CN107520162A - A kind of taper roller surface processing device - Google Patents
A kind of taper roller surface processing device Download PDFInfo
- Publication number
- CN107520162A CN107520162A CN201710774370.4A CN201710774370A CN107520162A CN 107520162 A CN107520162 A CN 107520162A CN 201710774370 A CN201710774370 A CN 201710774370A CN 107520162 A CN107520162 A CN 107520162A
- Authority
- CN
- China
- Prior art keywords
- casing
- taper roller
- processing device
- roller surface
- surface processing
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 238000012545 processing Methods 0.000 title claims abstract description 22
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims abstract description 19
- 239000010865 sewage Substances 0.000 claims description 10
- 238000001914 filtration Methods 0.000 claims description 7
- UHOVQNZJYSORNB-UHFFFAOYSA-N monobenzene Natural products C1=CC=CC=C1 UHOVQNZJYSORNB-UHFFFAOYSA-N 0.000 claims description 7
- 239000002270 dispersing agent Substances 0.000 claims description 6
- 239000006229 carbon black Substances 0.000 claims description 5
- 238000013329 compounding Methods 0.000 claims description 5
- 239000004615 ingredient Substances 0.000 claims description 5
- 210000003462 vein Anatomy 0.000 claims description 5
- 230000008878 coupling Effects 0.000 claims description 4
- 238000010168 coupling process Methods 0.000 claims description 4
- 238000005859 coupling reaction Methods 0.000 claims description 4
- 238000010058 rubber compounding Methods 0.000 claims description 4
- KAKZBPTYRLMSJV-UHFFFAOYSA-N vinyl-ethylene Natural products C=CC=C KAKZBPTYRLMSJV-UHFFFAOYSA-N 0.000 claims description 4
- 150000002148 esters Chemical class 0.000 claims description 3
- 238000004140 cleaning Methods 0.000 abstract description 37
- 238000010276 construction Methods 0.000 abstract description 3
- 230000007613 environmental effect Effects 0.000 abstract description 2
- 239000012535 impurity Substances 0.000 description 10
- 230000000903 blocking effect Effects 0.000 description 6
- 108090000765 processed proteins & peptides Proteins 0.000 description 6
- 102000004196 processed proteins & peptides Human genes 0.000 description 6
- 239000000463 material Substances 0.000 description 5
- 238000012216 screening Methods 0.000 description 5
- 239000007921 spray Substances 0.000 description 5
- 230000001105 regulatory effect Effects 0.000 description 4
- 238000005265 energy consumption Methods 0.000 description 3
- 239000000945 filler Substances 0.000 description 3
- 210000002683 foot Anatomy 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 238000004513 sizing Methods 0.000 description 3
- 125000003275 alpha amino acid group Chemical group 0.000 description 2
- 238000005452 bending Methods 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- 238000001035 drying Methods 0.000 description 2
- 230000003670 easy-to-clean Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 239000003292 glue Substances 0.000 description 2
- 230000001050 lubricating effect Effects 0.000 description 2
- 238000003754 machining Methods 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- YUGFLWBWAJFGKY-BQBZGAKWSA-N Arg-Cys-Gly Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CS)C(=O)NCC(O)=O YUGFLWBWAJFGKY-BQBZGAKWSA-N 0.000 description 1
- GEEXORWTBTUOHC-FXQIFTODSA-N Cys-Arg-Ser Chemical compound C(C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CS)N)CN=C(N)N GEEXORWTBTUOHC-FXQIFTODSA-N 0.000 description 1
- ZOKPRHVIFAUJPV-GUBZILKMSA-N Cys-Pro-Arg Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CS)N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O ZOKPRHVIFAUJPV-GUBZILKMSA-N 0.000 description 1
- 241000880493 Leptailurus serval Species 0.000 description 1
- BTSXLXFPMZXVPR-DLOVCJGASA-N Lys-Ala-His Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CCCCN)N BTSXLXFPMZXVPR-DLOVCJGASA-N 0.000 description 1
- 241000209051 Saccharum Species 0.000 description 1
- KCFKKAQKRZBWJB-ZLUOBGJFSA-N Ser-Cys-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(O)=O KCFKKAQKRZBWJB-ZLUOBGJFSA-N 0.000 description 1
- SGZVZUCRAVSPKQ-FXQIFTODSA-N Ser-Val-Cys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CO)N SGZVZUCRAVSPKQ-FXQIFTODSA-N 0.000 description 1
