CN107486056A - A kind of agitating device with agitating plate - Google Patents
A kind of agitating device with agitating plate Download PDFInfo
- Publication number
- CN107486056A CN107486056A CN201710625279.6A CN201710625279A CN107486056A CN 107486056 A CN107486056 A CN 107486056A CN 201710625279 A CN201710625279 A CN 201710625279A CN 107486056 A CN107486056 A CN 107486056A
- Authority
- CN
- China
- Prior art keywords
- agitating
- shaft
- agitator tank
- agitating plate
- plate
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01F—MIXING, e.g. DISSOLVING, EMULSIFYING OR DISPERSING
- B01F27/00—Mixers with rotary stirring devices in fixed receptacles; Kneaders
- B01F27/60—Mixers with rotary stirring devices in fixed receptacles; Kneaders with stirrers rotating about a horizontal or inclined axis
- B01F27/70—Mixers with rotary stirring devices in fixed receptacles; Kneaders with stirrers rotating about a horizontal or inclined axis with paddles, blades or arms
- B01F27/701—Mixers with rotary stirring devices in fixed receptacles; Kneaders with stirrers rotating about a horizontal or inclined axis with paddles, blades or arms comprising two or more shafts, e.g. in consecutive mixing chambers
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01F—MIXING, e.g. DISSOLVING, EMULSIFYING OR DISPERSING
- B01F27/00—Mixers with rotary stirring devices in fixed receptacles; Kneaders
- B01F27/05—Stirrers
- B01F27/051—Stirrers characterised by their elements, materials or mechanical properties
- B01F27/053—Stirrers characterised by their elements, materials or mechanical properties characterised by their materials
- B01F27/0531—Stirrers characterised by their elements, materials or mechanical properties characterised by their materials with particular surface characteristics, e.g. coated or rough
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01F—MIXING, e.g. DISSOLVING, EMULSIFYING OR DISPERSING
- B01F27/00—Mixers with rotary stirring devices in fixed receptacles; Kneaders
- B01F27/05—Stirrers
- B01F27/11—Stirrers characterised by the configuration of the stirrers
- B01F27/19—Stirrers with two or more mixing elements mounted in sequence on the same axis
- B01F27/191—Stirrers with two or more mixing elements mounted in sequence on the same axis with similar elements
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01F—MIXING, e.g. DISSOLVING, EMULSIFYING OR DISPERSING
- B01F35/00—Accessories for mixers; Auxiliary operations or auxiliary devices; Parts or details of general application
- B01F35/30—Driving arrangements; Transmissions; Couplings; Brakes
- B01F35/31—Couplings
-
- C—CHEMISTRY; METALLURGY
- C09—DYES; PAINTS; POLISHES; NATURAL RESINS; ADHESIVES; COMPOSITIONS NOT OTHERWISE PROVIDED FOR; APPLICATIONS OF MATERIALS NOT OTHERWISE PROVIDED FOR
- C09D—COATING COMPOSITIONS, e.g. PAINTS, VARNISHES OR LACQUERS; FILLING PASTES; CHEMICAL PAINT OR INK REMOVERS; INKS; CORRECTING FLUIDS; WOODSTAINS; PASTES OR SOLIDS FOR COLOURING OR PRINTING; USE OF MATERIALS THEREFOR
- C09D161/00—Coating compositions based on condensation polymers of aldehydes or ketones; Coating compositions based on derivatives of such polymers
- C09D161/04—Condensation polymers of aldehydes or ketones with phenols only
- C09D161/06—Condensation polymers of aldehydes or ketones with phenols only of aldehydes with phenols
- C09D161/14—Modified phenol-aldehyde condensates
-
- C—CHEMISTRY; METALLURGY
- C09—DYES; PAINTS; POLISHES; NATURAL RESINS; ADHESIVES; COMPOSITIONS NOT OTHERWISE PROVIDED FOR; APPLICATIONS OF MATERIALS NOT OTHERWISE PROVIDED FOR
- C09D—COATING COMPOSITIONS, e.g. PAINTS, VARNISHES OR LACQUERS; FILLING PASTES; CHEMICAL PAINT OR INK REMOVERS; INKS; CORRECTING FLUIDS; WOODSTAINS; PASTES OR SOLIDS FOR COLOURING OR PRINTING; USE OF MATERIALS THEREFOR
- C09D5/00—Coating compositions, e.g. paints, varnishes or lacquers, characterised by their physical nature or the effects produced; Filling pastes
- C09D5/08—Anti-corrosive paints
- C09D5/10—Anti-corrosive paints containing metal dust
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08K—Use of inorganic or non-macromolecular organic substances as compounding ingredients
- C08K13/00—Use of mixtures of ingredients not covered by one single of the preceding main groups, each of these compounds being essential
- C08K13/02—Organic and inorganic ingredients
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08K—Use of inorganic or non-macromolecular organic substances as compounding ingredients
- C08K3/00—Use of inorganic substances as compounding ingredients
- C08K3/18—Oxygen-containing compounds, e.g. metal carbonyls
- C08K3/20—Oxides; Hydroxides
