CN107504761A - Portable wall surface dryer - Google Patents
Portable wall surface dryer Download PDFInfo
- Publication number
- CN107504761A CN107504761A CN201710763519.9A CN201710763519A CN107504761A CN 107504761 A CN107504761 A CN 107504761A CN 201710763519 A CN201710763519 A CN 201710763519A CN 107504761 A CN107504761 A CN 107504761A
- Authority
- CN
- China
- Prior art keywords
- shell
- pump drainage
- inner casing
- wall surface
- parts
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F26—DRYING
- F26B—DRYING SOLID MATERIALS OR OBJECTS BY REMOVING LIQUID THEREFROM
- F26B3/00—Drying solid materials or objects by processes involving the application of heat
- F26B3/02—Drying solid materials or objects by processes involving the application of heat by convection, i.e. heat being conveyed from a heat source to the materials or objects to be dried by a gas or vapour, e.g. air
- F26B3/04—Drying solid materials or objects by processes involving the application of heat by convection, i.e. heat being conveyed from a heat source to the materials or objects to be dried by a gas or vapour, e.g. air the gas or vapour circulating over or surrounding the materials or objects to be dried
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D53/00—Separation of gases or vapours; Recovering vapours of volatile solvents from gases; Chemical or biological purification of waste gases, e.g. engine exhaust gases, smoke, fumes, flue gases, aerosols
- B01D53/26—Drying gases or vapours
- B01D53/265—Drying gases or vapours by refrigeration (condensation)
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F26—DRYING
- F26B—DRYING SOLID MATERIALS OR OBJECTS BY REMOVING LIQUID THEREFROM
- F26B19/00—Machines or apparatus for drying solid materials or objects not covered by groups F26B9/00 - F26B17/00
- F26B19/005—Self-contained mobile devices, e.g. for agricultural produce
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F26—DRYING
- F26B—DRYING SOLID MATERIALS OR OBJECTS BY REMOVING LIQUID THEREFROM
- F26B21/00—Arrangements or duct systems, e.g. in combination with pallet boxes, for supplying and controlling air or gases for drying solid materials or objects
- F26B21/001—Drying-air generating units, e.g. movable, independent of drying enclosure
Abstract
The present invention provides a kind of Portable wall surface dryer, belong to drying plant technical field, dryer includes electric baking device, actuation means, pump drainage gas device and moisture separator, electric baking device includes shell, enclosure is provided with inner casing, with being hollow interlayer on the inside of shell on the outside of inner casing, the lower surface of inner casing 0.5~1.5cm apart from the lower surface of shell, protection network I is provided with above inner casing, electrothermal tube is housed below inner casing, protection network II is provided with below electrothermal tube, outer casing bottom is provided with sealing strip, outer casing top surface has 4 through holes, through hole connecting conduit, conduit is connected by pipeline with pump drainage gas device, the present apparatus is simple in construction, energy consumption is low, cost is low, it is easy to use, dry more quickly ground and metope, the effect for removing moisture is preferable.
Description
Technical field
The invention belongs to drying plant technical field, more particularly to Portable wall surface dryer.
Background technology
During intermittent drizzles in the rainy season season, because the humidity of air is larger, many moisture of ground and metope aggegation, it is normal to influence people
Live and work.The product of the dehumidifying of dehumidifying in the market has dryer, heater, air-conditioning, dehumidifier etc., and air-conditioning can be tide
Wet air is converted into dry air, but can not thoroughly solve moisture remaining on the wall of ground, and heater, dehumidifier are only
Can there are limitation, and bad movement, although dryer energy drying earth surface, effect are only by ground subrange to drying
The moisture in face becomes vapor by hot blast and evaporated, and this drying mode, ground is to do, but the steam in hot blast is still full of
In the space in the place, the wetness of air in place is increased on the contrary, it is moist with the reduction of landing ground and steam temperature
Air condenses into the globule on the ground again, and due to being open radiating, energy consumption is big, work efficiency is low.
