CN107455493A - The white tea cleaning equipment of intelligentized control method - Google Patents

Abstract

The present invention discloses a kind of white tea cleaning equipment of intelligentized control method, belong to cleaning device field, the present apparatus includes support, the tank of placement above internal stent, the poking bar of horizontal setting in the middle part of tank, internal stent positioned beneath has air compressor and storage tank, uniform supersonic generator is mounted with basin sidewall, agitating roller one end and the output axis connection of motor, junction is provided with sealing ring, motor is placed in stent outer face, the uniform continental quilt in poking bar surface, the device of the present invention rapidly and efficiently cleans tealeaves surface stain using ultrasonic wave and bubble, tealeaves surface bacteria can be killed, processing and self-emptying are dried up to tealeaves after the completion of cleaning, the cleaning quality of white tea is obviously improved in inboard wall of cistern coating antifouling paint.

Description

The white tea cleaning equipment of intelligentized control method

Technical field

The invention belongs to cleaning device field, and in particular to a kind of white tea cleaning equipment of intelligentized control method.

Background technology

White tea, belong to micro- fermented tea, be one of traditional well-known tea, Chinese six big teas of Chinese tea grower's initiative, refer to a kind of harvesting Afterwards, without finishing or kneading, the tea of post-processing is only dried by solarization or slow fire, has profile bud milli complete, drapes over one's shoulders milli all over the body, it is fragrant in the least Clear fresh, soup look is yellowish green limpid, light time sweet quality characteristic of flavour, belongs to slight fermented tea, is the special treasure in Chinese teas. Because its sample tea is mostly bud head, pekoe is completely draped over one's shoulders, such as silver is gained the name like snow.Major production areas Fuding, Fujian Province, have stable political situation, Songxi, Jianyang, The ground such as Yunnan Jing Gu.

Tealeaves in whole growth course, inevitably by the dust in air, haze particle, residues of pesticides, The pollution of the pollutants such as birds excrement, after harvesting, tea making enterprise will clean to fresh tealeaves, could carry out lower road work The operation of sequence；At present, in general small enterprise majority is to rely on manually to be cleaned, and exists and takes time and effort, cleans sordid ask Topic；Tealeaves cleans with tealeaves cleaning machine in bigger tea making enterprise, and common tealeaves cleaning machine is by washing Cha Chi, conveyer belt and spray head Composition, cleaning process is that tealeaves first is put into service sink to be cleaned, then is transported to dress tea basket by conveyer belt, on the conveyor belt Side is provided with spray head and carries out spraying-rinsing to the tealeaves on conveyer belt, although this cleaning machine can largely remove tea fresh leaves appearance Spot, but the obstinate pollutant for being more securely attached on tea fresh leaves is helpless, can not thoroughly clean up tea Leaf spot.

Prior art such as, Chinese invention granted patent document, the B of Authorization Notice No. CN 104128327, the disclosure of the invention Pipeline, air compressor, slip occur for a kind of Multifunctional tea cleaning machine, including support, tank, supersonic generator, bubble Bar, lift cylinder and scraper bowl, tank are installed on support, and some supersonic generators are provided with tank, are provided with tank Agitating roller, one end of agitating roller are connected with motor, and air compressor is located at below tank, and bubble occurs pipeline and is installed on tank Interior, air compressor occurs pipeline with bubble by appendix and is connected, and cleaning agent holding vessel, cleaning agent storage are provided with support Deposit tank by infusion pump with tank to be connected, sliding bar is installed on support, and sliding bar is located at the top of tank, on sliding bar pacifies Equipped with sliding shoe, sliding motor and lift cylinder are installed on sliding shoe, at least one scraper bowl is connected with lift cylinder.The hair It is bright to effectively improve cleaning performance, the agricultural chemicals and other polluters on tealeaves surface are preferably removed, can after cleaning Self-emptying is completed, improves cleaning efficiency, but the device also has in terms of tealeaves cleaning efficiency and drying tealeaves is improved Further lifting.

The content of the invention

It is quick using ultrasonic wave and bubble it is an object of the invention to provide a kind of white tea cleaning equipment of intelligentized control method High-efficiency washing tealeaves surface stain, can kill tealeaves surface bacteria, dry up processing to tealeaves after the completion of cleaning and go out automatically Material, by the further lifting device cleaning performance of water wheels, white tea is obviously improved in the inboard wall of cistern coating antifouling paint of cleaning Cleaning performance.