- C08K3/22—Oxides; Hydroxides of metals
- C08K2003/2237—Oxides; Hydroxides of metals of titanium
- C08K2003/2241—Titanium dioxide
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08K—Use of inorganic or non-macromolecular organic substances as compounding ingredients
- C08K3/00—Use of inorganic substances as compounding ingredients
- C08K3/34—Silicon-containing compounds
Landscapes
- Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Materials Engineering (AREA)
- Wood Science & Technology (AREA)
- Organic Chemistry (AREA)
- Mixers Of The Rotary Stirring Type (AREA)
Abstract
The present invention provides a kind of agitating device with agitating plate, including motor and agitator tank, motor output shaft is connected with reduction box, reduction gearbox output shaft is connected with shaft coupling, shaft coupling is connected with agitating shaft, agitating shaft is arranged in agitator tank, motor, reduction box, the center line symmetrical setting of shaft coupling and agitating shaft rotating around agitator tank, the connection of apparatus of the present invention structure is simple, it is easy to operate, agitating plate can effectively increase material rolling scope, improve mixing quality, and the antiseptic property of agitating shaft and agitating plate is good, it is good to stir water conservancy diversion effect, service life is grown, suitable for promoting the use of.
Description
Technical field
The present invention relates to a kind of agitating device, and in particular to a kind of agitating device with agitating plate.
Background technology
Agitating device is that dosing tank is mainly used in the stirring, dissolving, storage of various medicaments in engineering of water treatment, then is passed through
Measuring pump or water sprayer are by liquid chemical feeding to each toss area.Dosing tank profile is divided into square and circular, and material is polyethylene（PE）,
By rotational moulding techniques one-shot forming, the installation site of measuring pump and mixer has been preset on top.
Such as, Chinese invention patent Granted publication document, Authorization Notice No. is the B of CN 101342766 to prior art, the invention
Disclose a kind of continuous strong stirring machine, including symmetrically arranged double motor and dual reducer, respectively with dual reducer phase
Connection makees heterodromous two agitating shafts, and two agitating shafts are located in mixing drum, and every agitating shaft is provided with helical blade, and
The multiple and reverse propeller-like blade of helical blade is provided with every the empty axle provided with multiple zonate fronds, helical blade interval.
The equipment continuously stirs transport, and automaticity is high, suitable for continuously stir with conveying sandstone, rubble, gangue, flyash or
The mixture of cement etc. and water, its is simple in construction, and operating efficiency is high, and labor intensity is small, and reliability is high, stirring and conveying effect
Good, environmental pollution is few, has wide applicability.But in actual applications, the stirring of the agitating shaft of the device has blind area,
Material stirring may be caused uneven, thereby increases and it is possible to partial material occur and block immobilising situation, therefore it goes back in terms of mixing effect
It is to be improved.
The content of the invention
The present invention provides a kind of stirring non-blind area to solve above-mentioned technical problem, and material agitation scope is wide, and mixing effect is good,
And agitating shaft and agitating plate are provided with corrosion-inhibiting coating, agitating shaft and agitating plate antiseptic property, the one kind to increase the service life are improved
Agitating device with agitating plate.
The present invention is for the scheme taken of solution above-mentioned technical problem：A kind of agitating device with agitating plate, including
Motor and agitator tank, motor output shaft are connected with reduction box, and reduction gearbox output shaft is connected with shaft coupling, and shaft coupling is connected with
Agitating shaft, agitating shaft are arranged in agitator tank, the center line of motor, reduction box, shaft coupling and agitating shaft rotating around agitator tank
It is symmetrical arranged, the connection of apparatus of the present invention structure is simple, easy to operate, can stablize and realize that non-blind area stirs, and stirring water conservancy diversion effect is good,
Service life is grown, suitable for promoting the use of.