- HNDMFDBQXYZSRM-IHRRRGAJSA-N Ser-Val-Phe Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O HNDMFDBQXYZSRM-IHRRRGAJSA-N 0.000 description 1
- AKXBNSZMYAOGLS-STQMWFEESA-N Tyr-Arg-Gly Chemical compound NC(N)=NCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 AKXBNSZMYAOGLS-STQMWFEESA-N 0.000 description 1
- KLGFILUOTCBNLJ-IHRRRGAJSA-N Tyr-Cys-Arg Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N)O KLGFILUOTCBNLJ-IHRRRGAJSA-N 0.000 description 1
- UUJHRSTVQCFDPA-UFYCRDLUSA-N Tyr-Tyr-Val Chemical compound C([C@@H](C(=O)N[C@@H](C(C)C)C(O)=O)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 UUJHRSTVQCFDPA-UFYCRDLUSA-N 0.000 description 1
- CWSIBTLMMQLPPZ-FXQIFTODSA-N Val-Cys-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](C(C)C)N CWSIBTLMMQLPPZ-FXQIFTODSA-N 0.000 description 1
- FRUYSSRPJXNRRB-GUBZILKMSA-N Val-Cys-Arg Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N FRUYSSRPJXNRRB-GUBZILKMSA-N 0.000 description 1
- 238000004026 adhesive bonding Methods 0.000 description 1
- 230000003712 anti-aging effect Effects 0.000 description 1
- 238000013475 authorization Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- FSXRLASFHBWESK-UHFFFAOYSA-N dipeptide phenylalanyl-tyrosine Natural products C=1C=C(O)C=CC=1CC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FSXRLASFHBWESK-UHFFFAOYSA-N 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 230000005611 electricity Effects 0.000 description 1
- XBGGUPMXALFZOT-UHFFFAOYSA-N glycyl-L-tyrosine hemihydrate Natural products NCC(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 XBGGUPMXALFZOT-UHFFFAOYSA-N 0.000 description 1
- 108010037850 glycylvaline Proteins 0.000 description 1
- 238000009434 installation Methods 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 238000000034 method Methods 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000001846 repelling effect Effects 0.000 description 1
- 238000005507 spraying Methods 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B3/00—Cleaning by methods involving the use or presence of liquid or steam
- B08B3/02—Cleaning by the force of jets or sprays
- B08B3/022—Cleaning travelling work
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D29/00—Filters with filtering elements stationary during filtration, e.g. pressure or suction filters, not covered by groups B01D24/00 - B01D27/00; Filtering elements therefor
- B01D29/01—Filters with filtering elements stationary during filtration, e.g. pressure or suction filters, not covered by groups B01D24/00 - B01D27/00; Filtering elements therefor with flat filtering elements
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D29/00—Filters with filtering elements stationary during filtration, e.g. pressure or suction filters, not covered by groups B01D24/00 - B01D27/00; Filtering elements therefor
- B01D29/50—Filters with filtering elements stationary during filtration, e.g. pressure or suction filters, not covered by groups B01D24/00 - B01D27/00; Filtering elements therefor with multiple filtering elements, characterised by their mutual disposition
- B01D29/56—Filters with filtering elements stationary during filtration, e.g. pressure or suction filters, not covered by groups B01D24/00 - B01D27/00; Filtering elements therefor with multiple filtering elements, characterised by their mutual disposition in series connection
- B01D29/58—Filters with filtering elements stationary during filtration, e.g. pressure or suction filters, not covered by groups B01D24/00 - B01D27/00; Filtering elements therefor with multiple filtering elements, characterised by their mutual disposition in series connection arranged concentrically or coaxially
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D35/00—Filtering devices having features not specifically covered by groups B01D24/00 - B01D33/00, or for applications not specifically covered by groups B01D24/00 - B01D33/00; Auxiliary devices for filtration; Filter housing constructions
- B01D35/02—Filters adapted for location in special places, e.g. pipe-lines, pumps, stop-cocks
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B13/00—Accessories or details of general applicability for machines or apparatus for cleaning
