CN108165565B - Mycobacterium tuberculosis H37Rv encoding gene and application thereof - Google Patents
Mycobacterium tuberculosis H37Rv encoding gene and application thereof Download PDFInfo
- Publication number
- CN108165565B CN108165565B CN201711251282.2A CN201711251282A CN108165565B CN 108165565 B CN108165565 B CN 108165565B CN 201711251282 A CN201711251282 A CN 201711251282A CN 108165565 B CN108165565 B CN 108165565B
- Authority
- CN
- China
- Prior art keywords
- gene
- mycobacterium tuberculosis
- sequence
- dna
- h37rv
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/35—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Mycobacteriaceae (F)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6888—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms
- C12Q1/689—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms for bacteria
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Analytical Chemistry (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Wood Science & Technology (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Immunology (AREA)
- Biotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicinal Chemistry (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The invention relates to a mycobacterium tuberculosis H37Rv coding gene which can be used as a standard gene for molecular identification of mycobacterium tuberculosis complex and is used for molecular identification and clinical detection of the mycobacterium tuberculosis complex.
Description
Technical Field
The invention relates to the field of gene detection, in particular to identification of pathogenic bacteria species.
Background
Mycobacterium Tuberculosis (MTB) is a pathogenic bacterium that causes tuberculosis in humans. It can invade all organs of the body, but pulmonary tuberculosis is the most common. Tuberculosis is an extremely important infectious disease so far and seriously threatens the life health of human beings. It is reported by WHO that about 800 new cases occur each year, and at least 300 million people die from the disease. The clinical bacterial strain of MTB is difficult to culture, slow in growth, capable of cross-infecting with other mycobacteria, difficult to distinguish between tuberculosis and other respiratory tract infection symptoms and the like, and brings great difficulty to clinical rapid diagnosis and treatment. Therefore, the establishment of a quick, accurate, specific, sensitive and cheap tuberculosis detection method is a necessary premise for effectively treating and controlling tuberculosis spreading, and is a new challenge and a new task for detecting mycobacterium in clinical laboratories.
Mycobacterium tuberculosis complex (MTBC) includes the Mycobacterium groups m.tuberculosis, m.africanum, m.orygis, m.bovis, m.microti, m.canettii, m.caprae, m.pinnipedii, m.subcatetate, m.mungi, which all cause tuberculosis in humans and other life forms. At present, the domestic and foreign MTBC identification method is mainly divided into the following three categories: traditional separation culture method; molecular level detection (IS6110, restriction fragment length polymorphism analysis, multi-site variable number repeat polymorphism analysis, etc.); a method for analyzing the components of a microorganism (fatty acid, mycolic acid) by chromatography. The three methods have respective advantages, but have disadvantages, such as long separation culture period and low thallus culturable rate; at present, the molecular level detection is poor in specificity, sensitivity and simplicity; the analysis cost of the thallus component characteristics is high, and the operation is complex.
MTB H37Rv completed whole genome sequencing in 1998, the MTB strain that completed whole genome sequencing the earliest. From this point on, researchers in various countries are perfecting and supplementing H37Rv gene annotation databases based on strategies such as algorithm optimization, annotation software updating, transcriptomics and proteomics. However, since MTB belongs to prokaryotes, annotation errors (over-annotation, gene boundary error, ORF initiation, termination site error, alternative splicing, ribosome translocation, missing annotation) may still exist in genome annotation due to the inherent shortcomings of the prokaryote genome annotation technology, which brings trouble to deep and accurate analysis of biological mechanisms. In order to solve the problem, proteomics (proteomics) has been used for correcting the annotated gene of H37Rv, however, high-proportion false positive, difficulty in annotated gene prediction, new gene verification, new gene function analysis and application thereof, and the like, are problems faced in the field. In general, the traditional mycobacterium tuberculosis complex (MTBC) identification strategy has the defects of long period, tedious steps, low specificity and sensitivity and the like. In order to further perfect re-annotation of the H37Rv whole genome, missing annotation genes in H37Rv are found, the H37Rv whole genome missing annotation genes and application technologies thereof in MTBC molecular identification are effectively protected, and a method for quickly and accurately identifying the MTBC group by using the H37Rv new genes is imperatively developed.