The scheme taken to achieve the above object of the present invention is：The white tea cleaning equipment of intelligentized control method, including support, The tank of placement above internal stent, the poking bar of tank middle part horizontal setting, internal stent positioned beneath have air compressor And storage tank, air compressor are connected with reversal valve, reversal valve difference connecting gas transmission pipe and drying are managed, appendix penetrate tank with In the bubble of bottom of gullet pipeline connection occurs for horizontal setting, and the gas outlet for drying up pipe is placed in inboard wall of cistern upper end, storage tank It is connected by water pipe with the infusion pump that frame bottom side disposes, infusion pump penetrates tank by woven hose and connects out liquid ball, goes out Liquid ball is placed in bottom of gullet bubble and pipeline upper end occurs, and goes out above liquid ball and is mounted with and tank floor space identical mesh screen, water The output axis connection of uniform supersonic generator, agitating roller one end and motor is mounted with groove sidewall, junction is provided with sealing Circle, motor are placed in stent outer face, the uniform continental quilt in poking bar surface, and tank top is provided with discharging mechanism, discharging mechanism bag Sliding bar, sliding shoe and scraper bowl are included, sliding bar is connected by connecting rod with side face, and sliding shoe is connected with sliding bar, sliding Motion block vertical direction lower end is provided with lift cylinder, and upper end is provided with sliding motor, and the output shaft top of lift cylinder is connected with scraper bowl, Sliding bar one end is provided with first baffle, and the other end is provided with second baffle, the 3rd be connected with sliding bar is provided with below second baffle Baffle plate, sliding shoe is between first baffle and second baffle.

The equipment of the present invention combined using the gentle raw pipeline of being soaked of ultrasonic wave by the way of to white tea cleaning, bubble is from tank bottom Portion, which is sent, plays a part of mixer cavitation, and setting value is reached when acoustic pressure or the sound intensity are under pressure in the presence of ultrasonic wave When, bubble can expansion-rupture rapidly, the moment of bubbles burst can produce shock wave, make to produce 1012-1013pa's around bubble Pressure and bureau of temperature adjustment, immense pressure can destroy insoluble dirt and them is broken up in solution caused by this ultrasonic cavitation In, also rotated by poking bar and combine scraper bowl and move back and forth and white tea is cleaned, can be achieved fast and efficiently to remove white tea Surface blot, and the moving back and forth and moving up and down and realize the discharging of tealeaves using scraper bowl after cleaning, it is simple and quick.

Preferably, sliding shoe is provided with the first range sensor by first baffle side, sliding shoe leans on second baffle side Upper end is provided with second distance sensor, and lower end is provided with the 3rd range sensor, sterilamp is provided with the middle part of lift cylinder output shaft.It is logical To cross setting sensor avoid sliding shoe and baffle plate from colliding or stuck phenomenon, is quickly moved back on sliding bar beneficial to sliding shoe It is dynamic, set sterilamp to be beneficial to sterilize to tealeaves and cleaning fluid in tealeaves cleaning process in the middle part of lift cylinder output shaft, avoid Tealeaves remained on surface after cleaning has bacterium to be unfavorable for tea leaf quality and health.

Preferably, inboard wall of cistern surface is coated with antifouling paint, antifouling paint is made up of following component and parts by weight：End Hydroxyl polysiloxane 28-36 parts, terminal hydroxy group fluorinated polysiloxane 5-15 parts, nano silicon 5-10 parts, nano-calcium carbonate 2.5-3.5 parts, activated carbon 2-4 parts, zinc powder 3-5 parts, ethylene diamine tetra methylene phosphonic acid sodium 0.4-0.6 parts, stannous octoate 0.4-0.8 Part, the butanone ketoximinosilanes 4-7 parts of methyl three, dimethicone 3-7 parts, bacteriostatic agent 0.4-0.8 parts, silane coupler 0.8- 1.3 parts, platinum catalyst 0.2-0.4 parts.The present invention coats antifouling paint in inboard wall of cistern and handled by natural air drying, makes cleaning Spot, which can not be attached to flume surface, after white tea prevents the Quality Down of next round white tea cleaning and the clean and maintenance cost of tank Increase, because zinc powder can decline the adhesiveness of coating after coating long-term use, pressed down by adding ethylene diamine tetra methylene phosphonic acid sodium The harmful effect of zinc powder processed ensures that coating effectively adheres to for a long time, and its mechanism of action is still not clear, and need further to study, and And the antifouling paint of the present invention also has excellent slickness and antiseptic property, cleaning fluid is on coating without influence.