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B3/00—Cleaning by methods involving the use or presence of liquid or steam
- B08B3/04—Cleaning involving contact with liquid
- B08B3/041—Cleaning travelling work
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B3/00—Cleaning by methods involving the use or presence of liquid or steam
- B08B3/04—Cleaning involving contact with liquid
- B08B3/10—Cleaning involving contact with liquid with additional treatment of the liquid or of the object being cleaned, e.g. by heat, by electricity or by vibration
- B08B3/14—Removing waste, e.g. labels, from cleaning liquid; Regenerating cleaning liquids
Landscapes
- Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Vehicle Cleaning, Maintenance, Repair, Refitting, And Outriggers (AREA)
Abstract
The present invention provides a kind of taper roller surface processing device, belong to cleaning device technical field, taper roller surface processing device includes casing, support baseboard, shower nozzle, support baseboard bottom both ends are provided with support feet, support baseboard upper end is connected with casing, motor is provided with the left of casing, casing upper end is provided with top cover, top cover both sides are provided with high pressure whirlpool blower fan, water pump is provided between high pressure whirlpool blower fan, water pump output end is connected with conduit, conduit is in casing internal, catheter output end is connected with shower nozzle, the surface of casing is provided with machine box door and PLC control devices, the surface of machine box door is provided with watch window, the present apparatus is simple in construction, operation is easy, environmental protection and energy saving, cleaning efficiency is high, noise is low, it is practical.
Description
Technical field
The invention belongs to cleaning device technical field, more particularly to a kind of taper roller surface processing device.
Background technology
At present, the cleaning equipment for bearing machining currently on the market has a series of problem, such as cleaning stirring dress
Put bad, it is impossible to comprehensive bearing cleaning, there is no filter screen device impurity screening, easily cause blocking, noise is too big during work,
Working environment is influenceed, power consumption is high, and machinery easily causes damage etc., and result in production requirement cannot improve, and can not meet to make
Demand, equipment service wear make it that the use cost of equipment is very high quickly.There is an urgent need to can be modified to bearing in the market
The technology of the cleaning equipment service efficiency of processing, improves the equipment of the cleaning equipment for bearing machining, increases operation rate, and makes clear
The efficiency washed improves, and the speed of cleaning is accelerated, and saves the time, cost-effective.
Prior art such as, Chinese invention granted patent document, the A of Authorization Notice No. CN 106955862, the disclosure of the invention
A kind of efficient bearing cleaner, including support baseboard, cleaning machine casing, the cleaning machine are installed on the support baseboard
The side of casing is fixed with motor, and the output revolving shaft of the motor is connected by shaft coupling with rotating shaft, the rotating shaft
One end be fixed with bolt column, be fixed with train wheel bridge and lower plate on the bolt column, the top installation of the cleaning machine casing
There is top cover, water pump is installed on the top cover, the water pump is connected with conduit, and spray nozzle is provided with the conduit, described clear
The surface of washing machine casing is provided with machine box door and PLC control devices, the invention, and train wheel bridge can be controlled with by regulating bolt post
The distance between clamping plate, suitable for different bearing type and size, and bearing can be clamped, avoid causing axle in cleaning
The phenomenon to drop is held, motor can drive train wheel bridge and lower plate to be rotated, bearing is comprehensively cleaned, but
It is to be cleaned in real work not thoroughly, cleaning efficiency is not high.