Preferably, agitating shaft surface, which tilts, is connected with agitating plate, the angle β angles between agitating plate and agitating shaft are 70
~ 83 °, agitating shaft tilts and is connected to stirring plate surface, and has certain angle so that material can because of the inclination of agitating plate and by
Gradually moved to discharging opening direction, and angle β make it that translational speed is appropriate, both will not also will not because being moved through blocking agitator tank slowly
Because of the too fast reduction mixing quality of movement.
Preferably, the thickness of agitating plate and the diameter ratio of agitating shaft are 0.5 ~ 0.77:1, stirring plate surface is connected with instead
To plate leaf, the angle of the angle α between agitating plate and reverse plate leaf is 33 ~ 48 °, and the reverse plate leaf connected on agitating plate can stirred
Mix when plate side is in minimum state and put into material, when the side of the agitating plate equipped with material slowly tends to peak, be equipped with
Material be dumped out so that material has the action stirred up and down, not only increases the mixing effect of material, also material is existed
Surface of material vapor is removed when stirring up and down and avoids materials from bonding.
Preferably, agitating shaft and agitating plate surface spraying have corrosion-inhibiting coating, corrosion-inhibiting coating is by following component and parts by weight
Composition：Nano combined 4 ~ 8 parts of liquid, 5 ~ 8 parts of carbon fiber of enhancing, 6.5 ~ 11 parts of silicon carbide ceramics powder, modified boron phenolic polymer 30 ~
35 parts, 4 ~ 9 parts of nickel-base alloy powder, 0.03 ~ 0.05 part of dispersant, 15 ~ 27 parts of rutile type titanium white, corrosion-inhibiting coating can effectively be prevented
Only erosion of the deep-etching material to agitating shaft and agitating plate, improve agitating shaft and agitating plate stability of molecule, prevent agitating shaft and
Agitating plate aging, so as to extend the service life of agitating shaft and agitating plate, the spraying of corrosion-inhibiting coating, it can also lift agitating shaft and stir
Mix the anti-sticking stickiness of plate surface, material is reduced in agitating shaft and agitating plate surface attachment, so as to ensure that agitating shaft and agitating plate
Can be light be stirred, improves the gearratio of device, saves energy consumption, it also avoid material attachment and results in blockage, influences to fill
The situation of normal operation is put, ensure that the continuously stirring property of device.
Preferably, agitator tank stem upper surface is provided with charging aperture, agitator tank afterbody lower surface is provided with discharging opening, agitator tank
Upper surface center be provided with observation window, observation window is sound insulation safety glass, and charging aperture that agitator tank is provided with and discharging opening position are closed
Reason, batch turning feeding are convenient, and agitator tank surface is provided with observation window, have device visual, can Real Time Observation into agitator tank
Material stirring situation, the emergency reaction ability of device is improved, improves artificial supervision intervening force, ensure the stable running of agitating paddle,
And observation window is sound insulation safety glass, not only with good soundproof effect, also with high intensity, the safety of mixer is improved
Property.
Preferably, shaft coupling is diaphragm coupling, bellows coupling, oldham coupling, plum coupling, rigidity connection
One kind in axle device, the active axis hole of shaft coupling and the aperture ratio of driven-shaft hole are 0.95 ~ 1.18:1, the selected scope of shaft coupling
It ensure that shaft coupling is more accurate, reduce parallel deviation, angular deviation and axial deviation that shaft coupling itself has, improve dress
The stability and transmission efficiency put, the active axis hole of shaft coupling and the aperture of driven-shaft hole are provided with ratio, ensure that shaft coupling utensil
There is higher transmission performance, improve the service behaviour and reliability of shaft coupling, reduce vibration and the generation of noise, and can subtract
Few capacity loss.
Preferably, agitator tank outer surface is provided with noise reduction layer, the thickness ratio of noise reduction layer and agitator tank is 0.35 ~ 0.48:1,
Agitator tank outer surface is provided with noise reduction layer, and both thickness have certain proportion, stirring function is reached optimal erasure effect, keep away
Exempt from noise pollution, control material usage just again, avoid materials waste, also avoid causing blender apparatus excessively burdensome, carry
The mobile convenience of height.