Disclosure of Invention
An object of the present invention is to provide a new encoding gene of mycobacterium tuberculosis H37Rv, which is H37Rv minus annotation encoding gene Rv2003(- | 2249260-.
Other objects of the present invention include providing specific PCR primers useful for amplifying the above-described encoding genes and providing a method of detecting or identifying the presence of a binding Mycobacterium complex in a sample; the invention also provides a detection kit related to the coding gene and application of the gene.
According to one aspect of the invention, by comparing proteomic research techniques, a protein coding sequence of H37Rv that is difficult to find by genetic prediction software was discovered that effectively distinguishes MTBC from other species of the same genus. The gene is a missing annotation gene of Mycobacterium tuberculosis (Mycobacterium tuberculosis H37Rv), namely Rv2003 (-2249260-2249457), after NCBI-BLASTP, the similarity with M.tuberculosis Bir 105 is 100%, the similarity with M.tuberculosis J09701920 is 98%, the similarity with M.canettii RefSeq (WP _041179674.1) is 97%, the similarity with other species is lower than 77%, and the functional annotation protein is Phosphoenolpyruvate synthsase. Comparative genomics studies show that the gene sequence can distinguish the Mycobacterium tuberculosis complex (MTBC) strain from other species of Mycobacterium.
Specifically, a primer capable of realizing specific amplification on the Rv2003(- | 2249260-:
F:5’-CCAACCATCACTGTCAGC-3’；
R:5’-AGCAACAATCGGCGTTC-3’。
according to the existence of the gene DNA sequence PCR product in the sample to be detected or the difference of the DNA sequence, the MTBC can be quickly and accurately identified.
According to another aspect of the present invention, based on the above-mentioned new standard encoding gene of Mycobacterium tuberculosis H37Rv, the present invention specifically establishes a method for detecting or identifying Mycobacterium tuberculosis complex, comprising the following steps:
(1) separating and extracting genome DNA from a sample to be detected;
(2) and (2) performing PCR amplification by using the DNA obtained in the step (1) as a template and adopting the following primers:
F:5’-CCAACCATCACTGTCAGC-3’(SEQ ID NO.4)；
R:5’-AGCAACAATCGGCGTTC-3’(SEQ ID NO.5)。
(3) performing gel electrophoresis analysis or sequencing on the DNA product obtained by amplification in the step (2);
(4) and (4) comparing the result of the step (3) with the barcode gene Rv2003(- | 2249260-.
Further, the detection method is characterized in that electrophoresis analysis is performed on the PCR product primarily according to the DNA bar code principle, and if the strain to be detected does not have a target band, the strain is not MTBC; if the band exists, further sequencing verification can be carried out, the sequence obtained by sequencing and the standard sequence of the Rv2003(- | 2249260-; and (3) distinguishing the MTBC family from nontuberculous mycobacteria, common respiratory pathogenic bacteria and common respiratory viruses according to the clustering condition of the DNA barcode sequence of the strain to be identified and the standard sequence.
The detection method can be used for strain identification research of the mycobacterium tuberculosis complex and can also be used for clinical rapid inspection. The sample to be detected can be H37Rv strain, other MTBC, nontuberculous mycobacteria, respiratory tract common pathogenic bacteria and respiratory tract common virus strain; or directly using sputum, saliva or blood of tuberculosis and other respiratory patients.
Based on the above method, the present invention also provides a detection kit, wherein the kit contains a reagent for detecting the novel standard encoding gene of Mycobacterium tuberculosis H37Rv in a container, and simultaneously provides manufacturing, using and marketing information about the medicine or biological product, which can be approved by a government drug administration. For example, the reagent for directly detecting the Rv2003(- | 2249260-. It is known to those skilled in the art that the above components are merely illustrative, and for example, the primers may employ the specific PCR primers described above, and the DNA polymerase used for the PCR reaction is an enzyme capable of being used for PCR amplification. The detection of the encoding gene of the present invention can also be provided in the form of an integrated, e.g., gene chip.
