 extracellular signal conducting structure domain, CD28 Cellular Signaling Transduction Mediated structural domain, CD27 Cellular Signaling Transduction Mediated structural domain, CD3 ζ Cellular Signaling Transduction Mediated structural domain, 2A sequence It is connected in series with FBKP.Casp9 structural domain, specific arrangement is as follows:
Secretory-CD19 scFv-CD28-CD27-CD3ζ-2A-FBKP.Casp9；
Secretory-CD22 scFv-CD28-CD27-CD3ζ-2A-FBKP.Casp9。
In a specific embodiment, the Chimeric antigen receptor Secretory-CD19scFv-CD28-CD27-CD3 The amino acid sequence of ζ -2A-FBKP.Casp9 has the amino acid of 90% or more homology as shown in SEQ ID NO.4 or with it Sequence, amino acid sequence shown in the SEQ ID NO.4 are as follows:
MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLE WMGWINTYTGEPTYADAFKGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDYGDYGMDYWGQGTTVTVSSGSTS GSGKPGSSEGSTKGDIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSFMHWYQQKPGQPPKLLIYLASNLESGV PDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSREVPWTFGQGTKVEIKAAAIEVMYPPPYLDNEKSNGTIIHVKG KHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPR DFAAYRSASGGGGSGGGGSQRRKYRSNKGESPVEPAEPCHYSCPREEEGSTIPIQEDYRKPEPACSPGGGGSGGGG SRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIG MKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRTSGSGATNFSLLKQAGDVEENPGPMGVQVETISPGDGRT FPKRGQTCVVHYTGMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGI IPPHATLVFDVELLKLEGGGGSGGGGSGAMVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSN IDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELARQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSV EKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLP TPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLF FKTSAS；
In a specific embodiment, the Chimeric antigen receptor Secretory-CD19 scFv-CD28-CD27- The nucleotide sequence of CD3 ζ -2A-FBKP.Casp9 has the nucleosides of 95% or more homology as shown in SEQ ID NO.5 or with it Acid sequence, nucleic acid sequence shown in the SEQ ID NO.5 are as follows:
ATGCTGCTGCTGGTCACAAGCCTGCTGCTGTGCGAGCTGCCCCACCCCGCCTTTCTGCTGATCCCCGA CATCCAGATGACCCAGACCACCAGCAGCCTGAGCGCCAGCCTGGGCGACAGAGTGACCATCAGCTGCCGGGCCAGC CAGGACATCAGCAAGTACCTGAACTGGTATCAGCAGAAACCCGACGGCACCGTGAAGCTGCTGATCTACCACACCA GCCGGCTGCACAGCGGCGTGCCCAGCAGATTTTCTGGCAGCGGATCTGGCACCGACTACAGCCTGACCATCTCCAA CCTGGAACAGGAAGATATCGCTACCTACTTCTGTCAGCAGGGCAACACCCTGCCCTACACCTTCGGCGGAGGCACC AAGCTGGAAATCACCGGCAGCACCAGCGGCTCCGGCAAGCCTGGATCTGGCGAGGGCAGCACCAAGGGCGAAGTGA AGCTGCAGGAAAGCGGCCCTGGCCTGGTCGCCCCTAGCCAGAGCCTGTCCGTGACCTGTACCGTGTCCGGCGTGTC CCTGCCCGACTACGGCGTGTCCTGGATCAGACAGCCCCCCAGAAAGGGCCTGGAATGGCTGGGCGTGATCTGGGGC AGCGAGACAACCTACTACAACAGCGCCCTGAAGTCCCGGCTGACCATCATCAAGGACAACAGCAAGAGCCAGGTGT TCCTGAAGATGAACAGCCTGCAGACCGACGACACCGCCATCTACTACTGCGCCAAGCACTACTACTACGGCGGCAG CTACGCCATGGACTACTGGGGCCAGGGCACCAGCGTGACAGTCTCTTCTGCGGCCGCAATTGAAGTTATGTATCCT CCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTCCAAGTCCCC TATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGGGGAGTCCTGGCTTGCTATAGCTTGCTAGT AACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACT CCCCGCCGCCCTGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCG CTAGCGGAGGTGGAGGTTCTGGAGGTGGTGGAAGTCAAAGAAGGAAGTACCGCAGCAACAAAGGAGAATCTCCCGT CGAGCCAGCCGAGCCCTGTCATTATTCATGCCCAAGGGAGGAGGAGGGAAGTACAATCCCAATTCAAGAAGACTAC AGGAAGCCCGAACCTGCATGCAGTCCAGGTGGAGGCGGTTCTGGAGGCGGTGGCTCCCGGGTGAAATTCTCACGGT CTGCAGACGCACCCGCTTACCAGCAAGGCCAGAACCAACTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTA CGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGC CTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGG GCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGC CCTGCCCCCTCGCACTAGTGGCTCCGGAGCCACGAACTTCTCTCTGTTAAAGCAAGCAGGAGACGTGGAAGAAAAC CCCGGTCCCATGGGAGTGCAGGTGGAAACCATCTCCCCAGGAGACGGGCGCACCTTCCCCAAGCGCGGCCAGACCT GCGTGGTGCACTACACCGGGATGCTTGAAGATGGAAAGAAAGTGGACTCCTCCCGGGACAGAAACAAGCCCTTTAA GTTTATGCTAGGCAAGCAGGAGGTGATCCGAGGCTGGGAAGAAGGGGTTGCCCAGATGAGTGTGGGTCAGAGAGCC AAACTGACTATATCTCCAGATTATGCCTATGGTGCCACTGGGCACCCAGGCATCATCCCACCACATGCCACTCTCG TCTTCGATGTGGAGCTTCTAAAACTGGAAGGTGGAGGCGGTTCAGGCGGCGGCGGCAGCGGCGCCATGGTCGGTGC TCTTGAGAGTTTGAGGGGAAATGCAGATTTGGCTTACATCCTGAGCATGGAGCCCTGTGGCCACTGCCTCATTATC AACAATGTGAACTTCTGCCGTGAGTCCGGGCTCCGCACCCGCACTGGCTCCAACATCGACTGTGAGAAGTTGCGGC GTCGCTTCTCCTCGCTGCATTTCATGGTGGAGGTGAAGGGCGACCTGACTGCCAAGAAAATGGTGCTGGCTTTGCT GGAGCTGGCGCGGCAGGACCACGGTGCTCTGGACTGCTGCGTGGTGGTCATTCTCTCTCACGGCTGTCAGGCCAGC CACCTGCAGTTCCCAGGGGCTGTCTACGGCACAGATGGATGCCCTGTGTCGGTCGAGAAGATTGTGAACATCTTCA ATGGGACCAGCTGCCCCAGCCTGGGAGGGAAGCCCAAGCTCTTTTTCATCCAGGCCTGTGGTGGGGAGCAGAAAGA CCATGGGTTTGAGGTGGCCTCCACTTCCCCTGAAGACGAGTCCCCTGGCAGTAACCCCGAGCCAGATGCCACCCCG TTCCAGGAAGGTTTGAGGACCTTCGACCAGCTGGACGCCATATCTAGTTTGCCCACACCCAGTGACATCTTTGTGT CCTACTCTACTTTCCCAGGTTTTGTTTCCTGGAGGGACCCCAAGAGTGGCTCCTGGTACGTTGAGACCCTGGACGA CATCTTTGAGCAGTGGGCTCACTCTGAAGACCTGCAGTCCCTCCTGCTTAGGGTCGCTAATGCTGTTTCGGTGAAA GGGATTTATAAACAGATGCCTGGTTGCTTTAATTTCCTCCGGAAAAAACTTTTCTTTAAAACATCAGCTAGTTAA.
In a specific embodiment, the Chimeric antigen receptor Secretory-CD22scFv-CD28-CD27-CD3 The amino acid sequence of ζ -2A-FBKP.Casp9 has the amino acid of 90% or more homology as shown in SEQ ID NO.6 or with it Sequence, amino acid sequence shown in the SEQ ID NO.6 are as follows:
MLLLVTSLLLCELPHPAFLLIPDIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKL LIYYTSILHSGVPSRFSGSGSGTDYSLTISNLEQEDFATYFCQQGNTLPWTFGGGTKLEIKGSTSGSGKPGSSEGS TKGEVQLVESGGGLVKPGGSLKLSCAASGFAFSIYDMSWVRQTPEKRLEWVAYISSGGGTTYYPDTVKGRFTISRD NAKNTLYLQMSSLKSEDTAMYYCARHSGYGTHWGVLFAYWGQGTLVTVSAAAAIEVMYPPPYLDNEKSNGTIIHVK GKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPP RDFAAYRSASGGGGSGGGGSQRRKYRSNKGESPVEPAEPCHYSCPREEEGSTIPIQEDYRKPEPACSPGGGGSGGG GSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEI GMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRTSGSGATNFSLLKQAGDVEENPGPMGVQVETISPGDGR TFPKRGQTCVVHYTGMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPG IIPPHATLVFDVELLKLEGGGGSGGGGSGAMVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGS NIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELARQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVS VEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSL PTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKL FFKTSAS；
In a specific embodiment, the Chimeric antigen receptor Secretory-CD22scFv-CD28-CD27-CD3 The nucleotide sequence of ζ -2A-FBKP.Casp9 has the nucleotide of 95% or more homology as shown in SEQ ID NO.7 or with it Sequence, nucleic acid sequence shown in the SEQ ID NO.7 are as follows:
ATGCTGCTCCTCGTTACAAGTCTGCTCCTGTGTGAACTGCCTCACCCTGCATTTCTGCTGATTCCAGA TATACAGATGACTCAAACCACATCCTCTCTGAGTGCTTCCCTGGGCGACCGCGTCACCATATCTTGTAGAGCCAGT CAGGACATCAGCAATTACCTGAATTGGTATCAGCAGAAACCAGACGGAACTGTGAAGCTGCTCATCTACTATACCA GCATTCTGCATAGCGGCGTTCCATCCCGCTTTAGCGGCAGTGGCAGCGGAACCGATTATTCACTGACTATCAGCAA CCTGGAACAGGAAGACTTTGCTACCTACTTCTGCCAGCAAGGCAATACCCTGCCCTGGACCTTCGGAGGCGGCACC AAGCTGGAAATCAAGGGTTCCACCTCTGGATCTGGGAAGCCTGGGAGCAGCGAGGGATCTACCAAAGGCGAGGTGC AGCTGGTGGAATCAGGAGGCGGACTCGTCAAGCCCGGAGGATCTCTGAAGCTGAGCTGCGCCGCCTCAGGGTTCGC ATTCTCTATATATGACATGTCTTGGGTGAGGCAGACTCCCGAGAAGAGGCTGGAGTGGGTTGCATACATCAGTTCT GGCGGCGGTACTACCTATTATCCCGATACTGTCAAGGGTCGGTTTACAATTTCTCGGGATAACGCTAAGAACACCC TGTATCTCCAGATGTCATCTCTGAAGAGTGAAGATACTGCTATGTATTATTGCGCTAGACACTCCGGGTACGGAAC ACACTGGGGCGTGCTGTTCGCATATTGGGGTCAGGGTACTCTGGTGACTGTGTCCGCAGCGGCCGCAATTGAAGTT ATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTC CAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGGGGAGTCCTGGCTTGCTATAG CTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATG AACATGACTCCCCGCCGCCCTGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCT ATCGCTCCGCTAGCGGAGGTGGAGGTTCTGGAGGTGGTGGAAGTCAAAGAAGGAAGTACCGCAGCAACAAAGGAGA ATCTCCCGTCGAGCCAGCCGAGCCCTGTCATTATTCATGCCCAAGGGAGGAGGAGGGAAGTACAATCCCAATTCAA GAAGACTACAGGAAGCCCGAACCTGCATGCAGTCCAGGTGGAGGCGGTTCTGGAGGCGGTGGCTCCCGGGTGAAAT TCTCACGGTCTGCAGACGCACCCGCTTACCAGCAAGGCCAGAACCAACTCTATAACGAGCTCAATCTAGGACGAAG AGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCT CAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGC GCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCA CATGCAGGCCCTGCCCCCTCGCACTAGTGGCTCCGGAGCCACGAACTTCTCTCTGTTAAAGCAAGCAGGAGACGTG