The content of the invention
It is an object of the invention to provide a kind of taper roller surface processing device, sets filter net device impurity screening, keeps away
Impurity after free of cleaning easily causes the situation of blocking, greatly reduces power consumption, improves the service efficiency and durability degree of device, real
It is more prominent with property, save time, cost-effective, raising cleaning efficiency, quickening cleaning rate.
The technical scheme taken to achieve the above object of the present invention is：A kind of taper roller surface processing device, including
Casing, support baseboard, shower nozzle, support baseboard bottom both ends are provided with support feet, and support baseboard upper end is connected with casing, on the left of casing
Provided with motor, casing upper end is provided with top cover, and top cover both sides are provided with high pressure whirlpool blower fan, water is provided between high pressure whirlpool blower fan
Pump, water pump output end are connected with conduit, and for conduit in casing internal, catheter output end is connected with shower nozzle, and the surface of casing is provided with
Machine box door and PLC control devices, the surface of machine box door are provided with watch window, and the present apparatus is simple in construction, operation is easy, environmental protection section
Energy, cleaning efficiency are high, noise is low, practical.
Preferably, motor output end is connected by shaft coupling with rotating shaft, one end and the bolt column of rotating shaft are connected, bolt column
It is provided with and is fixed with train wheel bridge and lower plate, the distance between train wheel bridge and lower plate can be controlled by regulating bolt post, fits
For different taper roller type and size, and taper roller can be clamped, when avoiding causing in cleaning taper roller
The phenomenon to drop.
Preferably, train wheel bridge and lower plate corresponding surface surface are provided with rubber layer, rubber layer surface is provided with anti-slip veins.Pass through
Rubber layer is set in upper lower plate corresponding surface, clamping plate is not caused to wear to taper roller surface when being clamped to taper roller,
Anti-slip veins are set in rubber layer surface, makes lower plate be easier to clamp taper roller, prevents taper roller from dropping.
Preferably, the rubber compounding of rubber layer by following component by weight：Rubber 100-120 parts, carbon
Black 11-25 parts, to benzene divinyl dibutyl ester 10-14 parts, dispersant 0.1-0.5 parts, organosilicon 0.1-7.5 parts, compounding ingredient 0.1-5
Part.This formula can reduce rubber cost, improve rubber performance, make material dispersion uniform, obtained rubber
Glue product anti-wear performance is strong, high temperature resistant, anti-aging, elastic good and possess good water repelling property, and service life is longer, has wide
Wealthy market prospects.
Preferably, dispersant is active peptides, the amino acid sequence of active peptides is：
SCASVCKAHCRSVCARRCGYYVSVFYRGVCRCYCRCPRC, each component added in energy lubricating formulations of the active peptides,
The internal friction of rubber macromolecule interchain is reduced, reduces compound viscosity, promotes scattered, the improvement sizing material of carbon black and other compounding ingredients
Homogeneity and processing characteristics, decline mixing time and energy consumption, accelerate the scattered of filler, further improve the resistance to of rubber
Mill property.
Preferably, being fixed with sewage catchment tank on support baseboard, sewage catchment tank is connected with casing by blow-off pipe, row
Screen pack, two layers of screen pack are provided with dirty pipe, screen pack is provided with coarse filtration net, and coarse filtration net side is provided with thin screen pack, if
Filter screen device impurity screening has been put, has avoided the impurity after cleaning from easily causing the situation of blocking, greatly reduces power consumption, can have
The service efficiency and durability degree that avoid unnecessary mechanical loss, improve device of effect, practicality is more prominent, save the time,
It is cost-effective, cleaning efficiency is improved, accelerates blowdown speed.
Preferably, shower nozzle upper end is provided with rotary shaft with conduit connection, inside bending-like water-supply-pipe is provided with inside shower nozzle.
By setting rotary shaft in shower nozzle and conduit connection, shower nozzle is set to be rotated with horizontal plane, can be with when cleaning taper roller surface
Make cleaning that built-in pipe more totally, more rapidly, more thoroughly are set into bending-like by being cleaned under rotation spray, make what shower nozzle sprayed
Water forms one and inwardly intersected, and taper roller some are not easy to clean to dead angle, can also clean to, increase the practicality of equipment
Property, improve cleaning efficiency.
