CN107442468A - A kind of Multifunctional ad paper washer - Google Patents
A kind of Multifunctional ad paper washer Download PDFInfo
- Publication number
- CN107442468A CN107442468A CN201710643580.XA CN201710643580A CN107442468A CN 107442468 A CN107442468 A CN 107442468A CN 201710643580 A CN201710643580 A CN 201710643580A CN 107442468 A CN107442468 A CN 107442468A
- Authority
- CN
- China
- Prior art keywords
- parts
- multifunctional
- casing
- damper
- paper washer
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims abstract description 29
- 239000000428 dust Substances 0.000 claims abstract description 19
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 claims abstract description 8
- 229910052744 lithium Inorganic materials 0.000 claims abstract description 8
- AFFLGGQVNFXPEV-UHFFFAOYSA-N 1-decene Chemical compound CCCCCCCCC=C AFFLGGQVNFXPEV-UHFFFAOYSA-N 0.000 claims description 10
- IRIAEXORFWYRCZ-UHFFFAOYSA-N Butylbenzyl phthalate Chemical compound CCCCOC(=O)C1=CC=CC=C1C(=O)OCC1=CC=CC=C1 IRIAEXORFWYRCZ-UHFFFAOYSA-N 0.000 claims description 6
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 claims description 6
- 238000013016 damping Methods 0.000 claims description 5
- 238000005984 hydrogenation reaction Methods 0.000 claims description 4
- 241000276489 Merlangius merlangus Species 0.000 claims description 3
- 229910000410 antimony oxide Inorganic materials 0.000 claims description 3
- 239000000022 bacteriostatic agent Substances 0.000 claims description 3
- 125000000118 dimethyl group Chemical group [H]C([H])([H])* 0.000 claims description 3
- 239000010445 mica Substances 0.000 claims description 3
- 229910052618 mica group Inorganic materials 0.000 claims description 3
- VTRUBDSFZJNXHI-UHFFFAOYSA-N oxoantimony Chemical compound [Sb]=O VTRUBDSFZJNXHI-UHFFFAOYSA-N 0.000 claims description 3
- 239000000843 powder Substances 0.000 claims description 3
- 239000000377 silicon dioxide Substances 0.000 claims description 3
- 229920005573 silicon-containing polymer Polymers 0.000 claims description 3
- BIKXLKXABVUSMH-UHFFFAOYSA-N trizinc;diborate Chemical compound [Zn+2].[Zn+2].[Zn+2].[O-]B([O-])[O-].[O-]B([O-])[O-] BIKXLKXABVUSMH-UHFFFAOYSA-N 0.000 claims description 3
- NWONKYPBYAMBJT-UHFFFAOYSA-L zinc sulfate Chemical compound [Zn+2].[O-]S([O-])(=O)=O NWONKYPBYAMBJT-UHFFFAOYSA-L 0.000 claims description 3
- 229960001763 zinc sulfate Drugs 0.000 claims description 3
- 229910000368 zinc sulfate Inorganic materials 0.000 claims description 3
- 239000004925 Acrylic resin Substances 0.000 claims description 2
- 229920000178 Acrylic resin Polymers 0.000 claims description 2
- 239000002202 Polyethylene glycol Substances 0.000 claims description 2
- 229920001223 polyethylene glycol Polymers 0.000 claims description 2
- SAJGCUXAHBJVRH-VFQQELCFSA-N (2r,3r,4r,5s)-hexane-1,2,3,4,5,6-hexol;hydrate Chemical compound O.OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO SAJGCUXAHBJVRH-VFQQELCFSA-N 0.000 claims 1
- MTTMVWKXHWRZLQ-UHFFFAOYSA-N n-ethoxydodecan-1-amine Chemical compound CCCCCCCCCCCCNOCC MTTMVWKXHWRZLQ-UHFFFAOYSA-N 0.000 claims 1
- 229920001721 polyimide Polymers 0.000 claims 1
- 239000009719 polyimide resin Substances 0.000 claims 1
- 238000004140 cleaning Methods 0.000 abstract description 16
- 239000007921 spray Substances 0.000 abstract description 8
- 239000000463 material Substances 0.000 abstract description 5
- 238000010276 construction Methods 0.000 abstract description 2