GAAGAAAACCCCGGTCCCATGGGAGTGCAGGTGGAAACCATCTCCCCAGGAGACGGGCGCACCTTCCCCAAGCGCG GCCAGACCTGCGTGGTGCACTACACCGGGATGCTTGAAGATGGAAAGAAAGTGGACTCCTCCCGGGACAGAAACAA GCCCTTTAAGTTTATGCTAGGCAAGCAGGAGGTGATCCGAGGCTGGGAAGAAGGGGTTGCCCAGATGAGTGTGGGT CAGAGAGCCAAACTGACTATATCTCCAGATTATGCCTATGGTGCCACTGGGCACCCAGGCATCATCCCACCACATG CCACTCTCGTCTTCGATGTGGAGCTTCTAAAACTGGAAGGTGGAGGCGGTTCAGGCGGCGGCGGCAGCGGCGCCAT GGTCGGTGCTCTTGAGAGTTTGAGGGGAAATGCAGATTTGGCTTACATCCTGAGCATGGAGCCCTGTGGCCACTGC CTCATTATCAACAATGTGAACTTCTGCCGTGAGTCCGGGCTCCGCACCCGCACTGGCTCCAACATCGACTGTGAGA AGTTGCGGCGTCGCTTCTCCTCGCTGCATTTCATGGTGGAGGTGAAGGGCGACCTGACTGCCAAGAAAATGGTGCT GGCTTTGCTGGAGCTGGCGCGGCAGGACCACGGTGCTCTGGACTGCTGCGTGGTGGTCATTCTCTCTCACGGCTGT CAGGCCAGCCACCTGCAGTTCCCAGGGGCTGTCTACGGCACAGATGGATGCCCTGTGTCGGTCGAGAAGATTGTGA ACATCTTCAATGGGACCAGCTGCCCCAGCCTGGGAGGGAAGCCCAAGCTCTTTTTCATCCAGGCCTGTGGTGGGGA GCAGAAAGACCATGGGTTTGAGGTGGCCTCCACTTCCCCTGAAGACGAGTCCCCTGGCAGTAACCCCGAGCCAGAT GCCACCCCGTTCCAGGAAGGTTTGAGGACCTTCGACCAGCTGGACGCCATATCTAGTTTGCCCACACCCAGTGACA TCTTTGTGTCCTACTCTACTTTCCCAGGTTTTGTTTCCTGGAGGGACCCCAAGAGTGGCTCCTGGTACGTTGAGAC CCTGGACGACATCTTTGAGCAGTGGGCTCACTCTGAAGACCTGCAGTCCCTCCTGCTTAGGGTCGCTAATGCTGTT TCGGTGAAAGGGATTTATAAACAGATGCCTGGTTGCTTTAATTTCCTCCGGAAAAAACTTTTCTTTAAAACATCAG CTAGTTAA.
In the present invention, the Chimeric antigen receptor further includes promoter, and the promoter is in EF1a, CMV-TAR or CMV Any one or at least two combination.
According to the present invention, the Chimeric antigen receptor is transfected into T cell by the nucleic acid sequence of its coding and is expressed.
According to the present invention, the mode of the transfection is by appointing in viral vectors, eukaryon expression plasmid or mRNA sequence A kind of or at least two combinations of anticipating are transfected into T cell, are transfected into T cell preferably by viral vectors.
Preferably, the viral vectors is any one in slow virus carrier or retroviral vector or at least two Combination, preferably slow virus carrier.
Second aspect, the present invention provide a kind of recombinant slow virus, will include dual chimeric antigen as described in relation to the first aspect The recombinant lentiviral that the immunocyte and packaging helper plasmid pNHP and pHEF-VSVG cotransfection mammalian cell of acceptor gene modification obtain Virus.
In the present invention, the recombinant slow virus can effective immunocyte, including T cell can prepare targeting T-cells.
According to the present invention, the mammalian cell is 293 cells, in 293T cell or TE671 cell any one or extremely Few two kinds of combination.
The third aspect, the present invention provide a kind of pharmaceutical composition, comprising dual chimeric antigen as described in relation to the first aspect by The immunocyte of body gene modification and/or the recombinant slow virus as described in second aspect.
Fourth aspect, the present invention provide the immune thin of dual Chimeric antigen receptor gene modification as described in relation to the first aspect Born of the same parents, the recombinant slow virus as described in second aspect or the pharmaceutical composition as described in the third aspect are in preparation Chimeric antigen receptor T Application in cell, immunocompetent cell or tumor therapeutic agent.
In the present invention, the antigen receptor T cell has good targeting, at the same can discharge low dosage it is immune because Son has hypotoxicity reaction property.
Preferably, the tumour is the relevant tumor disease of blood and/or solid tumor, and the tumor disease is selected from but unlimited In leukaemia.
Compared with prior art, the invention has the following beneficial effects:
(1) dual Chimeric antigen receptor of the invention is based on by the way that T cell Chimerical receptor gene is specifically transformed The dual CAR-T cell of CD19 and CD22 is in conjunction with tumor surface antigen CD19 and CD22, and it is stronger to kill tumor effect, tumor regression Effect becomes apparent；
(2) dual Chimeric antigen receptor of the invention can specificity identification tumor surface antigen CD19 and CD22, CD19 Expression quantity is high in leukaemia and lymthoma with CD22, has compared to other Chimeric antigen receptors and other tumour antigens and more pacifies Entirely, more significant effect is not susceptible to CD19 escape, it is easier to reach disease so that the immune effect of CAR-T cell enhances Place, improves the therapeutic effect of disease.
Detailed description of the invention
Fig. 1 is the synthetic gene sequence map of Chimeric antigen receptor CD19 and CD22 of the invention；
Fig. 2 is B cell leukemia and lymphoma cell strain CD19 and CD22 flow cytometric analysis results figure；
Fig. 3 be CD19 and CD22 Chimeric antigen receptor T cell external B cell leukemia lymphoma cell strain CD19 and CD22 specific killing streaming AnnexinV/PI result；
The position Fig. 4 CD19 and external B cell leukemia lymphoma cell strain CD19 of CD22 Chimeric antigen receptor T cell and CD22 specific killing microscopically observation green fluorescence target cell result；
Fig. 5 is CD19 and CD22 Chimeric antigen receptor T cell combination therapy B cell leukemia/lymthoma clinical test stream Cheng Tu；
Fig. 6 is CD19 the and CD22 antibody staining for flow cell analysis result point diagram of primary B-ALL cell, and sample comes from The marrow of three B-ALL patients；
Fig. 7 is CD22 expression quantity streaming dyeing statistics in B cell leukemia patient marrow malignant cell CD19 positive cell Analysis chart；
Fig. 8 is that B cell lymphoma tissue of patient is sliced immunohistochemical staining statistical analysis, wherein Fig. 8 (a) is CD19 table Up to intensity distribution, Fig. 8 (b) is the distribution of CD22 expression intensity；
Fig. 9 is that B cell lymphoma tissue of patient is sliced CD19 and CD22 immunohistochemical staining example；
Figure 10 is 18 B cell leukemia (Figure 10 (a))/lymthomas of clinical application CD19 and CD22 CAR-T cell therapy Patient (Figure 10 (b)), the remission rate of patient after feedback, wherein PD has progressed for disease, and PR is that part is alleviated, and CR is completely slow Solution；
Figure 11 is the intractable B cell follicular lymphoma patient of clinical use CD19 and CD22 CAR-T cell combination therapy, The variation of marrow malignant cell and CD19 positive cell clone after patient feeds back；
Figure 12 is that lymph nodes size changes after patient feeds back；
Figure 13 is CD19 and CD22 CAR copy number variation in peripheral blood after patient feeds back；
Figure 14 is lymthoma size variation shown in PET-CT after patient YXX is fed back.
Specific embodiment
Further to illustrate technological means and its effect adopted by the present invention, below in conjunction with attached drawing and by specific real Mode to further illustrate the technical scheme of the present invention is applied, but the present invention is not limited in scope of embodiments.
In the examples where no specific technique or condition is specified, described technology or conditions according to the literature in the art, Or it is carried out according to product description.Reagents or instruments used without specified manufacturer, be can be by regular channel commercially available from The conventional products of acquisition.
The building of 1 Chimeric antigen receptor of embodiment
(1) by full genome synthesize Secretory signal peptide, CD19 or CD22 antigen-binding domains, CD8 α and/or CD28 transmembrane domain, CD28 signal transduction structural domain, CD27 signal transduction structural domain, CD3 ζ signal transduction structural domain, 2A sequence Column and 9 structural domain of Caspase, as shown in Figure 1, i.e. Secretory-CD19 scFv-CD28-CD27-CD3 ζ -2A- FBKP.Casp9 and Secretory-CD22 scFv-CD28-CD27-CD3 ζ -2A-FBKP.Casp9；Particular sequence is as follows:
The nucleotide sequence such as SEQ ID of Secretory-CD19 scFv-CD28-CD27-CD3 ζ -2A-FBKP.Casp9 Shown in NO.5.
The nucleotide sequence such as SEQ ID of Secretory-CD22 scFv-CD28-CD27-CD3 ζ -2A-FBKP.Casp9 Shown in NO.7.
2 slow virus of embodiment packaging
(1) 293T cell is used, is cultivated 17-18 hours；