Compared with prior art, beneficial effects of the present invention are：1）Agitating device of the present invention is used with reverse plate leaf
Agitating plate, material is comprehensively and effectively stirred, and also ensure that the transportability of material；2）Agitating shaft and agitating plate table
Face is provided with corrosion-inhibiting coating, effectively improves the service life of agitating shaft and agitating plate, and coating stable is difficult for drop-off, does not interfere with just
Often work；3）Agitator tank outer surface is provided with noise reduction layer, reduces noise pollution, the inspection box that upper surface is provided with, adds stirring dress
The visuality put, improve manual control security performance；4）Shaft coupling mechanical property is good in device, reliable working performance, has height
Transmission ratio, normal operation is can effectively ensure that, and reduce energy consumption.
Present invention employs above-mentioned technical proposal to provide a kind of agitating device with agitating plate, compensate for prior art
Deficiency, it is reasonable in design, it is easy to operate.
Brief description of the drawings
Fig. 1 is a kind of structural representation of the agitating device with agitating plate of the present invention；
Fig. 2 is a kind of structural representation of the agitating plate of the agitating device with agitating plate of the present invention；
Fig. 3 is a kind of left view of the agitating plate of the agitating device with agitating plate of the present invention；
Fig. 4 is a kind of partial enlarged drawing at a positions of the agitating device with agitating plate of the present invention；
Fig. 5 is a kind of partial enlarged drawing at the b positions of the agitating device with agitating plate of the present invention；
Fig. 6 is a kind of sectional view of the agitator tank of the agitating device with agitating plate of the present invention.
Description of reference numerals：1 motor；2 reduction boxes；3 shaft couplings；4 agitating shafts；5 charging apertures；6 agitator tanks；7 agitating plates；
8 noise reduction layers；9 observation windows；10 reverse plate leafs.
Embodiment
It is described in further detail below in conjunction with drawings and examples：
Embodiment 1：
As shown in Fig. 1 ~ 6, a kind of agitating device with agitating plate, including motor 1 and agitator tank 6, the output shaft of motor 1 connect
Reduction box 2 is connected to, the output shaft of reduction box 2 is connected with shaft coupling 3, and shaft coupling 3 is connected with agitating shaft 4, and agitating shaft 4 is arranged at stirring
In case 6, motor 1, reduction box 2, shaft coupling 3 and agitating shaft 4 are rotating around the center line symmetrical setting of agitator tank 6, present invention dress
It is simple to put structure connection, it is easy to operate, it can stablize and realize that non-blind area stirs, stirring water conservancy diversion effect is good, service life length, is applied to
Promote the use of.
The surface of agitating shaft 4 tilts and is connected with agitating plate 7, and the angle β angles between agitating plate 7 and agitating shaft 4 are 75 °, are stirred
Mix axle 4 and tilt and be connected to the surface of agitating plate 7, and there is certain angle so that material can because of the inclination of agitating plate 7 and gradually to
Discharging opening direction is moved, and angle β make it that translational speed is appropriate, both will not be because being moved through blocking agitator tank slowly, also will not be because moving
Move too fast reduction mixing quality.
The thickness of agitating plate 7 is 0.6 with the diameter ratio of agitating shaft 4:1, the surface of agitating plate 7 is connected with reverse plate leaf 10, stirs
The angle for mixing the angle α between plate 7 and reversely plate leaf 10 is 35 °, and the reverse plate leaf 10 connected on agitating plate 7 can be in agitating plate 7
Material is put into side when being in minimum state, when the side of the agitating plate 7 equipped with material slowly tends to peak, the thing that is equipped with
Material is dumped out so that material has the action stirred up and down, not only increases the mixing effect of material, also makes material upper and lower
Surface of material vapor is removed when stirring and avoids materials from bonding.
Agitating shaft 4 and the surface spraying of agitating plate 7 have corrosion-inhibiting coating, and corrosion-inhibiting coating is made up of following component and parts by weight：Receive
5 parts of complex liquid of rice, 6 parts of carbon fiber of enhancing, 9 parts of silicon carbide ceramics powder, modified 32 parts of boron phenolic polymer, 7 parts of nickel-base alloy powder,
0.042 part of dispersant, 18 parts of rutile type titanium white, corrosion-inhibiting coating can effectively prevent deep-etching material to agitating shaft 4 and stirring
The erosion of plate 7, agitating shaft 4 and the stability of molecule of agitating plate 7 are improved, agitating shaft 4 and the aging of agitating plate 7 is prevented, is stirred so as to extend
The service life of axle 4 and agitating plate 7 is mixed, the spraying of corrosion-inhibiting coating, can also lift agitating shaft 4 and the anti-sticking of the surface of agitating plate 7 sticks
Property, material is reduced in agitating shaft 4 and the surface attachment of agitating plate 7, so as to ensure that progress that agitating shaft 4 and agitating plate 7 can be light
Stirring, the gearratio of device is improved, save energy consumption, it also avoid material attachment and result in blockage, influence device normal operation
Situation, it ensure that the continuously stirring property of device.