Has the advantages that: the invention provides a standard gene and a molecular identification method for molecular identification of Mycobacterium tuberculosis complex (MTBC), wherein the gene can effectively distinguish MTBC from other species of the same genus, the identification method using the gene overcomes the defects of primer design multiplicity, poor result repeatability and the like in the existing identification process of the Mycobacterium tuberculosis complex, has the characteristics of universality, easy amplification and easy comparison, can accurately identify the class from other mycobacteria with close relativity or other respiratory tract infectious germs, and provides powerful technical means and research tools for the epidemiological investigation and the rapid diagnosis and identification of clinical tuberculosis patients.
Drawings
FIG. 1: evidence of peptide profile matching supporting the discovery of new coding genes;
FIG. 2: comparing the mass spectrogram of the synthesized peptide fragment with the mass spectrogram of the original identified peptide fragment;
FIG. 3: a corresponding diagram of a protein sequence coded by ORF of the peptide fragment locus region; the underlined part is the peptide identified in proteomics and verified by the synthetic peptide;
FIG. 4: comparing the homology of the Rv2003(- |2249260-2249457|) standard gene sequence;
FIG. 5: the result of the protein sequence BLASTP corresponding to the Rv2003(- | 2249260) -2249457|) gene of the H37Rv strain;
FIG. 6: the result of agarose gel electrophoresis of the PCR amplification product of the Rv2003(- | 2249260) -specific primer;
wherein, the information of each lane sample is shown in Table 1.
FIG. 7: the PCR amplification sequencing result of the Rv2003(- |2249260-2249457|) gene is compared with a standard sequence.
Detailed Description
The invention is further described with reference to specific embodiments, but the scope of the claims is not limited thereto. The reagents used in the present invention are all commercially available.
Example 1: search for genes encoding missing release of the genome of strain H37Rv
1.1 high coverage proteomic validation of the genome of the H37Rv strain
The deep coverage study of proteome was performed on the H37Rv strain using the high coverage proteome technique. Annotated encoding gene validation was performed on its genome using the pFind 3 engine based on the Tuberculosis (20160307) database. To find new protein coding regions, we performed six-reading-frame database translation of H37Rv in the genome-wide (NC _000962.3) file published at NCBI using pAnno software based on proteomic technology, and identified new peptide fragments and new proteins using this database for mass spectrometry data. To reduce the false positive rate, we used 3 filtering methods to separately estimate class FDR for the annotated and new peptide fragments, S-FDR, T-FDR I and T-FDR II, respectively, during the data filtering.
Through data analysis, a total of 3238H 37Rv annotated genes are identified, and the coverage is as high as more than 80% of the strain, which is the largest mass spectrum data of the H37Rv protein reported so far. In addition, we obtained new peptide fragments after 3 FDRs ≤ 1 filtration. In order to further ensure the quality of the new peptide fragments, spectrogram quality screening is carried out on spectrograms corresponding to the new peptide fragments left after filtration, and finally some peptide fragments with good spectrogram quality are reserved. To further investigate that these peptides with higher spectral quality were not due to single amino acid mutations in the annotated peptide, we performed amino acid mutation checks to ensure that these new peptides were newly identified peptides of H37 Rv.
1.2 verification of the encoded protein and database of the Rv2003(- |2249260-2249457|) Gene
After high coverage proteome verification, we find some suspected new peptide fragments which are leaked to release, and perform peptide fragment synthesis verification on the suspected new peptide fragments with high reliability, and score more than or equal to 0.8 according to the similarity between the original spectrum and the synthesized spectrum of the new peptide fragments as a similarity threshold, and after scoring and screening, a plurality of peptide fragments pass through verification and correspond to a new Open Reading Frame (ORF), namely the potential leaked to release genes of the current H37Rv strain.