(2) fresh DMEM is added, includes 10% FBS；
(3) following reagent is added in sterile centrifugation tube: every hole takes DMEM that helper DNA mix (pNHP, pHEF- is added VSV-G) and pTYF DNA vector, vortex oscillation；
(4) centrifuge tube is added to Superfect or any transgenic line, be stored at room temperature 7-10 minutes；
(5) the DNA-Superfect mixed liquor in centrifuge tube is added dropwise in each culture cell, whirlpool is beaten；
(6) 37 DEG C of 3%CO2It is cultivated 4-5 hours in incubator；
(7) culture solution for siphoning away culture medium rinses culture medium with 293 cell culture fluids, and culture solution is added and continues to cultivate；
(8) culture medium is put back into 3%CO2Overnight incubation in incubator, the next morning are transfected with fluorescence microscope Efficiency.
The purifying and concentration of 3 slow virus of embodiment
1) viral purification
By being centrifuged 1000g, 5 minutes removing cell fragments obtain vial supernatant, with one 0.45 micron of low albumen Combined filtering device filters vial supernatant, and virus is distributed into aliquot, is stored in -80 DEG C；
Under normal conditions, in every milliliter of culture medium, transfection cell can produce 106To 107Transduced unit titrates slow Viral vectors.
2) slow virus carrier is concentrated with Centricon or similar filter
(1) vial supernatant is added in Centricon or similar screen pipe, is then centrifuged 30 minutes in 2500g；
(2) screen pipe is shaken, then 400g is centrifuged 2 minutes, collects the virus of concentration into collection cups.Finally by all pipes In virus focus in a centrifuge tube.
The transfection of 4 CAR-T cell of embodiment
By the T cell vaccination after activation into culture dish, the slow virus of concentration target gene is added, with 100g centrifugal force Speed is centrifuged 100 minutes, is placed in 37 DEG C of cultures for 24 hours, and the AIM-V culture medium for having the cell culture factor is added, after culture 2-3 days, Cell is harvested and counted, available CD19CAR-T cell and CD22 CAR-T cell are become.
The external malignant B cell strain killing of CD19 and CD22 CAR-T cell is used in combination in embodiment 5
Before carrying out fragmentation test, expression of the analysis CD19 and CD22 in malignant B cell strain first.3 kinds of Malignant Bs are thin Born of the same parents' strain: RS4；11, Daudi, BLCL carry out flow cytometer showed, as a result as shown in Figure 2, it can be seen that three all has the CD19 of high expression And CD22, wherein the expression of CD19 is respectively 88%, 93%, 60%, and the expression of CD22 is respectively 100%, and 100%, 99%. Thus generality of the CD19 and CD22 in malignant B cell strain known to result, and the foundation as fragmentation test.
CD19CAR-T cell and CD22 CAR-T cell and transfection are had to the RS4 of green fluorescence；11(RS4； 11wassort) target cells co-culture, and the ratio of CAR-T cell and target cells is 2:1.After culture one hour, with AnnexinV/PI is dyed, and the percentage of survivaling cell and dead cell is analyzed, it can be learnt that the efficiency of CAR-T killing.
As seen from Figure 3, the not RS4 with CAR-T cell co-cultivation；11 dead cell ratio be lower than 10%, and with The group that CAR-T cell co-cultures, dead cell ratio are all greater than 40%, wherein the group of CD19 and CD22 CAR-T is made At dead cell ratio be higher than 70%, more surpass be used alone CD19 CAR-T or CD22 CAR-T.Long-term observation killing examination The result tested is as shown in figure 4, wherein T cell and GD2 CAR-T are respectively as background value control group and non-specific killing control Group.Fragmentation test starts second day, that is, the disappearance of most of green fluorescence can be observed, until killing third day, it can be seen that same When using the other fluorecyte of CD19 and CD22 CAR-T group it is minimum, compared to exclusive use CD19 or CD22 CAR-T.5th After it, green fluorescence substantially completely disappears, it is shown that the high efficiency of CAR-T cell, and external use in conjunction CD19 and CD22 The feasibility of CAR-T.
The clinical application of 6 CD19 and CD22 CAR-T cell of embodiment
Fig. 5 is CD19 and CD22 Chimeric antigen receptor T cell combination therapy B cell leukemia/lymthoma clinical test stream Cheng Tu, the specific steps are as follows:
(1) patient first passes around the assessment in hospital and laboratory, acquires self or donor white blood cells after meeting group condition. Next follow Standard Operating Procedure, by filtering out CD3 positive T cell in PBMC, activated and transfected 4SCAR19 and CD19 CAR-T cell and CD22 CAR-T cell is made in 4SCA22.Patient is pre- through cyclophosphamide and fludarabine before infusion Processing.Average infused cells number is per kilogram of body weight 1.05 × 106Cell.The quality of leucocyte and CAR-T cell, gene transfection Rate, CAR-T cell amplification situation and effective CAR-T cell infusion number are all by assessment and record.
(2) after patient feeds back CAR-T cell, its immune factor storm and CAR copy number can be monitored closely in one month. The conclusion of the available treatment toxicity of long-term clinic and Laboratory Evaluation and final therapeutic effect.Toxicity evaluation foundation National Cancer Institute ' s Common Terminology Criteria for Adverse Events (beauty State's National Cancer Institute adverse events essential term standard) (CTCAE v4.03).
Specific clinical test results are as follows:
Fig. 6 shows CD19 the and CD22 antibody staining for flow cell analysis result point diagram of primary B-ALL cell, sample Marrow from three B-ALL patients, in three patients, the expression of CD19 and CD22 are all higher than 60%, and patient 3 is even more close 100% expression.With streaming dot map analysis as it can be seen that the bis- positive cells of CD19 and CD22 are also above the 60% of malignant cell.This figure is aobvious The generality and shared high proportion in malignant cell of CD19 and CD22 expression in B-ALL patient are shown, therefore CD22 can Using an extraordinary auxiliary target spot as CAR-T treatment B-ALL.
Fig. 7 is shown in the marrow streaming dyeing of 15 patients B-ALL, in CD19 positive cell group, the expression quantity of CD22 Scatter diagram, result are as shown in table 1 below:
Table 1
In 15 patients, the expression of the CD19 and CD22 of 11 patients exhibit more than 90% double sun, show CD22 conduct The generality and importance of second target spot.
Equally B cell lymphoma patient is analyzed, as a result as follows:
Fig. 8 (a)-Fig. 8 (b) shows CD19 the and CD22 immunohistochemical staining of 28 B cell lymphoma tissue of patient slice Statistical analysis.In CD19 positive patient, staining power distribution is average, 1+ to 4+ about respectively account for overall positive sufferer number four/ One.In the patient of CD22 stained positive, then it is most that be with staining power 3+ patient be, demonstrates again that in B cell lymphoma In CAR-T treatment, CD22 is also an auxiliary target spot well.
Fig. 9 shows the immunohistochemical staining result of three kinds of different B cell lymphoma patients.Whether in follicularis lymph Tumor diffuses in big B lymthoma or primary mediastinum large B cell lymphoid tumor, and CD19 and CD22 are that the high of consistency is expressed.
Through above-mentioned clinical test process, 18 B cell leukemias/B cell lymphoma patient is treated, remission rate result is such as Shown in Figure 10 (a)-Figure 10 (b).7 B cell leukemia patients are treated, wherein three people's complete incidence graphs and people part are alleviated, it is right The Proportion of patients that treatment has reaction is 57%.11 B cell lymphoma patients are treated, wherein two people's complete incidence graphs, five people parts Alleviate, the Proportion of patients for having reaction to treatment is 64%.
The practical case of clinical application of 7 CD19 and CD22 CAR-T cell of embodiment
In above-mentioned mentioned complete incidence graph case, a patient especially set out as combined clinical use CD19 and The case of the excellent therapeutic result of CD22 CAR-T is inquired into.