Prior art such as, Chinese invention granted patent document, the B of Authorization Notice No. CN 101829476, the disclosure of the invention
A kind of movable baking and drying machine, it is mainly by electric baking device, pump drainage gas device, moisture separator and actuation means group
Into the blast pipe of pump drainage gas device connects with the through hole in electric baking device, the air inlet of discharge pipe and moisture separator
Mouth connection, the delivery port of moisture separator are fitted with water tank, and actuation means are connected with electric baking device, electric baking dress
Put including shell, the inner casing being arranged in shell, the electrothermal tube for being arranged on inner casing bottom and the sealing strip for being arranged on shell lower end,
The lower surface of inner casing 0.5~1.5cm apart from the lower surface of shell, is hollow between the lateral surface of inner casing and the medial surface of shell
Interlayer, the upper end face closure of interlayer, the upper surface of interlayer are provided with through hole and connected by the blast pipe in pipeline and pump drainage gas device
It is logical.The invention have simple in construction, energy consumption is low, cost is low, it is easy to use, can more quickly make that ground and metope are dry, remove
The effect of moisture is preferable, but collected water at will outwells some waste of resource, and pipeline occurs with contact with moisture for a long time
Pollution.
The content of the invention
It is an object of the invention to provide a kind of Portable wall surface dryer, quickly metope can be dried, the moisture of collection
Dry gas and water can be separated into by moisture separator, water is by filter, filter the inside addition activated carbon
It can get off pollutant is all adsorbable, the water so separated can also reuse.
The technical scheme taken to achieve the above object of the present invention is：Portable wall surface dryer, including electric baking
Device, actuation means, pump drainage gas device and moisture separator, electric baking device upper end connection actuation means, the electricity
Hot apparatus for baking connects pump drainage gas device by pipeline, and the pump drainage gas device is connected aqueous vapor by discharge pipe with air inlet
Separator, the present apparatus is simple in construction, and operation is easy, environmental protection and energy saving, it is preferable effectively to remove moisture, moisture effect.
Preferably, electric baking device includes shell, enclosure is provided with inner casing, and inner casing outside with being on the inside of shell
Hollow interlayer, the lower surface of inner casing 0.5~1.5cm apart from the lower surface of shell are provided with protection network I above inner casing, under inner casing
Side is equipped with electrothermal tube, is provided with protection network II below electrothermal tube, outer casing bottom is provided with sealing strip, and outer casing top surface has individual through hole, through hole
Connecting conduit, conduit are connected by pipeline with pump drainage gas device, and electric baking device moves on the ground metope of humidity, the inside
Heat-generating pipe heating, rapidly metope can be dried, moisture will also pass through hollow interlayer between inner casing and shell to taking away.
Preferably, actuation means include control lever, control lever bottom connecting conduit, control lever surface be provided with speed regulator with
Thermosistor, speed regulator control pump drainage gas device, thermosistor control electrothermal tube, two buttons are concise on actuation means, and one
Individual button can adjust the speed that centrifugation pump drainage blower fan rotates, and another button regulation electrothermal tube can if metope is moister
The temperature of electrothermal tube is heightened to adapt to corresponding environment, it can also accelerate to dry metope, improve efficiency.
Preferably, pump drainage gas device includes centrifugation pump drainage blower fan, centrifuge and blast pipe one end connected before pump drainage blower fan,
Blast pipe other end connecting pipe, centrifuge and connect discharge pipe behind pump drainage blower fan, discharge pipe is connected with moisture separator, centrifugation
Pump drainage blower fan is to drive fan blade rotation driving air-flow by motor, a kind of atmosphere electricity-saving appliance for exchanging indoor and outdoor air, row
The purpose of gas seeks to remove indoor foul atmosphere, regulation temperature, humidity and sensory effect.
Preferably, moisture separator includes air-cooled condenser, air inlet one end, air inlet are connected before air-cooled condenser
Mouthful other end connection discharge pipe, air-cooled condenser behind and below are provided with water tank, and water tank top is provided with delivery port, on delivery port
Side is provided with drying gas outlet, and air-cooled condenser is the supporting radiators of compressor such as a kind of semi-enclosed and totally enclosed type, and aqueous vapor is divided
A moisture part effectively can be converted into dry air from device to discharge from drying gas outlet, another part or moisture
Water tank is flowed into from delivery port, is not in thus the reduction of ground and steam temperature, malaria condenses on the ground again
Into the phenomenon of the globule.