Preferably, scraper bowl side connects water wheels, the wheel blades of water wheels is arc rubber slab, printing on surface of rubber plate be all provided with circular hole or Polygonal hole or elliptical aperture or irregularly-shaped hole.By setting water wheels to control scraper bowl in device cleaning process in water in scraper bowl side Move back and forth in groove and drive water wheels to rotate the work being stirred to tealeaves, the water wheels of quality of rubber materials will not cause to damage to tealeaves Wound, beneficial to the integrality of protection tealeaves, it is beneficial in printing on surface of rubber plate providing holes caused tiny miscellaneous in rubber suction cleaning process Matter, be advantageous to improve the effect of tealeaves cleaning, regularly replace rubber slab.

Preferably, sliding bar surface is surrounded with nano wire groove, the axis angle of nanometer wire casing and sliding bar for 62 ° ~ 74 °, nano wire well width is 4 ~ 8nm, and depth is 3 ~ 5nm.Sliding bar is located at tank top, is easily got rusty by vapour corrosion, design Nanometer wire casing can reduce the contact area of sliding bar and sliding shoe and reduce the translational speed that both frictional force improves sliding shoe, Device discharging speed is improved, and lubricating oil or antirust oil can be coated in nanometer wire casing sliding bar is played and be effectively protected work With can also further lifting the translational speed of sliding shoe, nano wire grooved ring be advantageous to prevent around the sliding bar surface that is arranged on of shape Only lubricating oil or antirust oil drippage and the movement that lubricating oil or antirust oil and sliding shoe are more conducive to around shape.

Preferably, it is tubes in line that pipeline, which occurs, for bubble, tubes in line is by some longitudinal bubble branch pipes and some transverse directions Bubble branch pipe rearranges, and longitudinal bubble branch pipe and horizontal bubble branch pipe interconnect, and is produced beneficial to bubble, is advantageous to lifting dress The cleaning performance put.

Preferably, going out liquid ball surface is provided with fluid hole, the delivery port of fluid hole is evenly spaced by dividing plate, reduces fluid hole Effectively go out liquid level product increase flow rate of liquid, make liquid that there is certain impulse force to tealeaves, beneficial to the cleaning efficiency of tealeaves, pass through Experimental Comparison, the design have unexpected cleaning performance, go out liquid ball both sides and are connected with flexible pipe, hose surface is evenly equipped with water outlet Mouthful, improve cleaning fluid goes out liquid level product and the cleaning performance of tealeaves.

Compared with prior art, beneficial effects of the present invention are：The equipment of the present invention uses the gentle bubble generator tube of ultrasonic wave The mode that road combines is cleaned to white tea, and bubble is sent from bottom of gullet plays a part of mixer cavitation, in the effect of ultrasonic wave Under when acoustic pressure or the sound intensity are under pressure and reach setting value, bubble can expansion-rupture rapidly, the moment of bubbles burst can produce Shock wave, make the pressure and bureau of temperature adjustment that 1012-1013pa is produced around bubble, immense pressure caused by this ultrasonic cavitation Insoluble dirt can be destroyed and them is broken up in solution, antifouling paint is coated and by natural air drying in inboard wall of cistern Reason, spot can not be attached to the cleaning that flume surface prevents the Quality Down and tank of the cleaning of next round white tea after making cleaning white tea Maintenance cost increase, the nanometer wire casing of design can reduce sliding bar and the contact area of sliding shoe reduces both frictional force raisings The translational speed of sliding shoe, also rotated by poking bar and combine scraper bowl and move back and forth and white tea is cleaned, can be achieved it is quick, It is efficient to remove white tea surface blot, and the moving back and forth and moving up and down and realize going out for tealeaves using scraper bowl after cleaning Material, it is simple and quick.