Sample: patient is 31 years old male with recurring refractory type IV phase follicular lymphoma, through multiple R-CHOP chemotherapy and Second line R-ESHAP chemotherapy is all invalid, progression of disease, and patient's malignant cell expresses CD20, CD22, FMC7, CD79b, CD45, portion Divide expression CD19 and CD23.
CAR-T cell is prepared through above-mentioned experiment process, feeds back 1 × 106/ kg CAR-T cell.Patient is only small after feeding back In 1 grade of reaction of CRS.Figure 11 shows the variation of marrow malignant cell and CD19 positive cell clone after patient's feedback.
As shown in Figure 11,100 days after infusion, marrow malignant cell is completely disappeared, and is continued above 234 days, and CD19 is positive Cell clone is remarkably decreased after being also transfused at second.It is thin that Figure 12 shows that the enlarged lymph node of malignant cell proliferation feeds back CAR-T Size variation after born of the same parents.Lymph node is significant after infusion for the first time and persistently reduces, and to 300 days after feedback after second of infusion, dislikes Property enlarged lymph node has disappeared.The difference amplification situation of CD19 and CD22 CAR-T in Figure 13 display peripheral blood in patients, first The 14th day and the 21st day after secondary feedback, it can be seen that apparent CAR-T amplification.Second feed back after 10 days in, i.e., it can be seen that Obvious CAR-T amplification.Figure 14 shows under long-term tracking, lymthoma size variation shown in PET-CT.The 62nd after observation feedback, 141,285 days, it is seen that lymthoma persistently reduces, and i.e. without visible lympha tumour after nine months, reaches the complete incidence graph of duration State.
In conclusion dual Chimeric antigen receptor of the invention can specificity identification tumor surface antigen CD19 and CD22 is used in combination two kinds of CAR-T cells and makes therapeutic effect more compared to other single Chimeric antigen receptor T cells are used It is good, it is not susceptible to CD19 escape, it is easier to allow remission.
The Applicant declares that the present invention is explained by the above embodiments method detailed of the invention, but the present invention not office Be limited to above-mentioned method detailed, that is, do not mean that the invention must rely on the above detailed methods to implement.Technical field Technical staff it will be clearly understood that any improvement in the present invention, equivalence replacement and auxiliary element to each raw material of product of the present invention Addition, selection of concrete mode etc., all of which fall within the scope of protection and disclosure of the present invention.
SEQUENCE LISTING
<110>Beijing Meikang Ji Mian Biotechnology Co., Ltd
<120>a kind of immunocyte of dual Chimeric antigen receptor gene modification based on CD19 and CD22 and its application
<130> 2018
<160> 9
<170> PatentIn version 3.3
<210> 1
<211> 245
<212> PRT
<213>artificial synthesized sequence
<400> 1
Asp Ile Gln Met Thr Gln Thr Thr Ser Ser Leu Ser Ala Ser Leu Gly
1 5 10 15
Asp Arg Val Thr Ile Ser Cys Arg Ala Ser Gln Asp Ile Ser Lys Tyr
20 25 30
Leu Asn Trp Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Leu Leu Ile
35 40 45
Tyr His Thr Ser Arg Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Ser Asn Leu Glu Gln
65 70 75 80
Glu Asp Ile Ala Thr Tyr Phe Cys Gln Gln Gly Asn Thr Leu Pro Tyr
85 90 95
Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Thr Gly Ser Thr Ser Gly
100 105 110
Ser Gly Lys Pro Gly Ser Gly Glu Gly Ser Thr Lys Gly Glu Val Lys
115 120 125
Leu Gln Glu Ser Gly Pro Gly Leu Val Ala Pro Ser Gln Ser Leu Ser
130 135 140
Val Thr Cys Thr Val Ser Gly Val Ser Leu Pro Asp Tyr Gly Val Ser
145 150 155 160
Trp Ile Arg Gln Pro Pro Arg Lys Gly Leu Glu Trp Leu Gly Val Ile
165 170 175
Trp Gly Ser Glu Thr Thr Tyr Tyr Asn Ser Ala Leu Lys Ser Arg Leu
180 185 190
Thr Ile Ile Lys Asp Asn Ser Lys Ser Gln Val Phe Leu Lys Met Asn
195 200 205
Ser Leu Gln Thr Asp Asp Thr Ala Ile Tyr Tyr Cys Ala Lys His Tyr
210 215 220
Tyr Tyr Gly Gly Ser Tyr Ala Met Asp Tyr Trp Gly Gln Gly Thr Ser
225 230 235 240
Val Thr Val Ser Ser
245
<210> 2
<211> 248
<212> PRT
<213>artificial synthesized sequence
<400> 2
Asp Ile Gln Met Thr Gln Thr Thr Ser Ser Leu Ser Ala Ser Leu Gly
1 5 10 15
Asp Arg Val Thr Ile Ser Cys Arg Ala Ser Gln Asp Ile Ser Asn Tyr
20 25 30
Leu Asn Trp Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Leu Leu Ile
35 40 45
Tyr Tyr Thr Ser Ile Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Ser Asn Leu Glu Gln
65 70 75 80
Glu Asp Phe Ala Thr Tyr Phe Cys Gln Gln Gly Asn Thr Leu Pro Trp
85 90 95
Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Gly Ser Thr Ser Gly
100 105 110
Ser Gly Lys Pro Gly Ser Ser Glu Gly Ser Thr Lys Gly Glu Val Gln
115 120 125
Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly Ser Leu Lys
130 135 140
Leu Ser Cys Ala Ala Ser Gly Phe Ala Phe Ser Ile Tyr Asp Met Ser
145 150 155 160
Trp Val Arg Gln Thr Pro Glu Lys Arg Leu Glu Trp Val Ala Tyr Ile
165 170 175
Ser Ser Gly Gly Gly Thr Thr Tyr Tyr Pro Asp Thr Val Lys Gly Arg
180 185 190
Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr Leu Gln Met
195 200 205
Ser Ser Leu Lys Ser Glu Asp Thr Ala Met Tyr Tyr Cys Ala Arg His
210 215 220
Ser Gly Tyr Gly Thr His Trp Gly Val Leu Phe Ala Tyr Trp Gly Gln
225 230 235 240
Gly Thr Leu Val Thr Val Ser Ala
245
<210> 3
<211> 423
<212> PRT
<213>artificial synthesized sequence
<400> 3
Gly Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val
1 5 10 15
Glu Glu Asn Pro Gly Pro Met Gly Val Gln Val Glu Thr Ile Ser Pro
20 25 30
Gly Asp Gly Arg Thr Phe Pro Lys Arg Gly Gln Thr Cys Val Val His
35 40 45
Tyr Thr Gly Met Leu Glu Asp Gly Lys Lys Val Asp Ser Ser Arg Asp
50 55 60
Arg Asn Lys Pro Phe Lys Phe Met Leu Gly Lys Gln Glu Val Ile Arg
65 70 75 80
Gly Trp Glu Glu Gly Val Ala Gln Met Ser Val Gly Gln Arg Ala Lys
85 90 95
Leu Thr Ile Ser Pro Asp Tyr Ala Tyr Gly Ala Thr Gly His Pro Gly
100 105 110
Ile Ile Pro Pro His Ala Thr Leu Val Phe Asp Val Glu Leu Leu Lys
115 120 125
Leu Glu Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Ala Met Val
130 135 140
Gly Ala Leu Glu Ser Leu Arg Gly Asn Ala Asp Leu Ala Tyr Ile Leu
145 150 155 160
Ser Met Glu Pro Cys Gly His Cys Leu Ile Ile Asn Asn Val Asn Phe
165 170 175
Cys Arg Glu Ser Gly Leu Arg Thr Arg Thr Gly Ser Asn Ile Asp Cys
180 185 190
Glu Lys Leu Arg Arg Arg Phe Ser Ser Leu His Phe Met Val Glu Val
195 200 205
Lys Gly Asp Leu Thr Ala Lys Lys Met Val Leu Ala Leu Leu Glu Leu
210 215 220
Ala Arg Gln Asp His Gly Ala Leu Asp Cys Cys Val Val Val Ile Leu
225 230 235 240
Ser His Gly Cys Gln Ala Ser His Leu Gln Phe Pro Gly Ala Val Tyr
245 250 255
Gly Thr Asp Gly Cys Pro Val Ser Val Glu Lys Ile Val Asn Ile Phe
260 265 270
Asn Gly Thr Ser Cys Pro Ser Leu Gly Gly Lys Pro Lys Leu Phe Phe
275 280 285
Ile Gln Ala Cys Gly Gly Glu Gln Lys Asp His Gly Phe Glu Val Ala
290 295 300
Ser Thr Ser Pro Glu Asp Glu Ser Pro Gly Ser Asn Pro Glu Pro Asp
305 310 315 320
Ala Thr Pro Phe Gln Glu Gly Leu Arg Thr Phe Asp Gln Leu Asp Ala
325 330 335
Ile Ser Ser Leu Pro Thr Pro Ser Asp Ile Phe Val Ser Tyr Ser Thr
340 345 350
Phe Pro Gly Phe Val Ser Trp Arg Asp Pro Lys Ser Gly Ser Trp Tyr
355 360 365
Val Glu Thr Leu Asp Asp Ile Phe Glu Gln Trp Ala His Ser Glu Asp
370 375 380
Leu Gln Ser Leu Leu Leu Arg Val Ala Asn Ala Val Ser Val Lys Gly
385 390 395 400
Ile Tyr Lys Gln Met Pro Gly Cys Phe Asn Phe Leu Arg Lys Lys Leu
405 410 415
Phe Phe Lys Thr Ser Ala Ser
420
<210> 4
<211> 986
<212> PRT
<213>artificial synthesized sequence
<400> 4
Met Leu Leu Leu Val Thr Ser Leu Leu Leu Cys Glu Leu Pro His Pro
1 5 10 15
Ala Phe Leu Leu Ile Pro Gln Val Gln Leu Val Gln Ser Gly Ala Glu
20 25 30
Val Lys Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly
35 40 45
Tyr Thr Phe Thr Asn Tyr Gly Met Asn Trp Val Arg Gln Ala Pro Gly
50 55 60
Gln Gly Leu Glu Trp Met Gly Trp Ile Asn Thr Tyr Thr Gly Glu Pro
65 70 75 80
Thr Tyr Ala Asp Ala Phe Lys Gly Arg Val Thr Met Thr Thr Asp Thr
85 90 95
Ser Thr Ser Thr Ala Tyr Met Glu Leu Arg Ser Leu Arg Ser Asp Asp
100 105 110