Among them, we found that the new missing-release gene Rv2003(- |2249260-2249457|) has 100% similarity to M.tuboculosis Bir 105, 98% similarity to M.tuboculosis J09701920, 97% similarity to M.canettii RefSeq (WP-041179674.1) and 77% similarity to other species as compared with BLASTP, and the function annotation protein is Phosphoenolpyruvate synthsase. We detected a peptide segment MGITSVSVHSGAIAATPGSVAAAER (SEQ ID NO.6) and corresponded to the new gene Rv2003(- | 2249260-.
To further confirm this identification, we chemically synthesized the peptide according to the amino acid sequence of our newly identified peptide and generated a secondary spectrum of the synthesized peptide using the mass spectrometry conditions described above.
Our high energy collision MS on synthetic peptide fragments2Verification is carried out, and the primary parent ions and the secondary daughter ions both accord with theoretical values, so that the sequence of the synthesized peptide fragment is correct; on this basis, we manually examined MS of synthetic peptides of novel peptide sequences identified from large-scale proteomic data2And the large scale identification of the new peptide fragment spectrum, both of which are almost completely identical, the cosin value obtained by daughter ion similarity is 0.87, which proves that the new peptide fragment identified by us from H37Rv is correct. (FIG. 2).
After confirming the sequence of the peptide fragment to be released, according to the gene position of the peptide fragment, taking the region included by the former stop codon and the latter stop codon as a boundary, obtaining the Open Reading Frame (ORF) DNA sequence containing the new peptide fragment to be released, as shown in SEQ ID NO. 2.
TGAGCGCTCCGTGGGACAGGCCTACCACATCTGGCGCAGCGCGATCTGAGAACGCCGAAAGGAAAACCGATGCCAACCATCACTGTCAGCAGCACATCGTCGCTGTGTGGTCAAGCGCTCTCGGGCAACCCGACTTTCGCCGAGCATCTGGTCCGGATGGGAATCACCTCAGTGTCGGTCCATTCGGGCGCGATTGCTGCTACCCCGGGGTCGGTCGCGGCCGCCGAACGCCGATTGTTGCTGGAATCAGCTCGCGGTGACGCCTGA(SEQ ID NO.2)
The correspondence between the open reading frame code and the amino acid sequence is shown in FIG. 3.
Further translation verification revealed that the authentic gene sequence (SEQ ID NO.1) was found from the above-mentioned open reading frame DNA (SEQ ID NO.2)ATGAt the beginning, 198bp is used for coding 65 amino acids, the theoretical molecular weight of which is 6.51kDa, namely the gene Rv2003(- | 2249260-.
ATGCCAACCATCACTGTCAGCAGCACATCGTCGCTGTGTGGTCAAGCGCTCTCGGGCAACCCGACTTTCGCCGAGCATCTGGTCCGGATGGGAATCACCTCAGTGTCGGTCCATTCGGGCGCGATTGCTGCTACCCCGGGGTCGGTCGCGGCCGCCGAACGCCGATTGTTGCTGGAATCAGCTCGCGGTGACGCCTGA(SEQID NO.1)
The theoretical coding product amino acid sequence of the gene is shown as SEQ ID NO. 3:
MPTITVSSTSSLCGQALSGNPTFAEHLVRMGITSVSVHSGAIAATPGSVAAAERRLLLESARGDA(SEQ ID NO.3)
the amino acid sequence of the theoretical gene-encoded product shown in SEQ ID NO.3 was analyzed by NCBI-BLASTP, and found to have 100% similarity to M.tuboculosis Bir 105, 98% similarity to M.tuboculosis J09701920, 97% similarity to M.canettii RefSeq (WP _041179674.1), and 77% similarity to other species, with the functional annotated protein being Phosphoenolpyruvate synthsase (see FIG. 4). It was shown that the Rv2003(- |2249260-2249457|) gene product we detected was missing annotations in the H37Rv strain database.