Preferably, water-supply-pipe angle is 145 ° ~ 165 °.Water outlet pipe outlet is provided with rubber grain apopore.
By the way that the section of tubing in shower nozzle is set into certain bending angle, enable the water preferably cleaning objects table of ejection
Face, prevent dead angle or do not wash clean clearly, be provided with rubber grain apopore in delivery port, can be blocked up in shower nozzle apopore by incrustation scale
During plug, also it is easier to be cleaned, reduces the trouble for tearing shower nozzle internal structure open, is that equipment is more practical, more convenient.
Compared with prior art, beneficial effects of the present invention are：Taper roller that the present invention cleans is clean thoroughly, to circular cone
Roller surface damage is small, sets filter net device impurity screening, avoids the impurity after cleaning from easily causing the situation of blocking, drops significantly
Low power consumption, improve the service efficiency and durability degree of device, by adding dispersant in rubber compounding, reduce be kneaded it is gluing
Degree improves the homogeneity and processing characteristics of sizing material, declines mixing time and energy consumption, accelerates the scattered of filler, further improves rubber
The wearability of glue product, the present apparatus is simple in construction, operation is easy, cleaning efficiency is high, noise is low, practical.
Present invention employs a kind of taper roller surface processing device that above-mentioned technical proposal provides, prior art compensate for
Deficiency, it is reasonable in design, it is easy to operate.
Brief description of the drawings
Fig. 1 is schematic structural view of the invention；
Fig. 2 is machine box door structural representation of the present invention；
Fig. 3 is clamp region schematic diagram above and below the present invention；
Fig. 4 is shower nozzle sectional view of the present invention；
Fig. 5 is filter screen structure schematic diagram of the present invention.
Description of reference numerals：1 machine box door；2PLC control devices；3 watch windows；4 top covers；5 conduits；6 water pumps；7 shower nozzles；8 turns
Axle；9 high pressure whirlpool blower fans；10 motors；11 sewage catchment tanks；12 support feets；13 support baseboards；14 casings；15 lower plates；16 spiral shells
Hitching post；17 train wheel bridges；18 rubber layers；19 screen packs；20 coarse filtration nets；21 thin screen packs；22 water-supply-pipes；23 rotary shafts.
Embodiment
Technical scheme is described in further detail with accompanying drawing with reference to embodiments：
Embodiment 1：
As shown in Fig. 1 ~ 5, a kind of taper roller surface processing device, including casing 14, support baseboard 13, shower nozzle 7, the support
The bottom both ends of bottom plate 13 are provided with support feet 12, and sewage catchment tank 11, sewage catchment tank 11 and casing are fixed with support baseboard 13
14 are connected by blow-off pipe, and screen pack 19 is provided with blow-off pipe, and screen pack 19 is two layers, and screen pack 19 is provided with coarse filtration net 20,
The side of coarse filtration net 20 is provided with thin screen pack 21, and there is provided filter screen device impurity screening, avoids the impurity after cleaning from easily making
Into the situation of blocking, greatly reduce power consumption, can effectively avoid unnecessary mechanical loss, improve device service efficiency and
Durability degree, practicality is more prominent, saves time, cost-effective, raising cleaning efficiency, quickening blowdown speed.The left side of casing 14
Provided with motor 10, the output end of motor 10 is connected by shaft coupling with rotating shaft 8, and one end and the bolt column 16 of rotating shaft 8 are connected, bolt column
Be provided be fixed with train wheel bridge 17 and lower plate 15, by regulating bolt post can control between train wheel bridge and lower plate away from
From suitable for different taper roller type and size, and taper roller being clamped, avoid causing circular cone to roll in cleaning
The phenomenon that the period of the day from 11 p.m. to 1 a.m drops, train wheel bridge 17 and the corresponding surface surface of lower plate 15 are provided with rubber layer 18, and the surface of rubber layer 18 is provided with