Preferably, be coated with high-temperaure coating on the outside of sealing strip and shell, high-temperaure coating by following component and
Parts by weight form：3~4 parts of methyl-silicone oil, 8~9 parts of aluminate, 8~9 parts of water, 2~3 parts of APEOs of Aluminate, 1~2
Part, 4~5 parts of ceramic, 1~2 part of isomerous tridecanol polyoxyethylene ether, 5~6 parts of silicate, the fourth 1~2 of phthalic acid two
Part, ethylene diamine tetra methylene phosphonic acid sodium 0.1~0.2, stabilizer 1-2 parts, 1~2 part of hydroxymethyl cellulose.Sealing strip is with shell in height
Easily feel like jelly under temperature and do not have due effect, this coating is coated on the outside of sealing strip and shell and improves sealing strip and shell
Outside heat-resisting quantity, the coating of chemical reaction generation is produced by adding ethylene diamine tetra methylene phosphonic acid sodium and remaining composition,
Fine and close lamella is formed, further improves the heat-resisting quantity of coating, while this coating is also with excellent scale inhibition effect and surely
It is qualitative.
Preferably, stabilizer is active peptides, the amino acid sequence of active peptides is：
HSHACTSYYCSKFCGTASCHYLCRVLLSAKCRHPGKLCVCANCSR, the active peptides are added in energy stable coatings
Each component, improves sag resistance and the anti-settling of coating, increases thixotropy, prevent from occurring during spraying shrinkage cavity, scar, foaming,
The defects of pin hole, tangerine peel or boiling trace, the heat-resisting quantity of coating is further enhanced, the durable of external environmental factor is resisted in raising
Property.
Preferably, delivery port is equipped with filter, filter interior is placed with sponge, activated carbon is enclosed with inside sponge,
The water that delivery port flows out is less clean, in outlet plus a filter, includes activated carbon inside filter, and activated carbon can be with
Absorption, the debris in water is precipitated, last clean water will flow into water tank, be placed with active charcoal bag in water tank, and the water in water tank can
With recycling, can so economize on resources.
Compared with prior art, beneficial effects of the present invention are：The flash baking of present invention energy, blot wet ground and metope
Moisture, ground and metope is become drying, while also can partly be sopped up to the moisture in air, change into dry air and
Moisture, dry purpose is finally reached, while sewage can be changed into clean water, Ke Yizai in delivery port addition filter
High-temperaure coating is coated with the outside of secondary utilization, sealing strip and shell can protect the outside of sealing strip and shell not soft
Change, the present invention is simple in construction, energy consumption is low, cost is low, it is easy to use, can more quickly make that ground and metope are dry, remove moisture
Effect it is preferable.
Present invention employs the Portable wall surface dryer that above-mentioned technical proposal provides, the deficiencies in the prior art are compensate for,
It is reasonable in design, it is easy to operate.
Brief description of the drawings
Fig. 1 is the structural representation of Portable wall surface dryer of the present invention；
Fig. 2 is the structural representation of Portable wall surface dryer electric baking device of the present invention；
Fig. 3 is the A portions enlarged drawing of Portable wall surface dryer of the present invention.
Description of reference numerals：1 sealing strip；2 shells；3 inner casings；4 through holes；5 protection network I；6 conduits；7 thermosistors；8 speed governing
Device；9 pipelines；10 blast pipes；11 centrifugation pump drainage blower fans；12 discharge pipes；13 air inlets；14 air-cooled condensers；15 drying gas outlets；
16 delivery ports；17 water tanks；18 electrothermal tubes；19 protection network II；20 control lever；20 manipulation rod tubes；21 filters；22 sponges.