We performed comparative genome local BLAST analysis on the DNA sequence of the Rv2003(- |2249260-2249457|) gene, as shown in FIG. 5, and the results show that the Rv2003(- |2249260-2249457|) gene sequence belongs to the MTBC family specific gene and has no more homologous sequence in other species, which indicates that the Rv2003(- |2249260-2249457|) gene sequence found in the H37Rv strain has better sequence specificity, and can distinguish MTBC from other mycobacteria and other respiratory tract infection bacteria in the same genus.
Example 2: method for establishing and identifying MTBC complex group
(1) Designing a primer:
based on the CDS sequence of the Rv2003(- |2249260-2249457|) gene shown as SEQ ID NO.1, the PCR primers are designed by using Oligo7.0, and the primer sequences are as follows:
F:5’-CCAACCATCACTGTCAGC-3’(SEQ ID NO.4)；
R:5’-AGCAACAATCGGCGTTC-3’(SEQ ID NO.5)
the positional relationship between the above primers and the Rv2003(- |2249260-2249457|) gene is shown below, wherein the primer is underlined.
ATGCCAACCATCACTGTCAGCAGCACATCGTCGCTGTGTGGTCAAGCGCTCTCGGGCAACCCGACTTTCGCCGAGCATCTGGTCCGGATGGGAATCACCTCAGTGTCGGTCCATTCGGGCGCGATTGCTGCTACCCCGGGGTCGGTCGCGGCCGCCGAACGCCGATTGTTGCTGGAATCAGCTCGCGGTGACGCCTGA
(SEQ ID NO.1)
(2) Extracting total DNA of strains to be detected including M.tuberculosis H37Rv, wherein 40 mycobacterium standard strains are preserved by China medical bacterial strain preservation management center (CMCC), the other 16 non-tuberculous mycobacteria are clinical isolates of 309 hospital of China people's liberation military, and the work of sequencing and comparing strains 16SRNA genes and submitting NCBI sequences is completed, wherein the strains to be detected are shown in Table 1:
TABLE 1 related strains selected
(3) The DNA fragment was amplified and subjected to Polymerase Chain Reaction (PCR) using the above F/R primer.
PCR System (25. mu.L) as ddH2O (9.5. mu.L), 2XTaq PCR MasterMix (TIANGEN, 12.5. mu.L), primer F (10. mu.M, 1. mu.L), primer R (10. mu.M, 1. mu.L), DNA template (1. mu.L);
and (3) amplification procedure: pre-denaturation at 94 ℃ for 3min, denaturation at 94 ℃ for 30s, annealing at 58 ℃ for 30s, extension at 72 ℃ for 1min, 35 cycles, and extension at 72 ℃ for 5 min.
(4) And (4) detecting the amplified product by electrophoresis in agarose gel and 1 xTBE electrophoresis solution. As a result, as shown in FIG. 6, an amplification band appeared at 170bp in MTBC and the control group, and the actual amplification result agreed with the expected one, and the specificity was 98.3%.
(5) To further verify the sequence of the amplified DNA, we sequenced the amplified sequence and compared it with the original sequence, as shown in FIG. 7, which is a perfect match to the expected sequence without errors, further verifying the presence of a new missing annotated gene.
This shows that the method for identifying MTBC complex based on Rv2003(- |2249260-2249457|) gene is true and reliable.