Thr Ala Val Tyr Tyr Cys Ala Arg Asp Tyr Gly Asp Tyr Gly Met Asp
115 120 125
Tyr Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser Gly Ser Thr Ser
130 135 140
Gly Ser Gly Lys Pro Gly Ser Ser Glu Gly Ser Thr Lys Gly Asp Ile
145 150 155 160
Val Met Thr Gln Ser Pro Asp Ser Leu Ala Val Ser Leu Gly Glu Arg
165 170 175
Ala Thr Ile Asn Cys Arg Ala Ser Lys Ser Val Ser Thr Ser Gly Tyr
180 185 190
Ser Phe Met His Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu
195 200 205
Leu Ile Tyr Leu Ala Ser Asn Leu Glu Ser Gly Val Pro Asp Arg Phe
210 215 220
Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu
225 230 235 240
Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys Gln His Ser Arg Glu Val
245 250 255
Pro Trp Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Ala Ala Ala
260 265 270
Ile Glu Val Met Tyr Pro Pro Pro Tyr Leu Asp Asn Glu Lys Ser Asn
275 280 285
Gly Thr Ile Ile His Val Lys Gly Lys His Leu Cys Pro Ser Pro Leu
290 295 300
Phe Pro Gly Pro Ser Lys Pro Phe Trp Val Leu Val Val Val Gly Gly
305 310 315 320
Val Leu Ala Cys Tyr Ser Leu Leu Val Thr Val Ala Phe Ile Ile Phe
325 330 335
Trp Val Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met Asn
340 345 350
Met Thr Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr
355 360 365
Ala Pro Pro Arg Asp Phe Ala Ala Tyr Arg Ser Ala Ser Gly Gly Gly
370 375 380
Gly Ser Gly Gly Gly Gly Ser Gln Arg Arg Lys Tyr Arg Ser Asn Lys
385 390 395 400
Gly Glu Ser Pro Val Glu Pro Ala Glu Pro Cys His Tyr Ser Cys Pro
405 410 415
Arg Glu Glu Glu Gly Ser Thr Ile Pro Ile Gln Glu Asp Tyr Arg Lys
420 425 430
Pro Glu Pro Ala Cys Ser Pro Gly Gly Gly Gly Ser Gly Gly Gly Gly
435 440 445
Ser Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln
450 455 460
Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu
465 470 475 480
Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly
485 490 495
Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln
500 505 510
Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu
515 520 525
Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr
530 535 540
Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro
545 550 555 560
Arg Thr Ser Gly Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala
565 570 575
Gly Asp Val Glu Glu Asn Pro Gly Pro Met Gly Val Gln Val Glu Thr
580 585 590
Ile Ser Pro Gly Asp Gly Arg Thr Phe Pro Lys Arg Gly Gln Thr Cys
595 600 605
Val Val His Tyr Thr Gly Met Leu Glu Asp Gly Lys Lys Val Asp Ser
610 615 620
Ser Arg Asp Arg Asn Lys Pro Phe Lys Phe Met Leu Gly Lys Gln Glu
625 630 635 640
Val Ile Arg Gly Trp Glu Glu Gly Val Ala Gln Met Ser Val Gly Gln
645 650 655
Arg Ala Lys Leu Thr Ile Ser Pro Asp Tyr Ala Tyr Gly Ala Thr Gly
660 665 670
His Pro Gly Ile Ile Pro Pro His Ala Thr Leu Val Phe Asp Val Glu
675 680 685
Leu Leu Lys Leu Glu Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
690 695 700
Ala Met Val Gly Ala Leu Glu Ser Leu Arg Gly Asn Ala Asp Leu Ala
705 710 715 720
Tyr Ile Leu Ser Met Glu Pro Cys Gly His Cys Leu Ile Ile Asn Asn
725 730 735
Val Asn Phe Cys Arg Glu Ser Gly Leu Arg Thr Arg Thr Gly Ser Asn
740 745 750
Ile Asp Cys Glu Lys Leu Arg Arg Arg Phe Ser Ser Leu His Phe Met
755 760 765
Val Glu Val Lys Gly Asp Leu Thr Ala Lys Lys Met Val Leu Ala Leu
770 775 780
Leu Glu Leu Ala Arg Gln Asp His Gly Ala Leu Asp Cys Cys Val Val
785 790 795 800
Val Ile Leu Ser His Gly Cys Gln Ala Ser His Leu Gln Phe Pro Gly
805 810 815
Ala Val Tyr Gly Thr Asp Gly Cys Pro Val Ser Val Glu Lys Ile Val
820 825 830
Asn Ile Phe Asn Gly Thr Ser Cys Pro Ser Leu Gly Gly Lys Pro Lys
835 840 845
Leu Phe Phe Ile Gln Ala Cys Gly Gly Glu Gln Lys Asp His Gly Phe
850 855 860
Glu Val Ala Ser Thr Ser Pro Glu Asp Glu Ser Pro Gly Ser Asn Pro
865 870 875 880
Glu Pro Asp Ala Thr Pro Phe Gln Glu Gly Leu Arg Thr Phe Asp Gln
885 890 895
Leu Asp Ala Ile Ser Ser Leu Pro Thr Pro Ser Asp Ile Phe Val Ser
900 905 910
Tyr Ser Thr Phe Pro Gly Phe Val Ser Trp Arg Asp Pro Lys Ser Gly
915 920 925
Ser Trp Tyr Val Glu Thr Leu Asp Asp Ile Phe Glu Gln Trp Ala His
930 935 940
Ser Glu Asp Leu Gln Ser Leu Leu Leu Arg Val Ala Asn Ala Val Ser
945 950 955 960
Val Lys Gly Ile Tyr Lys Gln Met Pro Gly Cys Phe Asn Phe Leu Arg
965 970 975
Lys Lys Leu Phe Phe Lys Thr Ser Ala Ser
980 985
<210> 5
<211> 2955
<212> DNA
<213>artificial synthesized sequence
<400> 5
atgctgctgc tggtcacaag cctgctgctg tgcgagctgc cccaccccgc ctttctgctg 60
atccccgaca tccagatgac ccagaccacc agcagcctga gcgccagcct gggcgacaga 120
gtgaccatca gctgccgggc cagccaggac atcagcaagt acctgaactg gtatcagcag 180
aaacccgacg gcaccgtgaa gctgctgatc taccacacca gccggctgca cagcggcgtg 240
cccagcagat tttctggcag cggatctggc accgactaca gcctgaccat ctccaacctg 300
gaacaggaag atatcgctac ctacttctgt cagcagggca acaccctgcc ctacaccttc 360
ggcggaggca ccaagctgga aatcaccggc agcaccagcg gctccggcaa gcctggatct 420
ggcgagggca gcaccaaggg cgaagtgaag ctgcaggaaa gcggccctgg cctggtcgcc 480
cctagccaga gcctgtccgt gacctgtacc gtgtccggcg tgtccctgcc cgactacggc 540
gtgtcctgga tcagacagcc ccccagaaag ggcctggaat ggctgggcgt gatctggggc 600
agcgagacaa cctactacaa cagcgccctg aagtcccggc tgaccatcat caaggacaac 660
agcaagagcc aggtgttcct gaagatgaac agcctgcaga ccgacgacac cgccatctac 720
tactgcgcca agcactacta ctacggcggc agctacgcca tggactactg gggccagggc 780
accagcgtga cagtctcttc tgcggccgca attgaagtta tgtatcctcc tccttaccta 840
gacaatgaga agagcaatgg aaccattatc catgtgaaag ggaaacacct ttgtccaagt 900
cccctatttc ccggaccttc taagcccttt tgggtgctgg tggtggttgg gggagtcctg 960
gcttgctata gcttgctagt aacagtggcc tttattattt tctgggtgag gagtaagagg 1020
agcaggctcc tgcacagtga ctacatgaac atgactcccc gccgccctgg gcccacccgc 1080
aagcattacc agccctatgc cccaccacgc gacttcgcag cctatcgctc cgctagcgga 1140
ggtggaggtt ctggaggtgg tggaagtcaa agaaggaagt accgcagcaa caaaggagaa 1200
tctcccgtcg agccagccga gccctgtcat tattcatgcc caagggagga ggagggaagt 1260
acaatcccaa ttcaagaaga ctacaggaag cccgaacctg catgcagtcc aggtggaggc 1320
ggttctggag gcggtggctc ccgggtgaaa ttctcacggt ctgcagacgc acccgcttac 1380
cagcaaggcc agaaccaact ctataacgag ctcaatctag gacgaagaga ggagtacgat 1440
gttttggaca agagacgtgg ccgggaccct gagatggggg gaaagccgag aaggaagaac 1500
cctcaggaag gcctgtacaa tgaactgcag aaagataaga tggcggaggc ctacagtgag 1560
attgggatga aaggcgagcg ccggaggggc aaggggcacg atggccttta ccagggtctc 1620
agtacagcca ccaaggacac ctacgacgcc cttcacatgc aggccctgcc ccctcgcact 1680
agtggctccg gagccacgaa cttctctctg ttaaagcaag caggagacgt ggaagaaaac 1740
cccggtccca tgggagtgca ggtggaaacc atctccccag gagacgggcg caccttcccc 1800
aagcgcggcc agacctgcgt ggtgcactac accgggatgc ttgaagatgg aaagaaagtg 1860
gactcctccc gggacagaaa caagcccttt aagtttatgc taggcaagca ggaggtgatc 1920
cgaggctggg aagaaggggt tgcccagatg agtgtgggtc agagagccaa actgactata 1980
tctccagatt atgcctatgg tgccactggg cacccaggca tcatcccacc acatgccact 2040
ctcgtcttcg atgtggagct tctaaaactg gaaggtggag gcggttcagg cggcggcggc 2100
agcggcgcca tggtcggtgc tcttgagagt ttgaggggaa atgcagattt ggcttacatc 2160
ctgagcatgg agccctgtgg ccactgcctc attatcaaca atgtgaactt ctgccgtgag 2220
tccgggctcc gcacccgcac tggctccaac atcgactgtg agaagttgcg gcgtcgcttc 2280
tcctcgctgc atttcatggt ggaggtgaag ggcgacctga ctgccaagaa aatggtgctg 2340
gctttgctgg agctggcgcg gcaggaccac ggtgctctgg actgctgcgt ggtggtcatt 2400
ctctctcacg gctgtcaggc cagccacctg cagttcccag gggctgtcta cggcacagat 2460
ggatgccctg tgtcggtcga gaagattgtg aacatcttca atgggaccag ctgccccagc 2520
ctgggaggga agcccaagct ctttttcatc caggcctgtg gtggggagca gaaagaccat 2580
gggtttgagg tggcctccac ttcccctgaa gacgagtccc ctggcagtaa ccccgagcca 2640
gatgccaccc cgttccagga aggtttgagg accttcgacc agctggacgc catatctagt 2700
ttgcccacac ccagtgacat ctttgtgtcc tactctactt tcccaggttt tgtttcctgg 2760
agggacccca agagtggctc ctggtacgtt gagaccctgg acgacatctt tgagcagtgg 2820
gctcactctg aagacctgca gtccctcctg cttagggtcg ctaatgctgt ttcggtgaaa 2880
gggatttata aacagatgcc tggttgcttt aatttcctcc ggaaaaaact tttctttaaa 2940
acatcagcta gttaa 2955
<210> 6
<211> 987
<212> PRT
<213>artificial synthesized sequence
<400> 6
Met Leu Leu Leu Val Thr Ser Leu Leu Leu Cys Glu Leu Pro His Pro
1 5 10 15
Ala Phe Leu Leu Ile Pro Asp Ile Gln Met Thr Gln Thr Thr Ser Ser
20 25 30
Leu Ser Ala Ser Leu Gly Asp Arg Val Thr Ile Ser Cys Arg Ala Ser
35 40 45
Gln Asp Ile Ser Asn Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Asp Gly
50 55 60
Thr Val Lys Leu Leu Ile Tyr Tyr Thr Ser Ile Leu His Ser Gly Val
65 70 75 80
Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr
85 90 95
Ile Ser Asn Leu Glu Gln Glu Asp Phe Ala Thr Tyr Phe Cys Gln Gln
100 105 110
Gly Asn Thr Leu Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile
115 120 125
Lys Gly Ser Thr Ser Gly Ser Gly Lys Pro Gly Ser Ser Glu Gly Ser
130 135 140
Thr Lys Gly Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys
145 150 155 160
Pro Gly Gly Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Phe Ala Phe
165 170 175
Ser Ile Tyr Asp Met Ser Trp Val Arg Gln Thr Pro Glu Lys Arg Leu
180 185 190
Glu Trp Val Ala Tyr Ile Ser Ser Gly Gly Gly Thr Thr Tyr Tyr Pro
195 200 205
Asp Thr Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
210 215 220
Thr Leu Tyr Leu Gln Met Ser Ser Leu Lys Ser Glu Asp Thr Ala Met
225 230 235 240
Tyr Tyr Cys Ala Arg His Ser Gly Tyr Gly Thr His Trp Gly Val Leu
245 250 255
Phe Ala Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ala Ala Ala
260 265 270
Ala Ile Glu Val Met Tyr Pro Pro Pro Tyr Leu Asp Asn Glu Lys Ser
275 280 285
Asn Gly Thr Ile Ile His Val Lys Gly Lys His Leu Cys Pro Ser Pro
290 295 300
Leu Phe Pro Gly Pro Ser Lys Pro Phe Trp Val Leu Val Val Val Gly
305 310 315 320
Gly Val Leu Ala Cys Tyr Ser Leu Leu Val Thr Val Ala Phe Ile Ile
325 330 335
Phe Trp Val Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met
340 345 350
Asn Met Thr Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro
355 360 365
Tyr Ala Pro Pro Arg Asp Phe Ala Ala Tyr Arg Ser Ala Ser Gly Gly
370 375 380
Gly Gly Ser Gly Gly Gly Gly Ser Gln Arg Arg Lys Tyr Arg Ser Asn
385 390 395 400
Lys Gly Glu Ser Pro Val Glu Pro Ala Glu Pro Cys His Tyr Ser Cys
405 410 415
Pro Arg Glu Glu Glu Gly Ser Thr Ile Pro Ile Gln Glu Asp Tyr Arg
420 425 430
Lys Pro Glu Pro Ala Cys Ser Pro Gly Gly Gly Gly Ser Gly Gly Gly
435 440 445
Gly Ser Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln
450 455 460
Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu
465 470 475 480
Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly
485 490 495
Gly Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu
500 505 510
Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly
515 520 525
Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser
530 535 540
Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro
545 550 555 560
Pro Arg Thr Ser Gly Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys Gln
565 570 575
Ala Gly Asp Val Glu Glu Asn Pro Gly Pro Met Gly Val Gln Val Glu
580 585 590
Thr Ile Ser Pro Gly Asp Gly Arg Thr Phe Pro Lys Arg Gly Gln Thr
595 600 605
Cys Val Val His Tyr Thr Gly Met Leu Glu Asp Gly Lys Lys Val Asp
610 615 620
Ser Ser Arg Asp Arg Asn Lys Pro Phe Lys Phe Met Leu Gly Lys Gln
625 630 635 640
Glu Val Ile Arg Gly Trp Glu Glu Gly Val Ala Gln Met Ser Val Gly
645 650 655
Gln Arg Ala Lys Leu Thr Ile Ser Pro Asp Tyr Ala Tyr Gly Ala Thr
660 665 670
Gly His Pro Gly Ile Ile Pro Pro His Ala Thr Leu Val Phe Asp Val
675 680 685
Glu Leu Leu Lys Leu Glu Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
690 695 700
Gly Ala Met Val Gly Ala Leu Glu Ser Leu Arg Gly Asn Ala Asp Leu
705 710 715 720
Ala Tyr Ile Leu Ser Met Glu Pro Cys Gly His Cys Leu Ile Ile Asn
725 730 735
Asn Val Asn Phe Cys Arg Glu Ser Gly Leu Arg Thr Arg Thr Gly Ser
740 745 750
Asn Ile Asp Cys Glu Lys Leu Arg Arg Arg Phe Ser Ser Leu His Phe
755 760 765
Met Val Glu Val Lys Gly Asp Leu Thr Ala Lys Lys Met Val Leu Ala
770 775 780
Leu Leu Glu Leu Ala Arg Gln Asp His Gly Ala Leu Asp Cys Cys Val
785 790 795 800
Val Val Ile Leu Ser His Gly Cys Gln Ala Ser His Leu Gln Phe Pro
805 810 815
Gly Ala Val Tyr Gly Thr Asp Gly Cys Pro Val Ser Val Glu Lys Ile
820 825 830
Val Asn Ile Phe Asn Gly Thr Ser Cys Pro Ser Leu Gly Gly Lys Pro
835 840 845
Lys Leu Phe Phe Ile Gln Ala Cys Gly Gly Glu Gln Lys Asp His Gly
850 855 860
Phe Glu Val Ala Ser Thr Ser Pro Glu Asp Glu Ser Pro Gly Ser Asn
865 870 875 880
Pro Glu Pro Asp Ala Thr Pro Phe Gln Glu Gly Leu Arg Thr Phe Asp
885 890 895
Gln Leu Asp Ala Ile Ser Ser Leu Pro Thr Pro Ser Asp Ile Phe Val
900 905 910
Ser Tyr Ser Thr Phe Pro Gly Phe Val Ser Trp Arg Asp Pro Lys Ser
915 920 925
Gly Ser Trp Tyr Val Glu Thr Leu Asp Asp Ile Phe Glu Gln Trp Ala
930 935 940
His Ser Glu Asp Leu Gln Ser Leu Leu Leu Arg Val Ala Asn Ala Val
945 950 955 960
Ser Val Lys Gly Ile Tyr Lys Gln Met Pro Gly Cys Phe Asn Phe Leu
965 970 975
Arg Lys Lys Leu Phe Phe Lys Thr Ser Ala Ser
980 985
<210> 7
<211> 2964
<212> DNA
<213>artificial synthesized sequence
<400> 7
atgctgctcc tcgttacaag tctgctcctg tgtgaactgc ctcaccctgc atttctgctg 60
attccagata tacagatgac tcaaaccaca tcctctctga gtgcttccct gggcgaccgc 120
gtcaccatat cttgtagagc cagtcaggac atcagcaatt acctgaattg gtatcagcag 180
aaaccagacg gaactgtgaa gctgctcatc tactatacca gcattctgca tagcggcgtt 240
ccatcccgct ttagcggcag tggcagcgga accgattatt cactgactat cagcaacctg 300
gaacaggaag actttgctac ctacttctgc cagcaaggca ataccctgcc ctggaccttc 360
ggaggcggca ccaagctgga aatcaagggt tccacctctg gatctgggaa gcctgggagc 420
agcgagggat ctaccaaagg cgaggtgcag ctggtggaat caggaggcgg actcgtcaag 480
cccggaggat ctctgaagct gagctgcgcc gcctcagggt tcgcattctc tatatatgac 540
atgtcttggg tgaggcagac tcccgagaag aggctggagt gggttgcata catcagttct 600
ggcggcggta ctacctatta tcccgatact gtcaagggtc ggtttacaat ttctcgggat 660
aacgctaaga acaccctgta tctccagatg tcatctctga agagtgaaga tactgctatg 720
tattattgcg ctagacactc cgggtacgga acacactggg gcgtgctgtt cgcatattgg 780
ggtcagggta ctctggtgac tgtgtccgca gcggccgcaa ttgaagttat gtatcctcct 840
ccttacctag acaatgagaa gagcaatgga accattatcc atgtgaaagg gaaacacctt 900
tgtccaagtc ccctatttcc cggaccttct aagccctttt gggtgctggt ggtggttggg 960
ggagtcctgg cttgctatag cttgctagta acagtggcct ttattatttt ctgggtgagg 1020
agtaagagga gcaggctcct gcacagtgac tacatgaaca tgactccccg ccgccctggg 1080
cccacccgca agcattacca gccctatgcc ccaccacgcg acttcgcagc ctatcgctcc 1140
gctagcggag gtggaggttc tggaggtggt ggaagtcaaa gaaggaagta ccgcagcaac 1200
aaaggagaat ctcccgtcga gccagccgag ccctgtcatt attcatgccc aagggaggag 1260
gagggaagta caatcccaat tcaagaagac tacaggaagc ccgaacctgc atgcagtcca 1320
ggtggaggcg gttctggagg cggtggctcc cgggtgaaat tctcacggtc tgcagacgca 1380
cccgcttacc agcaaggcca gaaccaactc tataacgagc tcaatctagg acgaagagag 1440
gagtacgatg ttttggacaa gagacgtggc cgggaccctg agatgggggg aaagccgaga 1500
aggaagaacc ctcaggaagg cctgtacaat gaactgcaga aagataagat ggcggaggcc 1560
tacagtgaga ttgggatgaa aggcgagcgc cggaggggca aggggcacga tggcctttac 1620
cagggtctca gtacagccac caaggacacc tacgacgccc ttcacatgca ggccctgccc 1680
cctcgcacta gtggctccgg agccacgaac ttctctctgt taaagcaagc aggagacgtg 1740
gaagaaaacc ccggtcccat gggagtgcag gtggaaacca tctccccagg agacgggcgc 1800
accttcccca agcgcggcca gacctgcgtg gtgcactaca ccgggatgct tgaagatgga 1860
aagaaagtgg actcctcccg ggacagaaac aagcccttta agtttatgct aggcaagcag 1920
gaggtgatcc gaggctggga agaaggggtt gcccagatga gtgtgggtca gagagccaaa 1980
ctgactatat ctccagatta tgcctatggt gccactgggc acccaggcat catcccacca 2040
catgccactc tcgtcttcga tgtggagctt ctaaaactgg aaggtggagg cggttcaggc 2100
ggcggcggca gcggcgccat ggtcggtgct cttgagagtt tgaggggaaa tgcagatttg 2160
gcttacatcc tgagcatgga gccctgtggc cactgcctca ttatcaacaa tgtgaacttc 2220
tgccgtgagt ccgggctccg cacccgcact ggctccaaca tcgactgtga gaagttgcgg 2280
cgtcgcttct cctcgctgca tttcatggtg gaggtgaagg gcgacctgac tgccaagaaa 2340
atggtgctgg ctttgctgga gctggcgcgg caggaccacg gtgctctgga ctgctgcgtg 2400
gtggtcattc tctctcacgg ctgtcaggcc agccacctgc agttcccagg ggctgtctac 2460
ggcacagatg gatgccctgt gtcggtcgag aagattgtga acatcttcaa tgggaccagc 2520
tgccccagcc tgggagggaa gcccaagctc tttttcatcc aggcctgtgg tggggagcag 2580
aaagaccatg ggtttgaggt ggcctccact tcccctgaag acgagtcccc tggcagtaac 2640
cccgagccag atgccacccc gttccaggaa ggtttgagga ccttcgacca gctggacgcc 2700
atatctagtt tgcccacacc cagtgacatc tttgtgtcct actctacttt cccaggtttt 2760
gtttcctgga gggaccccaa gagtggctcc tggtacgttg agaccctgga cgacatcttt 2820
gagcagtggg ctcactctga agacctgcag tccctcctgc ttagggtcgc taatgctgtt 2880
tcggtgaaag ggatttataa acagatgcct ggttgcttta atttcctccg gaaaaaactt 2940
ttctttaaaa catcagctag ttaa 2964
<210> 8
<211> 22
<212> PRT
<213>artificial synthesized sequence
<400> 8
Met Leu Leu Leu Val Thr Ser Leu Leu Leu Cys Glu Leu Pro His Pro
1 5 10 15
Ala Phe Leu Leu Ile Pro
20
<210> 9
<211> 21
<212> PRT
<213>artificial synthesized sequence
<400> 9
Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu
1 5 10 15
His Ala Ala Arg Pro
20