Embodiment
Technical scheme is described in further detail with accompanying drawing with reference to embodiments：
Embodiment 1：
As shown in Fig. 1 ~ 3, Portable wall surface dryer, including electric baking device, actuation means, pump drainage gas device and aqueous vapor
Separator, electric baking device upper end connection actuation means, electric baking device connect pump drainage gas device by pipeline 9,
Pump drainage gas device is connected moisture separator by discharge pipe 12 with air inlet 13, and the present apparatus is simple in construction, and operation is easy, ring
Energy-conservation is protected, it is preferable effectively to remove moisture, moisture effect, and electric baking device includes shell 2, and shell 2 is internally provided with interior
Shell 3, the outside of inner casing 3 and the inner side of shell 2 are hollow interlayer, the lower surface of inner casing 3 0.6cm, inner casing 3 apart from the lower surface of shell 2
Top is provided with protection network I 5, and the lower section of inner casing 3 is equipped with electrothermal tube 18, and the lower section of electrothermal tube 18 is provided with protection network II 19, and the bottom of shell 2 is set
There is sealing strip 11, the top surface of shell 2 has 4 through holes 4, the connecting conduit 6 of through hole 1, and conduit 6 is connected by pipeline 9 and pump drainage gas device
Connect, electric baking device moves on the ground metope of humidity, the heat-generating pipe heating of the inside, rapidly metope can be dried, water
The hollow interlayer between inner casing and shell point be will also pass through to taking away, actuation means include control lever 20, the bottom of control lever 20 company
Conduit 6 is connect, the surface of control lever 20 is provided with speed regulator 8 and thermosistor 7, and speed regulator 8 controls pump drainage gas device, and thermosistor 7 controls
Electrothermal tube 18, two buttons are concise on actuation means, and a button can adjust the speed that centrifugation pump drainage blower fan rotates, separately
One button adjusts electrothermal tube, the temperature of electrothermal tube can be heightened if metope is moister to adapt to corresponding environment,
It can accelerate to dry metope, improve efficiency, pump drainage gas device includes centrifugation pump drainage blower fan 11, centrifuged before pump drainage blower fan 11
The one end of blast pipe 10, the other end connecting pipe 9 of blast pipe 10 are connected, centrifugation pump drainage blower fan 11 connects discharge pipe 12, air-out below
Pipe 12 is connected with moisture separator, and centrifugation pump drainage blower fan is to drive fan blade rotation driving air-flow by motor, makes indoor outer space
A kind of atmosphere electricity-saving appliance that gas exchanges, the purpose of exhaust seek to remove indoor foul atmosphere, regulation temperature, humidity and sense
Feel effect, moisture separator includes air-cooled condenser 14, and air-cooled condenser 14 above connects the one end of air inlet 13, air inlet 13
The other end connects discharge pipe 12, and the behind and below of air-cooled condenser 14 is provided with water tank 17, and the top of water tank 17 is provided with delivery port 16,
The top of delivery port 16 is provided with drying gas outlet 15, and air-cooled condenser, which is that the compressors such as a kind of semi-enclosed and totally enclosed type are supporting, to be dissipated
Hot device, a moisture part effectively can be converted into dry air and be discharged from drying gas outlet by moisture separator, another
Part or moisture flow into water tank from delivery port, are not in thus the reduction of ground and steam temperature, malaria is again
The phenomenon of the globule is condensed on the ground, and the material of electrothermal tube 18 is one kind in quartz, aluminium, copper tube, what electrothermal tube was selected
Material melting point is high, and thermal conductivity is good, and delivery port 16 is equipped with filter 21, and sponge 22, the inside of sponge 22 are placed with inside filter 21
Activated carbon is enclosed with, the water that delivery port flows out is less clean, comprising active inside outlet plus a filter, filter
Charcoal, activated carbon can adsorb, and precipitate the debris in water, and last clean water will flow into water tank, and the water in water tank can repeat
Utilize, can so economize on resources.