SEQUENCE LISTING
<110> Peking proteome research center
<120> Mycobacterium tuberculosis H37Rv encoding gene and application thereof
<130> BJ1936-17P121796
<160> 6
<170> PatentIn version 3.3
<210> 1
<211> 198
<212> DNA
<213> Artificial
<220>
<223> Mycobacterium tuberculosis H37Rv encoding gene Rv2003(- |2249260-
<400> 1
atgccaacca tcactgtcag cagcacatcg tcgctgtgtg gtcaagcgct ctcgggcaac 60
ccgactttcg ccgagcatct ggtccggatg ggaatcacct cagtgtcggt ccattcgggc 120
gcgattgctg ctaccccggg gtcggtcgcg gccgccgaac gccgattgtt gctggaatca 180
gctcgcggtg acgcctga 198
<210> 2
<211> 267
<212> DNA
<213> Artificial
<220>
<223> open reading frame DNA sequence comprising peptide fragment with missing annotation
<400> 2
tgagcgctcc gtgggacagg cctaccacat ctggcgcagc gcgatctgag aacgccgaaa 60
ggaaaaccga tgccaaccat cactgtcagc agcacatcgt cgctgtgtgg tcaagcgctc 120
tcgggcaacc cgactttcgc cgagcatctg gtccggatgg gaatcacctc agtgtcggtc 180
cattcgggcg cgattgctgc taccccgggg tcggtcgcgg ccgccgaacg ccgattgttg 240
ctggaatcag ctcgcggtga cgcctga 267
<210> 3
<211> 65
<212> PRT
<213> Artificial
<220>
<223> Rv2003(- |2249260-
<400> 3
Met Pro Thr Ile Thr Val Ser Ser Thr Ser Ser Leu Cys Gly Gln Ala
1 5 10 15
Leu Ser Gly Asn Pro Thr Phe Ala Glu His Leu Val Arg Met Gly Ile
20 25 30
Thr Ser Val Ser Val His Ser Gly Ala Ile Ala Ala Thr Pro Gly Ser
35 40 45
Val Ala Ala Ala Glu Arg Arg Leu Leu Leu Glu Ser Ala Arg Gly Asp
50 55 60
Ala
65
<210> 4
<211> 18
<212> DNA
<213> Artificial
<220>
<223> F primer sequences
<400> 4
<210> 5
<211> 17
<212> DNA
<213> Artificial
<220>
<223> R primer sequences
<400> 5
agcaacaatc ggcgttc 17
<210> 6
<211> 25
<212> PRT
<213> Artificial
<220>
<223> peptide fragment to be released by missed injection
<400> 6
Met Gly Ile Thr Ser Val Ser Val His Ser Gly Ala Ile Ala Ala Thr
1 5 10 15
Pro Gly Ser Val Ala Ala Ala Glu Arg
20 25
Claims (3)
1. A method for rapidly detecting and/or identifying whether a Mycobacterium tuberculosis complex class exists in a sample to be detected comprises the following steps:
(1) separating and extracting genome DNA from a sample to be detected;
(2) adding an amplification primer by taking the DNA obtained in the step (1) as a template to perform polymerase chain reaction;
(3) performing gel electrophoresis analysis or sequencing on the DNA product obtained by amplification in the step (2);
(4) comparing the result of the step (3) with the encoding gene of the mycobacterium tuberculosis H37Rv shown in SEQ ID NO.1, and judging whether the mycobacterium tuberculosis complex exists in the sample to be detected according to the homology; wherein the sequence of the amplification primer in the step (2) is as follows:
F:5’-CCAACCATCACTGTCAGC-3’；
R:5’-AGCAACAATCGGCGTTC-3’；
the method is not used for the diagnostic treatment of diseases.