Brief description of the drawings

Fig. 1 is the white tea cleaning equipment structural representation of intelligentized control method of the present invention；

Fig. 2 is the scraper bowl schematic diagram of the white tea cleaning equipment of intelligentized control method of the present invention；

Fig. 3 is the white tea cleaning equipment bubble generator tube top view of intelligentized control method of the present invention；

Fig. 4 goes out liquid ball schematic diagram for the white tea cleaning equipment of intelligentized control method of the present invention.

Description of reference numerals：1 connecting rod；2 supersonic generators；3 scraper bowls；4 tanks；Pipeline occurs for 5 bubbles；6 appendixs； 7 air compressors；8 first baffles；9 first range sensors；10 lift cylinders；11 sliding shoes；12 sliding motors；13 second away from From sensor；14 the 3rd range sensors；15 fluid holes；16 sliding bars；17 second baffles；18 third baffles；19 agitating rollers；20 Continental quilt；21 sealing rings；22 output shafts；23 motors；24 woven hoses；25 infusion pumps；26 supports；27 mesh screens；28 go out liquid ball；29 deposit Storage tank；30 longitudinal bubble branch pipes；31 horizontal bubble branch pipes；32 sterilamps；33 flexible pipes；34 drying pipes；35 water wheels.

Embodiment

The present invention is described in further detail with accompanying drawing with reference to embodiments：

Embodiment 1：

As Figure 1-4, the white tea cleaning equipment of intelligentized control method, including support 26, the tank of the inner upper of support 26 placement 4, the poking bar 19 of the middle part horizontal setting of tank 4, the lower inside of support 26 is mounted with air compressor 7 and storage tank 29, air Compressor 7 is connected with reversal valve, reversal valve difference connecting gas transmission pipe 6 and drying pipe 34, and appendix 6 penetrates tank 4 pacifies with horizontal Put the bubble generation pipeline 5 in the bottom of tank 4 to connect, it is tubes in line that pipeline 5, which occurs, for bubble, and tubes in line is by some longitudinal gas Bubble branch pipe 30 and some horizontal bubble branch pipes 31 rearrange, and longitudinal bubble branch pipe 30 and horizontal bubble branch pipe 31 interconnect, The gas outlet of drying pipe 34 is placed in the inwall upper end of tank 4, and storage tank 29 is disposed defeated by water pipe with the bottom side of support 26 Liquid pump 25 connects, and infusion pump 25 penetrates tank 4 by woven hose 24 and connects out liquid ball 28, goes out liquid ball 28 and is placed in the bottom of tank 4 Pipeline 5 upper end occurs for bubble, go out the top of liquid ball 28 be mounted with the floor space identical mesh screen 27 of tank 4, go out the surface of liquid ball 28 and set There is fluid hole 15, the delivery port of fluid hole 15 is evenly spaced by dividing plate, and that reduces fluid hole effectively goes out liquid level product increase liquid flow Speed, make liquid that there is certain impulse force to tealeaves, beneficial to the cleaning efficiency of tealeaves, by Experimental Comparison, the design, which has, to be expected Less than cleaning performance, go out the both sides of liquid ball 28 and be connected with flexible pipe 33, the surface of flexible pipe 33 is evenly equipped with delivery port, improves cleaning fluid Go out the cleaning performance of liquid level product and tealeaves.Be mounted with uniform supersonic generator 2 in the side wall of tank 4, the one end of agitating roller 19 with The output shaft 22 of motor 23 connects, and junction is provided with sealing ring 21, and motor 23 is placed in the lateral surface of support 26, the surface of poking bar 19 Uniform continental quilt 20, the top of tank 4 are provided with discharging mechanism, and discharging mechanism includes sliding bar 16, sliding shoe 11 and scraper bowl 3, scraper bowl 3 Side connects water wheels 35, and the wheel blade of water wheels 35 is arc rubber slab, and printing on surface of rubber plate is all provided with circular hole or polygonal hole or elliptical aperture Or irregularly-shaped hole, sliding bar 16 are connected by connecting rod 1 with the side of support 26, the surface of sliding bar 16 is surrounded with nano wire groove, nanometer The axis angle of wire casing and sliding bar 16 is 70 °, and nano wire well width is 6nm, depth 3nm, and cunning is connected with sliding bar 16 Motion block 11, the vertical direction lower end of sliding shoe 11 are provided with lift cylinder 10, and upper end is provided with sliding motor 12, the output of lift cylinder 10 Axle top is connected with scraper bowl 3, and the one end of sliding bar 16 is provided with first baffle 8, and the other end is provided with second baffle 17, under second baffle 17 Side is provided with the third baffle 18 being connected with sliding bar 16, and sliding shoe 11 is between first baffle 8 and second baffle 17, sliding shoe 11 are provided with the first range sensor 9 by the side of first baffle 8, and sliding shoe 11 is provided with second distance by the side upper end of second baffle 17 Sensor 13, lower end are provided with the 3rd range sensor 14, sterilamp 32 are provided with the middle part of the output shaft of lift cylinder 10.