The outside of sealing strip 1 and shell 2 is coated with high-temperaure coating, and high-temperaure coating is by following component and parts by weight group
Into：4 parts of methyl-silicone oil, 9 parts of aluminate, 8 parts of water, 2.5 parts of APEOs of Aluminate, 2 parts, 4.5 parts of ceramic, isomery ten
2 parts of triol APEO, 6 parts of silicate, 2 parts of two fourth of phthalic acid, ethylene diamine tetra methylene phosphonic acid sodium 0.2, stabilizer 1
Part, 2 parts of hydroxymethyl cellulose.Sealing strip easily feels like jelly at high temperature with shell does not have due effect, and this coating is coated to
The heat-resisting quantity in the outside of sealing strip and shell is improved on the outside of sealing strip and shell, by adding ethylene diamine tetra methylene phosphonic acid
Remaining of sodium and coating composition produce chemical reaction, form the lamella of densification, further improve the heat-resisting quantity of coating, simultaneously
This coating also has excellent scale inhibition effect and stability.
Stabilizer is active peptides, and the amino acid sequence of active peptides is：
HSHACTSYYCSKFCGTASCHYLCRVLLSAKCRHPGKLCVCANCSR, the active peptides are added in energy stable coatings
Each component, increase heat-resisting quantity, prevent occurring the defects of shrinkage cavity, scar, foaming, pin hole, tangerine peel or boiling trace during spraying, enter one
The heat-resisting quantity of step enhancing coating, improves the durability for resisting external environmental factor.
Embodiment 2：
As shown in Fig. 1 ~ 3, moisture separator is air-cooled condenser 14, and the air inlet 13 of the condenser is with centrifuging pump drainage blower fan 11
Discharge pipe 12 connected with pipe, form the flow channel of a gas, when centrifuging pump drainage blower fan 11 and working, humid air is from interior
Inner casing 3 is sucked at the upper end protection network I 5 of shell 3, hot gas is heated into by electrothermal tube 18, and water caused by ground is toasted with electrothermal tube 18
Steam forms mixed gas, and due to centrifuging the draft effect of pump drainage blower fan 11, mixed gas rushes at lower section ground, inevitable from inner casing
3rd, the clearance space of shell 2 is that hollow interlayer suction top four through hole 4 enters four conduits 6, the hollow lumen through action bars
And flexible pipe enters centrifugation pump drainage blower fan 11, due to centrifuging the two-way function of pump drainage blower fan 11, mixed gas is transported to air-cooled cold
Condenser 14 is separated into water and the air dried, and dried air goes out 15 discharges from gas is dried, and water is from delivery port 16 by filtering
Device 21, sponge 22 is provided with filter 21, activated carbon is also enclosed with sponge, can adsorb the impurity in water, filter completion
Water can be into water tank 17.
During the Portable wall surface dryer real work of the present invention：Pump drainage blower fan continuously works, and electric baking device is in tide
Moved on wet ground, ground just becomes rapidly drying, the present invention is simple in construction, energy consumption is low, cost is low, it is easy to use, can be compared with
Rapidly make that ground and metope are dry, it is preferable to remove the effect of moisture.
The prior art of routine techniques dawn known to those skilled in the art in above-described embodiment, is not chatted in detail herein
State.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, it can also make a variety of changes and modification.Therefore, it is all equivalent
Technical scheme fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
Sequence table
<110>Pujiang County Yuan Shou agricultural science and technologys Co., Ltd
<120>Portable wall surface dryer
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 45
<212> PRT
<213>Trachyostracous mussel (Mytilus coruscus)
<400> 1
His Ser His Ala Cys Thr Ser Tyr Tyr Cys Ser Lys Phe Cys Gly Thr
1 5 10 15
Ala Ser Cys His Tyr Leu Cys Arg Val Leu Leu Ser Ala Lys Cys Arg
20 25 30
His Pro Gly Lys Leu Cys Val Cys Ala Asn Cys Ser Arg
35 40 45
Claims (7)
1. Portable wall surface dryer, including electric baking device, actuation means, pump drainage gas device and moisture separator,
It is characterized in that：The electric baking device upper end connects actuation means, and the electric baking device passes through pipeline（9）Connection is taken out
Body device is vented, the pump drainage gas device passes through discharge pipe（12）With air inlet（13）Connect moisture separator.