2. A specific PCR primer for the genomic DNA amplification of a sample to be tested in the method of claim 1, wherein the sequence of the primer is as follows:
F:5’-CCAACCATCACTGTCAGC-3’；
R:5’-AGCAACAATCGGCGTTC-3’。
3. a test kit comprising the specific PCR primers of claim 2.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711251282.2A CN108165565B (en) | 2017-12-01 | 2017-12-01 | Mycobacterium tuberculosis H37Rv encoding gene and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711251282.2A CN108165565B (en) | 2017-12-01 | 2017-12-01 | Mycobacterium tuberculosis H37Rv encoding gene and application thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN108165565A CN108165565A (en) | 2018-06-15 |
| CN108165565B true CN108165565B (en) | 2021-04-20 |
Family
ID=62525094
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201711251282.2A Active CN108165565B (en) | 2017-12-01 | 2017-12-01 | Mycobacterium tuberculosis H37Rv encoding gene and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN108165565B (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110343706A (en) * | 2019-01-25 | 2019-10-18 | 北京蛋白质组研究中心 | Mycobacterium tuberculosis H37Rv encoding gene and its application |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1715422A (en) * | 2004-06-30 | 2006-01-04 | 中国农业科学院哈尔滨兽医研究所 | Novel Mycobacterium bovis and the method for quick identification of mycobacterium tuberculosis and application |
| CN103014135B (en) * | 2011-09-22 | 2016-02-10 | 上海市肺科医院 | A kind of method identifying mycobacterium tuberculosis |
-
2017
- 2017-12-01 CN CN201711251282.2A patent/CN108165565B/en active Active
Also Published As
| Publication number | Publication date |
|---|---|
| CN108165565A (en) | 2018-06-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN110408630B (en) | Mycobacterium tuberculosis H37Rv encoding gene and application thereof | |
| CN110408629B (en) | Mycobacterium tuberculosis H37Rv encoding gene and application thereof | |
| Jiang et al. | Comparison of the proteome of isoniazid-resistant and-susceptible strains of Mycobacterium tuberculosis | |
| CN108004253B (en) | Mycobacterium tuberculosis H37Rv encoding gene and application thereof | |
| CN108165561B (en) | Mycobacterium tuberculosis H37Rv encoding gene and application thereof | |
| CN108165562B (en) | Mycobacterium tuberculosis H37Rv encoding gene and application thereof | |
| CN113481311A (en) | SNP molecular marker for identifying Brucella vaccine strain M5 and application thereof | |
| CN108165565B (en) | Mycobacterium tuberculosis H37Rv encoding gene and application thereof | |
| CN108165564B (en) | Mycobacterium tuberculosis H37Rv encoding gene and application thereof | |
| CN108165560B (en) | Mycobacterium tuberculosis H37Rv encoding gene and application thereof | |
| CN110408632B (en) | Mycobacterium tuberculosis H37Rv encoding gene and application thereof | |
| CN110511995B (en) | Tuberculosis markers and application thereof | |
| CN105603081B (en) | Non-diagnosis-purpose qualitative and quantitative detection method for intestinal microorganisms | |
| CN108165563B (en) | Mycobacterium tuberculosis H37Rv encoding gene and application thereof | |
| CN110408631B (en) | Mycobacterium tuberculosis H37Rv encoding gene and application thereof | |
| CN114041188A (en) | Method for detecting helicobacter pylori levels in fecal samples | |
| WO2021246045A1 (en) | System and method for identifying species or subspecies of non-tuberculous mycobacteria present in specimen | |
| CN114196779A (en) | Pathogenic microorganism detection method and kit based on targeted sequencing | |
| CN114107454A (en) | Respiratory tract infection pathogen detection method based on macrogene/macrotranscriptome sequencing | |
| Mironov et al. | Multilocus sequence-typing scheme for Borrelia miyamotoi—the erythema-free ixodid tick-borne borreliosis pathogens | |
| Huang et al. | rpoB nested PCR and sequencing for the early diagnosis of tuberculous meningitis and rifampicin resistance | |
| CN113174443B (en) | Mycobacterium identification method and biological material thereof | |
| CN110343706A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| Zhu et al. | Metataxonomics of Internal Transcribed Spacer amplicons in cerebrospinal fluid for diagnosing and genotyping of cryptococcal meningitis | |
| CN110938702B (en) | Method for detecting mycobacterium avium by real-time fluorescent PCR and application thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant | ||
| TR01 | Transfer of patent right | ||
| TR01 | Transfer of patent right |
Effective date of registration: 20230613 Address after: 100850 No. 27 Taiping Road, Beijing, Haidian District Patentee after: ACADEMY OF MILITARY MEDICAL SCIENCES Address before: Building 1, No.33, kekeyuan Road, Changping District, Beijing Patentee before: BEIJING PROTEOME RESEARCH CENTER |