The inner wall surface of tank 4 is coated with antifouling paint, and antifouling paint is made up of following component and preferred weight part：Terminal hydroxy group 30 parts of polysiloxanes, 10 parts of terminal hydroxy group fluorinated polysiloxane, 6 parts of nano silicon, 3 parts of nano-calcium carbonate, 2 parts of activated carbon, 3 parts of zinc powder, 0.45 part of ethylene diamine tetra methylene phosphonic acid sodium, 0.6 part of stannous octoate, 5 parts of three butanone ketoximinosilanes of methyl, dimethyl 4 parts of silicone oil, 0.45 part of bacteriostatic agent, 1.2 parts of silane coupler, 0.24 part of platinum catalyst.The present invention coats antifouling in inboard wall of cistern Coating is simultaneously handled by natural air drying, and spot can not be attached to flume surface prevents what next round white tea from cleaning The increase of the clean and maintenance cost of Quality Down and tank, because zinc powder can decline the adhesiveness of coating after coating long-term use, The harmful effect for suppressing zinc powder by adding ethylene diamine tetra methylene phosphonic acid sodium ensures that coating effectively adheres to for a long time, its mechanism of action It is still not clear, need further to study, and the antifouling paint of the present invention also has excellent slickness and antiseptic property, clearly Washing lotion is on coating without influence.

Bacteriostatic agent in above-mentioned antifouling paint is bacteriostatic peptide, and the amino acid sequence of bacteriostatic peptide is HSHACTSYYCAKFCGTASCTHHPGLCVCVNCSK, the bacteriostatic peptide can prevent the synthesis of Bacterial outer membrane proteins matter, so as to press down The formation of bacteria cell wall processed, prevent bacterium from maintaining normal cellular morphology, growth retardation, and can wear the cell membrane of bacterium Hole, bacterial death is ultimately resulted in, effectively avoid the bacterial adhesion that white tea surface clean is got off in the inwall of tank 4 and growth or under Secondary cleaning has undesirable effect.

Embodiment 2：

As Figure 1-4, during the white tea cleaning equipment real work of intelligentized control method of the invention：Occur by using ultrasonic wave The gentle mode that raw pipeline 5 combines and scraper bowl 3 and water wheels 35 move back and forth in tank 4 that is soaked of device 2 is cleaned to white tea, gas The bubble for the raw output of pipeline 5 that is soaked can play stirring white tea and improve the effect of cavitation, when acoustic pressure or the sound intensity be under pressure to Up to a certain degree when, bubble will expand rapidly, then again suddenly closure, during this section, bubble closure moment production Raw shock wave, make the pressure and bureau of temperature adjustment that 1012-1013pa is produced around bubble, huge pressure caused by this ultrasonic cavitation Power can destroy insoluble dirt and them is broken up in solution, and the bottom that pipeline 5 is installed on tank 4 occurs for bubble, realizes gas Bubble is emerged from tank 4 is bottom up, and white tea is in contact comprehensively with bubble, is advantageous to the cleaning efficiency of the present apparatus, and agitating roller 19 revolves Turn and drive continental quilt 20 to stir white tea, contact of the continental quilt 20 with white tea can preferably remove white tea surface impurity and Bacterium, holding vessel 29 carry out conveying cleaning fluid to tank 4 by going out liquid ball 28 and flexible pipe 33, coordinate ultrasonic wave can be quicker Removal remain in the insoluble impurities on white tea surface.