2. Portable wall surface dryer according to claim 1, it is characterised in that the electric baking device includes outer
Shell（2）, the shell（2）It is internally provided with inner casing（3）, the inner casing（3）Outside and shell（2）Inner side is hollow interlayer, institute
State inner casing（3）Lower surface apart from shell（2）0.5~1.5cm of lower surface, the inner casing（3）Top is provided with protection network I
（5）, the inner casing（3）Lower section is equipped with electrothermal tube（18）, the electrothermal tube（18）Lower section is provided with protection network II（19）, the shell
（2）Bottom is provided with sealing strip（1）, the shell（2）Top surface has 4 through holes（4）, the through hole（4）Connecting conduit（6）, it is described
Conduit（6）Pass through pipeline（9）It is connected with pump drainage gas device.
3. Portable wall surface dryer according to claim 1, it is characterised in that the actuation means include control lever
（20）, the control lever（20）Bottom connecting conduit（6）, the control lever（20）Surface is provided with speed regulator（8）With thermosistor
（7）, the speed regulator（8）Control pump drainage gas device, the thermosistor（7）Control electrothermal tube（18）.
4. Portable wall surface dryer according to claim 1, it is characterised in that the pump drainage gas device includes centrifugation
Pump drainage blower fan（11）, the centrifugation pump drainage blower fan（11）Above connect blast pipe（10）One end, the blast pipe（10）The other end
Connecting pipe（9）, the centrifugation pump drainage blower fan（11）Discharge pipe is connected below（12）, the discharge pipe（12）Dress is separated with aqueous vapor
Put connected.
5. Portable wall surface dryer according to claim 1, it is characterised in that the moisture separator includes air-cooled
Condenser（14）, the air-cooled condenser（14）Above connect air inlet（13）One end, the air inlet（13）The other end connects
Discharge pipe（12）, the air-cooled condenser（14）Behind and below is provided with water tank（17）, the water tank（17）Top is provided with out
The mouth of a river（16）, the delivery port（16）Top is provided with drying gas outlet（15）.
6. Portable wall surface dryer according to claim 1, it is characterised in that the sealing strip（1）With shell（2）'s
Outside is coated with high-temperaure coating, and the high-temperaure coating is made up of following component and parts by weight：3~4 parts of methyl-silicone oil, aluminium
8~9 parts of hydrochlorate, 8~9 parts of water, 2~3 parts of Aluminate, APEO, 1~2 part, 4~5 parts of ceramic, isomerous tridecanol
1~2 part of APEO, 5~6 parts of silicate, 1~2 part of two fourth of phthalic acid, ethylene diamine tetra methylene phosphonic acid sodium 0.1~0.2
Part, 1~2 part of methylcellulose, stabilizer 1-2 parts.
7. Portable wall surface dryer according to claim 1, it is characterised in that the delivery port（16）Equipped with filter
（21）, the filter（21）Inside is placed with sponge（22）, the sponge（22）The inside is enclosed with activated carbon.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710763519.9A CN107504761A (en) | 2017-08-30 | 2017-08-30 | Portable wall surface dryer |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710763519.9A CN107504761A (en) | 2017-08-30 | 2017-08-30 | Portable wall surface dryer |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107504761A true CN107504761A (en) | 2017-12-22 |
Family
ID=60693166
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710763519.9A Pending CN107504761A (en) | 2017-08-30 | 2017-08-30 | Portable wall surface dryer |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107504761A (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108224914A (en) * | 2018-03-07 | 2018-06-29 | 山东新希望六和集团有限公司 | A kind of wall damp-removing device |
| CN109920219A (en) * | 2019-03-20 | 2019-06-21 | 王浩 | A kind of intelligent building fire-fighting early warning system |