Dispersant in corrosion-inhibiting coating is active peptides, and the amino acid sequence of active peptides is：
HSHSYYHSKTACAKFCGTASCTHYLSCTHYLCRVLHPGKLCACVNCSR, the addition of dispersant can be in coating preparation process
It is effectively promoted that each component molecules are compatible, improves the mixing of each composition, lift the mechanical property of coating, can effectively strengthen agitating shaft
4 and the antiseptic property of agitating plate 7, and dispersant can also improve the film forming for improving corrosion-inhibiting coating, make coating be securely attached to stir
Axle 4 and the surface of agitating plate 7 are mixed, extends the service life of agitating shaft 4 and agitating plate 7, prevents agitating shaft aging.
The stem upper surface of agitator tank 6 is provided with charging aperture 5, and the afterbody lower surface of agitator tank 6 is provided with discharging opening, agitator tank 6 it is upper
Centre of surface is provided with observation window 9, and observation window 9 is sound insulation safety glass, and the charging aperture 5 and discharging opening position that agitator tank 6 is provided with close
Reason, batch turning feeding are convenient, and the surface of agitator tank 6 is provided with observation window 9, have device visual, can Real Time Observation to agitator tank 6
Middle material stirring situation, the emergency reaction ability of device is improved, improve artificial supervision intervening force, ensure the stable fortune of agitating paddle
Make, and observation window 9 is sound insulation safety glass, not only with good soundproof effect, also with high intensity, improves mixer
Security.
Shaft coupling 3 is in diaphragm coupling, bellows coupling, oldham coupling, plum coupling, positive coupling
One kind, the active axis hole of shaft coupling 3 and the aperture ratio of driven-shaft hole are 1.05:1, the selected scope of shaft coupling 3 ensure that shaft coupling
Device 3 is more accurate, reduces parallel deviation, angular deviation and axial deviation that shaft coupling 3 has itself, improves the stabilization of device
Property and transmission efficiency, the active axis hole of shaft coupling 3 and the aperture of driven-shaft hole be provided with ratio, ensure that shaft coupling 3 have it is higher
Transmission performance, improve the service behaviour and reliability of shaft coupling 3, reduce vibration and the generation of noise, and energy can be reduced
Power is lost.
The outer surface of agitator tank 6 is provided with noise reduction layer 8, and the thickness ratio of noise reduction layer 8 and agitator tank 6 is 0.42:1, the appearance of agitator tank 6
Face is provided with noise reduction layer 8, and both thickness have certain proportion, stirring function is reached optimal erasure effect, avoids noise dirty
Dye, control material usage just again, avoid materials waste, also avoid causing blender apparatus excessively burdensome, improve movement just
Profit.
Embodiment 2：
As shown in Fig. 1 ~ 6, a kind of agitating device with agitating plate, in real work, motor 1 is opened, material is passed through
Charging aperture 5 is continuously poured into agitator tank 6, and for motor 1 through reduction box 2 by driving shaft coupling 3 to rotate, shaft coupling 3 drives stirring
Axle 4 rotates, and two motors 1 turn on the contrary, rotating speed is identical, and agitating shaft 4 is also done, steering is opposite but rotating speed identical operates, from
And drive the agitating plate 7 on agitating shaft 4 reversely carried out to material to rolling to stirring, also to material while stirring
Power forward, material side is stirred, while being pushed to discharging opening, the Real Time Observation agitator tank 6 of observation window 9 can be passed through in whipping process
Internal stirring state, discharging opening is placed on by collection device, and the material to stir can be exported endlessly from discharging opening,
Midway saves the electricity consumption that start and stop make, under lasting charging, this mixer can realize continuous mixing, extremely without power-off
Stirring closes motor 1 after being fully completed.
Angle β angles between agitating plate 7 and agitating shaft 4 are not limited only to 70 ~ 83 °, should also include 70 ° or 70.1 ° or
70.2 ° or 70.3 ° or 70.4 ° ... or 82.9 ° or 83 °.