Anti-slip veins.By setting rubber layer in upper lower plate corresponding surface, make clamping plate will not be to taper roller table when being clamped to taper roller
Face is caused to wear, and anti-slip veins are set in rubber layer surface, is made lower plate be easier to clamp taper roller, is prevented taper roller
Drop.The upper end of casing 14 is provided with top cover 4, and the both sides of top cover 4 are provided with high pressure whirlpool blower fan 9, water is provided between high pressure whirlpool blower fan 9
Pump 6, the output end of water pump 6 are connected with conduit 5, and conduit 5 is inside casing 14, and the output end of conduit 5 is connected with shower nozzle 7, casing 14
Surface is provided with machine box door 1 and PLC control devices 2, and the surface of machine box door 1 is provided with watch window 3, and the upper end of shower nozzle 7 connects with conduit 5
Meet place and be provided with rotary shaft 23, the inside of shower nozzle 7 is provided with inside bending-like water-supply-pipe 22.Revolved by being set in shower nozzle and conduit connection
Rotating shaft, shower nozzle is rotated with horizontal plane, when cleaning taper roller surface, by being cleaned under rotation spray cleaning can be made more dry
Only, more rapidly, more thoroughly, built-in pipe is set to bending-like, the water for spraying shower nozzle forms one and inwardly intersected, and circular cone is rolled
Some of son are not easy to clean to dead angle, can also clean to, and increase the practicality of equipment, improve cleaning efficiency, and water-supply-pipe 22 presss from both sides
Angle is 155 °.The delivery port of water-supply-pipe 22 is provided with rubber grain apopore.By the way that the section of tubing in shower nozzle is set into certain bending
Angle, enable the water preferably cleaning objects surface of ejection, prevent dead angle or do not wash clean clearly, rubber is provided with delivery port
Particle apopore, it can also be easier to be cleaned, reduce and tear shower nozzle internal structure open when shower nozzle apopore is blocked by incrustation scale
Trouble, be that equipment is more practical, more convenient.
The rubber compounding of rubber layer 18 by following component by weight：110 parts of rubber, 17 parts of carbon black, to benzene
12 parts of divinyl dibutyl ester, 0.3 part of dispersant, 5 parts of organosilicon, 3 parts of compounding ingredient.The present invention can reduce rubber cost,
Improve rubber performance, make material dispersion uniform, rubber wearability is relatively strong and service life is longer, has wide
Market prospects.
Dispersant is active peptides, and the amino acid sequence of active peptides is：
SCASVCKAHCRSVCARRCGYYVSVFYRGVCRCYCRCPRC, each component added in energy lubricating formulations of the active peptides,
The internal friction of rubber macromolecule interchain is reduced, reduces compound viscosity, promotes scattered, the improvement sizing material of carbon black and other compounding ingredients
Homogeneity and processing characteristics, decline mixing time and energy consumption, accelerate the scattered of filler, further improve the resistance to of rubber
Mill property.
Embodiment 2：
As shown in Fig. 1 ~ 5, a kind of taper roller surface processing device at work, opens machine box door 1, taper roller is put in order
To between train wheel bridge 17 and lower plate 15, regulating bolt post 16 fixes taper roller, and electricity is controlled by operating PLC control devices 2
Machine 10 is started working, and drives train wheel bridge 17 and lower plate 15 to rotate by rotating shaft 8, spray of the water pump 6 by conduit 5 by water from rotation
Rotation sprays out in first 7, taper roller clean without dead angle, by the high pressure whirlpool blower fan 9 on top cover 14, to cleaning
Good taper roller carries out drying drying process, taper roller is obtained certain aridity, improves the cleaning matter of taper roller
Amount, the sewage after cleaning is stored in sewage catchment tank 11 by screen pack 19, avoids impurity from blocking pipeline and sewage pollution
Environment.