| CN113028818A (en) * | 2021-03-02 | 2021-06-25 | 孙冬高 | Surface dewatering device of self-adhesion modified asphalt coiled material preparation process |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101829476A (en) * | 2010-05-19 | 2010-09-15 | 陈平 | Movable baking and drying machine |
| CN201744281U (en) * | 2010-05-19 | 2011-02-16 | 陈平 | Movable suction drier |
| CN102352268A (en) * | 2011-09-08 | 2012-02-15 | 西北化工研究院 | Method for producing synthesis gas by using coal powder as raw material |
| CN102719193A (en) * | 2012-06-27 | 2012-10-10 | 广州豪之晟化工有限公司 | High-temperature resistant coating |
| JP2014074542A (en) * | 2012-10-04 | 2014-04-24 | Chubu Electric Power Co Inc | Superheated steam drying device and drying method |
| CN106830387A (en) * | 2015-12-07 | 2017-06-13 | 山东联星能源集团有限公司 | A kind of novel active carbon filter |
-
2017
- 2017-08-30 CN CN201710763519.9A patent/CN107504761A/en active Pending
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101829476A (en) * | 2010-05-19 | 2010-09-15 | 陈平 | Movable baking and drying machine |
| CN201744281U (en) * | 2010-05-19 | 2011-02-16 | 陈平 | Movable suction drier |
| CN102352268A (en) * | 2011-09-08 | 2012-02-15 | 西北化工研究院 | Method for producing synthesis gas by using coal powder as raw material |
| CN102719193A (en) * | 2012-06-27 | 2012-10-10 | 广州豪之晟化工有限公司 | High-temperature resistant coating |
| JP2014074542A (en) * | 2012-10-04 | 2014-04-24 | Chubu Electric Power Co Inc | Superheated steam drying device and drying method |
| CN106830387A (en) * | 2015-12-07 | 2017-06-13 | 山东联星能源集团有限公司 | A kind of novel active carbon filter |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108224914A (en) * | 2018-03-07 | 2018-06-29 | 山东新希望六和集团有限公司 | A kind of wall damp-removing device |
| CN108224914B (en) * | 2018-03-07 | 2024-01-26 | 夏津新希望六和农牧有限公司 | Wall body moisture absorption device |
| CN109920219A (en) * | 2019-03-20 | 2019-06-21 | 王浩 | A kind of intelligent building fire-fighting early warning system |
| CN113028818A (en) * | 2021-03-02 | 2021-06-25 | 孙冬高 | Surface dewatering device of self-adhesion modified asphalt coiled material preparation process |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN107504761A (en) | Portable wall surface dryer | |
| CN2907241Y (en) | Electric drying box for cleaning pets | |
| CN105135862A (en) | Copper coated steel wire hot air circulation drying system | |
| CN101829476B (en) | Movable baking and drying machine | |
| CN102072619B (en) | Drying boxes for hot-blast air furnace | |
| CN200987570Y (en) | Fast drying and cleaning device for shoes and umbrella during rain day | |
| CN210179936U (en) | Open type drying heat pump with waste heat recovery device | |
| CN107676892A (en) | A kind of air conditioner and control method | |
| CN205481462U (en) | Air purifier of integrated warm braw, warm quilt, dry clothing and deodorization function | |
| CN105300042B (en) | Agricultural product drying equipment | |
| CN104896882B (en) | A kind of combined dryer | |
| CN206563392U (en) | A kind of Multifunctional fragrance shell humidifier | |
| CN208226337U (en) | A kind of moisture-proof outdoor electric Electric Appliance Cabinet | |
| CN201906551U (en) | Dehumidifier | |
| CN107036407A (en) | Natural dehumidifying drying system | |
| CN103968438A (en) | Negative-pressure ventilation and heat exchange energy-saving range hood | |
| CN208704021U (en) | A kind of hot air type gas heating stove recycling steam humidification | |
| CN209147287U (en) | Airhandling equipment | |
| CN207721687U (en) | A kind of water dispenser with air cleaning unit | |
| CN213551603U (en) | Rain boot drying-machine | |
| CN107773187A (en) | A kind of commercial dish-washing machine | |
| CN201744281U (en) | Movable suction drier | |
| CN107904891A (en) | A kind of Clothes-hanging cabinet easy to airing clothes | |
| CN106500182A (en) | A kind of humidifying type air-conditioning and its air-humidification method | |
| CN208373492U (en) | A kind of spray baking all-in-one machine |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20171222 |
|
| RJ01 | Rejection of invention patent application after publication |