The thickness of agitating plate 7 is not limited only to 0.5 ~ 0.77 with the diameter ratio of agitating shaft 4:1, it should also include 0.5:1 or 0.51:
1 or 0.52:1 or 0.53:1 or 0.54:1 ... or 0.769:1 or 0.66:1.
The angle of angle α between agitating plate 7 and reversely plate leaf 10 is not limited only to 33 ~ 48 °, should also include 33 ° or 33.1 °
Or 33.2 ° or 33.3 ° or 33.4 ° ... or 47.9 ° or 48 °.
The active axis hole of shaft coupling 3 and the aperture ratio of driven-shaft hole are not limited only to 0.95 ~ 1.18:1, it should also include 0.95:1
Or 0.951:1 or 0.952:1 or 0.953:1 or 0.954:1 ... or 1.179:1 or 1.17:1.
Noise reduction layer 8 and the thickness ratio of agitator tank 6 are not limited only to 0.35 ~ 0.48:1, it should also include 0.35 or 0.351:1 or
0.352:1 or 0.353:1 or 0.354:1 ... or 0.479:1 or 0.48:1.
Routine techniques connection or the prior art of prior art dawn known to those skilled in the art in above-described embodiment,
Therefore it is not described in detail herein.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, it can also make a variety of changes and modification.Therefore, it is all equivalent
Technical scheme fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
SEQUENCE LISTING
<110>Lanxi City You Ze feed technologies Services Co., Ltd
<120>A kind of agitating device with agitating plate
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 48
<212> PRT
<213>It is artificial synthesized
<400> 1
His Ser His Ser Tyr Tyr His Ser Lys Thr Ala Cys Ala Lys Phe Cys
1 5 10 15
Gly Thr Ala Ser Cys Thr His Tyr Leu Ser Cys Thr His Tyr Leu Cys
20 25 30
Arg Val Leu His Pro Gly Lys Leu Cys Ala Cys Val Asn Cys Ser Arg
35 40 45
Claims (7)
1. a kind of agitating device with agitating plate, including motor（1）And agitator tank（6）, it is characterised in that the motor
（1）Output shaft is connected with reduction box（2）, the reduction box（2）Output shaft is connected with shaft coupling（3）, the shaft coupling（3）Connection
There is agitating shaft（4）, the agitating shaft（4）It is arranged at agitator tank（6）It is interior, the motor（1）, reduction box（2）, shaft coupling（3）
And agitating shaft（4）Rotating around agitator tank（6）Center line symmetrical setting.
A kind of 2. agitating device with agitating plate according to claim 1, it is characterised in that the agitating shaft（4）Table
Face tilts and is connected with agitating plate（7）, the agitating plate（7）And agitating shaft（4）Between angle β angles be 70 ~ 83 °.
A kind of 3. agitating device with agitating plate according to claim 2, it is characterised in that the agitating plate（7）'s
Thickness and agitating shaft（4）Diameter ratio be 0.5 ~ 0.77:1, the agitating plate（7）Surface is connected with reverse plate leaf（10）, it is described
Agitating plate（7）With reverse plate leaf（10）Between angle α angle be 33 ~ 48 °.
A kind of 4. agitating device with agitating plate according to claim 1, it is characterised in that the agitating shaft（4）With
Agitating plate（7）Surface spraying has corrosion-inhibiting coating, and the corrosion-inhibiting coating is made up of following component and parts by weight：Nano combined liquid 4 ~ 8
Part, 5 ~ 8 parts of carbon fiber of enhancing, 6.5 ~ 11 parts of silicon carbide ceramics powder, modified 30 ~ 35 parts of boron phenolic polymer, nickel-base alloy powder 4 ~ 9
Part, 0.03 ~ 0.05 part of dispersant, 15 ~ 27 parts of rutile type titanium white.
A kind of 5. agitating device with agitating plate according to claim 1, it is characterised in that the agitator tank（6）It is first
Portion upper surface is provided with charging aperture（5）, the agitator tank（6）Afterbody lower surface is provided with discharging opening, the agitator tank（6）Upper surface
Center is provided with observation window（9）, the observation window（9）For sound insulation safety glass.
A kind of 6. agitating device with agitating plate according to claim 1, it is characterised in that the shaft coupling（3）For
One kind in diaphragm coupling, bellows coupling, oldham coupling, plum coupling, positive coupling, the shaft coupling
（3）Active axis hole and driven-shaft hole aperture ratio be 0.95 ~ 1.18:1.