Claims (10)

1. a kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and CD22, which is characterized in that described Dual Chimeric antigen receptor includes Chimeric antigen receptor CD19 and Chimeric antigen receptor CD22.
2. immunocyte according to claim 1, which is characterized in that the Chimeric antigen receptor includes antigen binding structure Domain, transmembrane domain, costimulatory signal conducting region, CD3 ζ signal transduction structural domain and can induce suicide Fusion domain series connection and At；
Preferably, the antigen-binding domains are to resist for the single-chain antibody of tumor surface antigen CD19 and for tumor surface The single-chain antibody of former CD22.
3. immunocyte according to claim 1 or 2, which is characterized in that the list for tumor surface antigen CD19 The amino acid sequence of chain antibody has any one in amino acid sequence shown in (I), (II) or (III):
(I) there is the amino acid sequence as shown in SEQ ID NO.1；
(II) with amino acid sequence shown in SEQ ID NO.1 with >=90%, preferably >=95%, more preferably >=98%, most preferably The amino acid sequence of >=99% homology；
(III) it modified with amino acid sequence shown in SEQ ID NO.1, replace, miss or add one or several amino acid The amino acid sequence of acquisition；
The amino acid sequence has the activity of the single-chain antibody for tumor surface antigen CD19；
Preferably, the amino acid sequence of the single-chain antibody for tumor surface antigen CD22 has (I), (II) or (III) Shown in any one in amino acid sequence:
(I) there is the amino acid sequence as shown in SEQ ID NO.2；
(II) with amino acid sequence shown in SEQ ID NO.2 with >=90%, preferably >=95%, more preferably >=98%, most preferably The amino acid sequence of >=99% homology；
(III) it modified with amino acid sequence shown in SEQ ID NO.2, replace, miss or add one or several amino acid The amino acid sequence of acquisition；
The amino acid sequence has the activity of the single-chain antibody for tumor surface antigen CD22.
4. immunocyte according to any one of claim 1-3, which is characterized in that the transmembrane domain be CD28 across Spanning domain and/or CD8 α transmembrane domain；
Preferably, the costimulatory signal conducting region is CD28 signal transduction structural domain, CD27 signal transduction structural domain or CD137 In signal transduction structural domain any one or at least two combination；
Preferably, the inducible suicide Fusion domain is to include 9 structural domain of Caspase；
Preferably, the amino acid sequence of 9 structural domain of Caspase is as shown in SEQ ID NO.3；
Preferably, the inducible suicide Fusion domain is connected in series by 2A sequence and CD3 ζ signal transduction structural domain.
5. immunocyte described in any one of -4 according to claim 1, which is characterized in that the Chimeric antigen receptor includes letter Number peptide, antigen-binding domains, transmembrane domain, costimulatory signal conducting region, CD3 ζ signal transduction structural domain, 2A sequence and can Induction suicide Fusion domain is connected in series；
Preferably, the Chimeric antigen receptor is Secretory signal peptide, CD19 antigen-binding domains and/or CD22 antigen Binding structural domain, CD8 α and/or CD28 transmembrane domain, CD28 signal transduction structural domain, CD27 signal transduction structural domain, CD3 ζ Signal transduction structural domain, 2A sequence and 9 structural domain of Caspase are connected in series；
Preferably, the Chimeric antigen receptor CD19 is Secretory-CD19 scFv-CD28-CD27-CD3 ζ -2A- FBKP.Casp9；The Chimeric antigen receptor CD22 is Secretory-CD22 scFv-CD28-CD27-CD3 ζ -2A- FBKP.Casp9；
Preferably, the amino acid sequence of the Chimeric antigen receptor CD19 as shown in SEQ ID NO.4 or with its have 90% with The amino acid sequence of upper homology；
Preferably, the amino acid sequence of the Chimeric antigen receptor CD22 as shown in SEQ ID NO.6 or with its have 90% with The amino acid sequence of upper homology.
6. immunocyte according to any one of claims 1-5, which is characterized in that the dual Chimeric antigen receptor is logical The nucleic acid sequence for crossing its coding, which is transfected into T cell, to be expressed；
Preferably, the mode of the transfection be by viral vectors, eukaryon expression plasmid or mRNA sequence any one or At least two combination is transfected into T cell, is transfected into T cell preferably by viral vectors；
Preferably, the viral vectors be in slow virus carrier or retroviral vector any one or at least two group It closes, preferably slow virus carrier.
7. a kind of recombinant slow virus, which is characterized in that will be comprising such as dual chimeric antigen of any of claims 1-6 The viral vectors of the immunocyte of acceptor gene modification is obtained with packaging helper plasmid pNHP and pHEF-VSVG cotransfection mammalian cell The recombinant slow virus arrived；
Preferably, the mammalian cell is 293 cells, any one in 293T cell or TE671 cell or at least two Combination.
8. a kind of pharmaceutical composition, which is characterized in that the composition includes as of any of claims 1-6 dual The immunocyte of Chimeric antigen receptor gene modification and/or recombinant slow virus as claimed in claim 7.
9. as the immunocyte of dual Chimeric antigen receptor gene modification of any of claims 1-6, such as right are wanted Recombinant slow virus described in asking 7 or pharmaceutical composition as claimed in claim 8 are preparing Chimeric antigen receptor T cell, are being immunized Application in competent cell or tumor therapeutic agent.
10. application according to claim 9, which is characterized in that the tumour is the relevant tumor disease of blood；
Preferably, the relevant tumor disease of the blood is leukaemia or lymthoma.
CN201811460000.4A 2018-11-30 2018-11-30 CD19 and CD22 based double chimeric antigen receptor gene modified immune cell and application thereof Active CN109517799B (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
CN201811460000.4A CN109517799B (en) 2018-11-30 2018-11-30 CD19 and CD22 based double chimeric antigen receptor gene modified immune cell and application thereof
PCT/CN2019/122162 WO2020108644A1 (en) 2018-11-30 2019-11-29 Cd19-and cd22-based combined car-t immunotherapy