The prior art of routine techniques dawn known to those skilled in the art in above-described embodiment, is not chatted in detail herein
State.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, it can also make a variety of changes and modification.Therefore, it is all equivalent
Technical scheme fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
Sequence table
<110>Lanxi City Bai Ruike science services Co., Ltd
<120>A kind of taper roller surface processing device
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 39
<212> PRT
<213>Artificial synthesized (Saccharum)
<400> 1
Ser Cys Ala Ser Val Cys Lys Ala His Cys Arg Ser Val Cys Ala Arg
1 5 10 15
Arg Cys Gly Tyr Tyr Val Ser Val Phe Tyr Arg Gly Val Cys Arg Cys
20 25 30
Tyr Cys Arg Cys Pro Arg Cys
35
Claims (7)
1. a kind of taper roller surface processing device, including casing（14）, support baseboard（13）, shower nozzle（7）, it is characterised in that：
The support baseboard（13）Bottom both ends are provided with support feet（12）, the support baseboard（13）Upper end and casing（14）Connection, institute
State casing（14）Left side is provided with motor（10）, the casing（14）Upper end is provided with top cover（4）, top cover（4）Both sides are provided with high pressure
Whirlpool blower fan（9）, the high pressure whirlpool blower fan（9）Between be provided with water pump（6）, the water pump（6）Output end and conduit（5）Even
Connect, the conduit（5）In casing（14）Inside, the conduit（5）Output end is connected with shower nozzle（7）, the casing（14）Table
Face is provided with machine box door（1）With PLC control devices（2）, the machine box door（1）Surface watch window is installed（3）.
A kind of 2. taper roller surface processing device according to claim 1, it is characterised in that：The motor（10）Output
End passes through shaft coupling and rotating shaft（8）Connection, the rotating shaft（8）One end and bolt column（16）It is connected, bolt column（16）It is provided with
It is fixed with train wheel bridge（17）And lower plate（15）.
A kind of 3. taper roller surface processing device according to claim 2, it is characterised in that：The train wheel bridge（17）With
Lower plate（15）Corresponding surface surface is provided with rubber layer（18）, the rubber layer（18）Surface is provided with anti-slip veins.
A kind of 4. taper roller surface processing device according to claim 3, it is characterised in that：The rubber layer（18）'s
Rubber compounding by following component by weight：Rubber 100-120 parts, carbon black 11-25 parts, to benzene divinyl dibutyl ester
10-14 parts, dispersant 0.1-0.5 parts, organosilicon 0.1-7.5 parts, compounding ingredient 0.1-5 parts.
A kind of 5. taper roller surface processing device according to claim 1, it is characterised in that：The support baseboard（13）
On be fixed with sewage catchment tank（11）, sewage catchment tank（11）With casing（14）Connected by blow-off pipe, set in the blow-off pipe
There is screen pack（19）, the screen pack（19）For two layers, the screen pack（19）Provided with coarse filtration net（20）, the coarse filtration net
（20）Side is provided with thin screen pack（21）.
A kind of 6. taper roller surface processing device according to claim 1, it is characterised in that：The shower nozzle（7）Upper end
With conduit（5）Junction is provided with rotary shaft（23）, the shower nozzle（7）Inside is provided with inside bending-like water-supply-pipe（22）.