The moving process of scraper bowl 3 is in white tea cleaning process：After the completion of white tea cleaning, using drawing liquid pump by tank 4 Cleaning fluid extract out, white tea is tentatively dried up by drying up pipe 34, scraper bowl 3 stretches into tank under the control of lift cylinder 10 Set sterilamp 32 to be beneficial to sterilize to white tea and cleaning fluid in white tea cleaning process in 4, in the middle part of the output shaft of lift cylinder 10, keep away White tea remained on surface after free of cleaning has bacterium to be unfavorable for quality of white tea and health, the effect that sliding shoe 11 passes through sliding motor 12 Scraper bowl 3 is driven to move right, when scraper bowl 3 soon encounters 4 right side inwall of tank, the 3rd range sensor 14 and third baffle 18 Reach setpoint distance, scraper bowl 3 rises under the control of lift cylinder 10, the zone of action that then sliding shoe 11 passes through sliding motor 12 Dynamic scraper bowl 3 continues to move right, and after scraper bowl 3 removes 4 right side edge of tank, second distance sensor 13 reaches with second baffle 17 To setpoint distance, sliding shoe 11 stops movement, takes out the white tea in scraper bowl 3, the work that then sliding shoe 11 passes through sliding motor 12 It is moved to the left with drive scraper bowl 3, when scraper bowl 3 is moved to above the left side edge of tank 4, the first range sensor 9 and first gear Plate 8 reaches setpoint distance, and scraper bowl 3 stops moving horizontally, and scraper bowl 3 extends downwardly into the presence of lift cylinder 10 to be entered in tank 4 Row is above-mentioned toward motion, and untill white tea is removed substantially in tank 4, scraper bowl 3 is can control in cleaning process in tank 4 The dynamic drive water wheels 35 of return, which rotate, is stirred cleaning to white tea.

The surface of sliding bar 16 is surrounded with nano wire groove, the axis angle of nanometer wire casing and sliding bar 16 be not limited only to 62 ° ~ 74 °, should also including 62 ° or 62.1 ° or 62.3 ° or 62.4 ° ..., 73.9 ° or 74 °, nano wire well width is not limited only to 4 ~ 8nm, 4nm or 4.1nm or 4.2nm or 4.3nm ... or 7.9nm or 8.0nm should also be included, depth is not limited only to 3 ~ 5nm, should also included 3nm or 3.1nm or 3.2nm or 3.3nm or 3.4nm ... or 4.9nm or 5nm.

The prior art of routine techniques dawn known to those skilled in the art in above-described embodiment 1-2, do not make herein in detail Thin narration.

Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area Member, without departing from the spirit and scope of the present invention, it can also make a variety of changes and modification.Therefore, it is all equivalent Technical scheme fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.

SEQUENCE LISTING

<110>Pujiang County crystalline substance rich peasant's industry Science and Technology Ltd.

<120>The white tea cleaning equipment of intelligentized control method

<130> 1

<160> 1

<170> PatentIn version 3.5

<210> 1

<211> 33

<212> PRT

<213>It is artificial synthesized

<400> 1

His Ser His Ala Cys Thr Ser Tyr Tyr Cys Ala Lys Phe Cys Gly Thr

1 5 10 15

Ala Ser Cys Thr His His Pro Gly Leu Cys Val Cys Val Asn Cys Ser

20 25 30

Lys

Claims (7)