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN201811460000.4A CN109517799B (en) 2018-11-30 2018-11-30 CD19 and CD22 based double chimeric antigen receptor gene modified immune cell and application thereof

Publications (2)

Publication Number Publication Date
CN109517799A true CN109517799A (en) 2019-03-26
CN109517799B CN109517799B (en) 2022-07-26

Family

ID=65794990

Family Applications (1)

Application Number Title Priority Date Filing Date
CN201811460000.4A Active CN109517799B (en) 2018-11-30 2018-11-30 CD19 and CD22 based double chimeric antigen receptor gene modified immune cell and application thereof

Country Status (2)

Country Link
CN (1) CN109517799B (en)
WO (1) WO2020108644A1 (en)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020108644A1 (en) * 2018-11-30 2020-06-04 Beijing Meikang Geno-Immune Biotechnology Co., Ltd. Cd19-and cd22-based combined car-t immunotherapy
CN111808200A (en) * 2020-07-16 2020-10-23 广东昭泰体内生物医药科技有限公司 CD19 and CD22 double-target chimeric antigen receptor and application thereof
WO2021027867A1 (en) * 2019-08-14 2021-02-18 苏州方德门达新药开发有限公司 Chimeric antigen receptor, construction method therefor and application thereof
WO2021197483A1 (en) * 2020-04-02 2021-10-07 南京驯鹿医疗技术有限公司 Fully human anti-human cd22 chimeric antigen receptor and application thereof
CN114369622A (en) * 2021-12-31 2022-04-19 西安桑尼赛尔生物医药有限公司 Bispecific universal CAR-T cells simultaneously targeting CD7 and CD19 and methods of making the same
CN116462770A (en) * 2023-04-18 2023-07-21 上海科棋药业科技有限公司 Humanized antibody of CD19, CAR-T cell expressing bispecific chimeric antigen receptor and application thereof

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20230241212A1 (en) * 2020-06-30 2023-08-03 Nanjing Iaso Biotherapeutics Co., Ltd. Fully humanized bispecific chimeric antigen receptor targeting cd19 and cd22 and use thereof
CA3203531A1 (en) 2020-12-30 2022-07-07 Simon Olivares Recombinant vectors comprising polycistronic expression cassettes and methods of use thereof
KR102393776B1 (en) * 2020-12-30 2022-05-04 (주)이노베이션바이오 Humanized antibody specific for CD22 and chimeric antigen receptor using the same
KR20230072536A (en) * 2021-11-17 2023-05-25 (주)이노베이션바이오 Humanized antibody specific for CD22 and chimeric antigen receptor using the same

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105246504A (en) * 2013-03-15 2016-01-13 纪念斯隆-凯特琳癌症中心 Compositions and methods for immunotherapy
AU2015376656A1 (en) * 2015-08-07 2017-02-23 Shenzhen In Vivo Biomedicine Technology Limited Company Chimeric antigen receptor containing a Toll-like receptor intracellular domain
CN107312098A (en) * 2017-07-18 2017-11-03 深圳市免疫基因治疗研究院 A kind of Chimeric antigen receptor and its application based on CD22
CN108383914A (en) * 2018-02-23 2018-08-10 北京美康基免生物科技有限公司 A kind of Chimeric antigen receptor and its application based on CD19

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10738116B2 (en) * 2015-03-19 2020-08-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Dual specific anti-CD22-anti-CD19 chimeric antigen receptors
CN108715859B (en) * 2018-05-31 2021-08-03 中国医学科学院血液病医院(中国医学科学院血液学研究所) Chimeric antigen receptor targeting CD22 and application thereof
CN109678965B (en) * 2018-10-12 2023-04-07 中国人民解放军总医院 Chimeric antigen receptor, gene and recombinant expression vector thereof, CD22-CD19 dual-targeting T cell and application thereof
CN109517799B (en) * 2018-11-30 2022-07-26 北京美康基免生物科技有限公司 CD19 and CD22 based double chimeric antigen receptor gene modified immune cell and application thereof

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105246504A (en) * 2013-03-15 2016-01-13 纪念斯隆-凯特琳癌症中心 Compositions and methods for immunotherapy
AU2015376656A1 (en) * 2015-08-07 2017-02-23 Shenzhen In Vivo Biomedicine Technology Limited Company Chimeric antigen receptor containing a Toll-like receptor intracellular domain
CN107312098A (en) * 2017-07-18 2017-11-03 深圳市免疫基因治疗研究院 A kind of Chimeric antigen receptor and its application based on CD22
CN108383914A (en) * 2018-02-23 2018-08-10 北京美康基免生物科技有限公司 A kind of Chimeric antigen receptor and its application based on CD19

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
王用揖: "病毒性疾病的免疫问题", 《微生物学报》 *

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020108644A1 (en) * 2018-11-30 2020-06-04 Beijing Meikang Geno-Immune Biotechnology Co., Ltd. Cd19-and cd22-based combined car-t immunotherapy
WO2021027867A1 (en) * 2019-08-14 2021-02-18 苏州方德门达新药开发有限公司 Chimeric antigen receptor, construction method therefor and application thereof
WO2021197483A1 (en) * 2020-04-02 2021-10-07 南京驯鹿医疗技术有限公司 Fully human anti-human cd22 chimeric antigen receptor and application thereof
CN111808200A (en) * 2020-07-16 2020-10-23 广东昭泰体内生物医药科技有限公司 CD19 and CD22 double-target chimeric antigen receptor and application thereof
CN114369622A (en) * 2021-12-31 2022-04-19 西安桑尼赛尔生物医药有限公司 Bispecific universal CAR-T cells simultaneously targeting CD7 and CD19 and methods of making the same
CN116462770A (en) * 2023-04-18 2023-07-21 上海科棋药业科技有限公司 Humanized antibody of CD19, CAR-T cell expressing bispecific chimeric antigen receptor and application thereof
CN116462770B (en) * 2023-04-18 2024-03-08 科弈(浙江)药业科技有限公司 Humanized antibody of CD19, CAR-T cell expressing bispecific chimeric antigen receptor and application thereof

Also Published As

Publication number Publication date
CN109517799B (en) 2022-07-26
WO2020108644A1 (en) 2020-06-04

Similar Documents

Publication Publication Date Title
CN109517799A (en) A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and CD22 and its application
CN108383914A (en) A kind of Chimeric antigen receptor and its application based on CD19
CN109880802A (en) A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and CD70 and its application
CN109468284A (en) A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and PSMA and its application
CN109468283A (en) A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and BCMA and its application
CN112142854B (en) Immune regulation specific chimeric antigen receptor cell and preparation method and application thereof
CN109562126A (en) Chimeric antigen receptor (CAR), composition and its application method
CN108047332B (en) Specific antibody with CD19 as target, CAR-NK cell, and preparation and application thereof
CN108395482B (en) Construction of targeting CD20 antigen chimeric antigen receptor and activity identification of engineered T cell thereof
CN108948211A (en) A kind of Chimeric antigen receptor and its application based on GD2
KR20200000495A (en) Nucleic acid for coding chimeric antigen feceptor protein and t lymphocyte for expression of chimeric antigen receprof prorein
CN107245107B (en) Chimeric antigen receptor based on CD20 and application thereof
CN107709353A (en) The method and composition for the treatment of cancer
CN109468279A (en) Target immune effector cell and its application of GPC3
JP2022078246A (en) Recombinant immunocyte, manufacture method, and use method
CN110951689A (en) CD19 and CD30 based double chimeric antigen receptor gene modified immune cell and application thereof
CN113896801B (en) Chimeric antigen receptor cell targeting human Claudin18.2 and NKG2DL, and preparation method and application thereof
CN107287163B (en) Express the dendritic cells and application thereof of Chimeric antigen receptor
CN113583139A (en) Chimeric receptor and application thereof
CN111848810A (en) Protein molecule and application thereof
CN108047333B (en) Specific antibody with CD33 as target, CAR-NK cell, and preparation and application thereof
CN114591444A (en) Humanized chimeric antigen receptor based on CD7 and application thereof
US20230399627A1 (en) Vector genetically engineered with chimeric antigen receptor and against two or more targets and application thereof
KR20210141573A (en) anti-BCMA chimeric antigen receptor
CN110079502B (en) PD-L1CAR-NK cell and preparation and application thereof

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
GR01 Patent grant
GR01 Patent grant