A kind of 7. taper roller surface processing device according to claim 6, it is characterised in that：The water-supply-pipe（22）Folder
Angle is 145 ° ~ 165 °, the water-supply-pipe（22）Delivery port is provided with rubber grain apopore.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710774370.4A CN107520162A (en) | 2017-08-31 | 2017-08-31 | A kind of taper roller surface processing device |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710774370.4A CN107520162A (en) | 2017-08-31 | 2017-08-31 | A kind of taper roller surface processing device |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107520162A true CN107520162A (en) | 2017-12-29 |
Family
ID=60683150
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710774370.4A Pending CN107520162A (en) | 2017-08-31 | 2017-08-31 | A kind of taper roller surface processing device |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107520162A (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108993966A (en) * | 2018-07-08 | 2018-12-14 | 羊兰妹 | A kind of LED light frame cleaning device |
| CN110586546A (en) * | 2019-09-27 | 2019-12-20 | 云梭(宁波)科技有限公司 | Be used for high-efficient belt cleaning device of PCB circuit board |
| CN111659681A (en) * | 2020-06-22 | 2020-09-15 | 大连天凡防腐工程有限公司 | Method and system for quickly cleaning inner wall of butadiene storage tank by thickening catalysis method |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101780445A (en) * | 2010-03-02 | 2010-07-21 | 武汉钢铁(集团)公司 | Spiral nozzle collector for dephosphorization before billet rolling |
| CN205949103U (en) * | 2016-07-13 | 2017-02-15 | 厦门建霖工业有限公司 | Spray crisscross water flower structure |
| CN106955862A (en) * | 2017-05-21 | 2017-07-18 | 盐城市三川轴承制造有限公司 | A kind of efficient bearing cleaner |
-
2017
- 2017-08-31 CN CN201710774370.4A patent/CN107520162A/en active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101780445A (en) * | 2010-03-02 | 2010-07-21 | 武汉钢铁(集团)公司 | Spiral nozzle collector for dephosphorization before billet rolling |
| CN205949103U (en) * | 2016-07-13 | 2017-02-15 | 厦门建霖工业有限公司 | Spray crisscross water flower structure |
| CN106955862A (en) * | 2017-05-21 | 2017-07-18 | 盐城市三川轴承制造有限公司 | A kind of efficient bearing cleaner |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108993966A (en) * | 2018-07-08 | 2018-12-14 | 羊兰妹 | A kind of LED light frame cleaning device |
| CN110586546A (en) * | 2019-09-27 | 2019-12-20 | 云梭(宁波)科技有限公司 | Be used for high-efficient belt cleaning device of PCB circuit board |
| CN111659681A (en) * | 2020-06-22 | 2020-09-15 | 大连天凡防腐工程有限公司 | Method and system for quickly cleaning inner wall of butadiene storage tank by thickening catalysis method |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN107520162A (en) | A kind of taper roller surface processing device | |
| CN206965745U (en) | It is easy to the stirred autoclave of cleaning | |
| CN205774944U (en) | Weaving Bombyx bombycis cleans device | |
| CN201303584Y (en) | Submerged water injection-typed vegetable cleaning machine | |
| CN107891033A (en) | A kind of photovoltaic panel cleaning device | |
| CN105755549A (en) | Cocoon cleaning device for spinning | |
| CN106474832A (en) | A kind of industrial smoke purifying equipment | |
| CN109281485A (en) | A kind of construction and decoration metope finishing coat removing device | |
| CN208960477U (en) | A kind of cleaning equipment containing interior circulation high efficiency filter drying system | |
| CN208785991U (en) | A kind of workshop air purification fan | |
| CN107126803A (en) | dust collecting system | |
| CN107470224A (en) | A kind of retired surface of composite insulator purging system | |
| CN207204709U (en) | A kind of retired surface of composite insulator purging system | |
| CN209697215U (en) | Dusting device is used in a kind of processing | |
| CN104399713B (en) | A kind of equipment for cleaning concrete shaft | |
| CN209565321U (en) | A kind of communication network equipment electrification cleaning plant | |
| CN208829709U (en) | A kind of buffing dust cleaning device | |
| CN213529840U (en) | Novel production of fire prevention battenboard is with wasing device | |
| CN212091567U (en) | Exhaust gas purification device with good treatment effect | |
| CN209464809U (en) | Centrifugal gas-liquid separator and the integral type polishing grinding dust removal machine for using the device | |
| CN209363108U (en) | It is a kind of with the jetting machine that function is collected by filtration | |
| CN208605221U (en) | A kind of tunnel remove haze device | |
| CN207295587U (en) | A kind of gardens sweeper cleaned up | |
| CN219326922U (en) | Seat cloth belt cleaning device | |
| CN110420443A (en) | A kind of tennis cleaning device |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20171229 |
|
| RJ01 | Rejection of invention patent application after publication |