1. the white tea cleaning equipment of intelligentized control method, including support（26）, support（26）The tank of inner upper placement（4）, water Groove（4）The poking bar of middle part horizontal setting（19）, it is characterised in that：The support（26）Lower inside is mounted with air compressor （7）And storage tank（29）, the air compressor（7）Reversal valve is connected with, the reversal valve distinguishes connecting gas transmission pipe（6）With blow Main（34）, the appendix（6）Penetrate tank（4）With horizontal setting in tank（4）Pipeline occurs for the bubble of bottom（5）Even Connect, the drying pipe（34）Gas outlet be placed in tank（4）Inwall upper end, the storage tank（29）Pass through water pipe and support （26）The infusion pump of bottom side placement（25）Connection, the infusion pump（25）Pass through woven hose（24）Penetrate tank（4）Connection Go out liquid ball（28）, it is described go out liquid ball（28）It is placed in tank（4）Pipeline occurs for bottom bubble（5）Upper end, it is described go out liquid ball（28） Top is mounted with and tank（4）Floor space identical mesh screen（27）, the tank（4）Uniform ultrasonic wave hair is mounted with side wall Raw device（2）, the agitating roller（19）One end and motor（23）Output shaft（22）Connection, junction is provided with sealing ring（21）, institute State motor（23）It is placed in support（26）Lateral surface, the poking bar（19）The uniform continental quilt in surface（20）, the tank（4）On Side is provided with discharging mechanism, and the discharging mechanism includes sliding bar（16）, sliding shoe（11）And scraper bowl（3）, the sliding bar（16） Pass through connecting rod（1）With support（26）Side connects, the sliding bar（16）On be connected with sliding shoe（11）, the sliding shoe （11）Vertical direction lower end is provided with lift cylinder（10）, upper end is provided with sliding motor（12）, the lift cylinder（10）Output Axle top is connected with scraper bowl（3）, the sliding bar（16）One end is provided with first baffle（8）, the other end is provided with second baffle（17）, The second baffle（17）Lower section is provided with and sliding bar（16）The third baffle of connection（18）, the sliding shoe（11）Positioned at first Baffle plate（8）With second baffle（17）Between.

2. the white tea cleaning equipment of intelligentized control method according to claim 1, it is characterised in that：The sliding shoe（11）Lean on First baffle（8）Side is provided with the first range sensor（9）, the sliding shoe（11）By second baffle（17）Side upper end is provided with Second distance sensor（13）, lower end is provided with the 3rd range sensor（14）, the lift cylinder（10）It is provided with the middle part of output shaft Sterilamp（32）.

3. the white tea cleaning equipment of intelligentized control method according to claim 1, it is characterised in that：The tank（4）Inwall Surface is coated with antifouling paint, and the antifouling paint is made up of following component and parts by weight：Hydroxy-terminated polysiloxane 28-36 parts, Terminal hydroxy group fluorinated polysiloxane 5-15 parts, nano silicon 5-10 parts, nano-calcium carbonate 2.5-3.5 parts, activated carbon 2-4 parts, Zinc powder 3-5 parts, ethylene diamine tetra methylene phosphonic acid sodium 0.4-0.6 parts, stannous octoate 0.4-0.8 parts, the butanone ketoximinosilanes of methyl three 4-7 parts, dimethicone 3-7 parts, bacteriostatic agent 0.4-0.8 parts, silane coupler 0.8-1.3 parts, platinum catalyst 0.2-0.4 parts.

4. the white tea cleaning equipment of intelligentized control method according to claim 1, it is characterised in that：The scraper bowl（3）Side Connect water wheels（35）, the water wheels（35）Wheel blade be arc rubber slab, the printing on surface of rubber plate is all provided with circular hole or polygonal hole Or elliptical aperture or irregularly-shaped hole.

5. the white tea cleaning equipment of intelligentized control method according to claim 1, it is characterised in that：The sliding bar（16）Table Face ring is wound with a nanometer wire casing, the nanometer wire casing and sliding bar（16）Axis angle be 62 ° ~ 74 °, the nano wire well width For 4 ~ 8nm, depth is 3 ~ 5nm.

6. the white tea cleaning equipment of intelligentized control method according to claim 1, it is characterised in that：Pipeline occurs for the bubble (5) it is tubes in line, the tubes in line is by some longitudinal bubble branch pipes (30) and some horizontal bubble branch pipe (31) arrangement groups Into longitudinal bubble branch pipe (30) and horizontal bubble branch pipe (31) interconnect.

7. the white tea cleaning equipment of intelligentized control method according to claim 1, it is characterised in that：It is described go out liquid ball（28）Table Face is provided with fluid hole（15）, the fluid hole（15）Delivery port it is evenly spaced by dividing plate, it is described go out liquid ball（28）Both sides connect There is flexible pipe（33）, the flexible pipe（33）Surface is evenly equipped with delivery port.