A kind of 7. agitating device with agitating plate according to claim 1, it is characterised in that the agitator tank（6）Outside
Surface is provided with noise reduction layer（8）, the noise reduction layer（8）With agitator tank（6）Thickness ratio be 0.35 ~ 0.48:1.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710625279.6A CN107486056A (en) | 2017-07-27 | 2017-07-27 | A kind of agitating device with agitating plate |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710625279.6A CN107486056A (en) | 2017-07-27 | 2017-07-27 | A kind of agitating device with agitating plate |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107486056A true CN107486056A (en) | 2017-12-19 |
Family
ID=60643851
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710625279.6A Withdrawn CN107486056A (en) | 2017-07-27 | 2017-07-27 | A kind of agitating device with agitating plate |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107486056A (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111744388A (en) * | 2020-07-16 | 2020-10-09 | 沈阳九和流体科技有限公司 | Carbon fiber silicon carbide composite material stirrer |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101342766A (en) * | 2008-08-11 | 2009-01-14 | 中国矿业大学 | Continuous strong stirring machine |
| CN101805554A (en) * | 2009-02-16 | 2010-08-18 | 中国科学院金属研究所 | Boron phenolics-titanium nano composite temperature and pressure resistant heavy anti-corrosive coating and preparation method thereof |
| CN105032233A (en) * | 2015-07-31 | 2015-11-11 | 无锡乐华自动化科技有限公司 | Oil stirring device |
-
2017
- 2017-07-27 CN CN201710625279.6A patent/CN107486056A/en not_active Withdrawn
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101342766A (en) * | 2008-08-11 | 2009-01-14 | 中国矿业大学 | Continuous strong stirring machine |
| CN101805554A (en) * | 2009-02-16 | 2010-08-18 | 中国科学院金属研究所 | Boron phenolics-titanium nano composite temperature and pressure resistant heavy anti-corrosive coating and preparation method thereof |
| CN105032233A (en) * | 2015-07-31 | 2015-11-11 | 无锡乐华自动化科技有限公司 | Oil stirring device |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111744388A (en) * | 2020-07-16 | 2020-10-09 | 沈阳九和流体科技有限公司 | Carbon fiber silicon carbide composite material stirrer |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| KR100768246B1 (en) | Mixer for fiber reinforced mortar and repair-reinforcement method using thereof | |
| CN107855049A (en) | A kind of efficient mixer | |
| CN107297825A (en) | A kind of construction heavy duty detergent concrete mixer | |
| CN213797298U (en) | High-efficient agitating unit of raw materials stirring station | |
| CN208163997U (en) | A kind of Construction of Civil Engineering concrete central mix plant | |
| CN108247837A (en) | A kind of swing small-sized concrete mixer | |
| CN107263709A (en) | A kind of road construction construction dual mixing arrangement of concrete | |
| CN209649131U (en) | A kind of concrete central mix plant | |
| CN107718298A (en) | One kind regeneration mixed mud production agitating device | |
| CN109093848A (en) | A kind of high-effective concrete blender | |
| CN107297817A (en) | Agitating device based on mixing arm | |
| CN108608577A (en) | A kind of uniformly mixed concrete central mix plant | |
| CN208164002U (en) | A kind of uniformly mixed concrete central mix plant | |
| CN107486056A (en) | A kind of agitating device with agitating plate | |
| CN215790819U (en) | Dry mechanism that condenses is prevented to thick liquid sand for construction | |
| CN209036734U (en) | A kind of blender rabbling mechanism | |
| CN207930868U (en) | Concrete double agitating device | |
| KR200434373Y1 (en) | Mixer for fiber reinforced mortar | |
| CN205766861U (en) | A kind of full-automatic mixer of laboratory concrete | |
| CN107376690A (en) | The agitator tank of the smooth discharge of energy | |
| CN107253272A (en) | Continuous mixing and blending machine | |
| CN206690329U (en) | A kind of efficient easily concrete central mix plant | |
| CN108211906A (en) | A kind of JS polymer cement-base waterproof coatings mixing plant | |
| CN213005893U (en) | Mix earth hybrid processing device | |
| CN205704728U (en) | One can automatic watering concrete mixer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WW01 | Invention patent application withdrawn after publication | ||
| WW01 | Invention patent application withdrawn after publication |
Application publication date: 20171219 |