- 238000010586 diagram Methods 0.000 description 11
- 239000011248 coating agent Substances 0.000 description 9
- 238000000576 coating method Methods 0.000 description 9
- 230000036544 posture Effects 0.000 description 5
- 241000894006 Bacteria Species 0.000 description 4
- 239000003910 polypeptide antibiotic agent Substances 0.000 description 3
- ZORQXIQZAOLNGE-UHFFFAOYSA-N 1,1-difluorocyclohexane Chemical compound FC1(F)CCCCC1 ZORQXIQZAOLNGE-UHFFFAOYSA-N 0.000 description 2
- 229920000877 Melamine resin Polymers 0.000 description 2
- 239000004640 Melamine resin Substances 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 238000005260 corrosion Methods 0.000 description 2
- 238000001035 drying Methods 0.000 description 2
- 230000000694 effects Effects 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000005201 scrubbing Methods 0.000 description 2
- 229940035049 sorbitan monooleate Drugs 0.000 description 2
- 235000011069 sorbitan monooleate Nutrition 0.000 description 2
- 239000001593 sorbitan monooleate Substances 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 238000004659 sterilization and disinfection Methods 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- SMZOUWXMTYCWNB-UHFFFAOYSA-N 2-(2-methoxy-5-methylphenyl)ethanamine Chemical compound COC1=CC=C(C)C=C1CCN SMZOUWXMTYCWNB-UHFFFAOYSA-N 0.000 description 1
- HCYSJBICYOIBLS-UHFFFAOYSA-N 2-(dodecylamino)ethanol Chemical compound CCCCCCCCCCCCNCCO HCYSJBICYOIBLS-UHFFFAOYSA-N 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-N 2-Propenoic acid Natural products OC(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 1
- UQJUGHFKNKGHFQ-VZFHVOOUSA-N Ala-Cys-Thr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(O)=O UQJUGHFKNKGHFQ-VZFHVOOUSA-N 0.000 description 1
- AUFACLFHBAGZEN-ZLUOBGJFSA-N Ala-Ser-Cys Chemical compound N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O AUFACLFHBAGZEN-ZLUOBGJFSA-N 0.000 description 1
- SPIPSJXLZVTXJL-ZLUOBGJFSA-N Asn-Cys-Ser Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(O)=O SPIPSJXLZVTXJL-ZLUOBGJFSA-N 0.000 description 1
- 108010071023 Bacterial Outer Membrane Proteins Proteins 0.000 description 1
- DCJNIJAWIRPPBB-CIUDSAMLSA-N Cys-Ala-Lys Chemical compound C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CS)N DCJNIJAWIRPPBB-CIUDSAMLSA-N 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- 206010053759 Growth retardation Diseases 0.000 description 1
- DGLAHESNTJWGDO-SRVKXCTJSA-N His-Ser-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N DGLAHESNTJWGDO-SRVKXCTJSA-N 0.000 description 1
- NFHJQETXTSDZSI-DCAQKATOSA-N Leu-Cys-Arg Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O NFHJQETXTSDZSI-DCAQKATOSA-N 0.000 description 1
- ALHULIGNEXGFRM-QWRGUYRKSA-N Phe-Cys-Gly Chemical compound OC(=O)CNC(=O)[C@H](CS)NC(=O)[C@@H](N)CC1=CC=CC=C1 ALHULIGNEXGFRM-QWRGUYRKSA-N 0.000 description 1
- STGVYUTZKGPRCI-GUBZILKMSA-N Pro-Val-Cys Chemical compound SC[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H]1CCCN1 STGVYUTZKGPRCI-GUBZILKMSA-N 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- OSFZCEQJLWCIBG-BZSNNMDCSA-N Ser-Tyr-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O OSFZCEQJLWCIBG-BZSNNMDCSA-N 0.000 description 1
- YDWLCDQXLCILCZ-BWAGICSOSA-N Thr-His-Tyr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O YDWLCDQXLCILCZ-BWAGICSOSA-N 0.000 description 1
- XTDDIVQWDXMRJL-IHRRRGAJSA-N Val-Leu-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](C(C)C)N XTDDIVQWDXMRJL-IHRRRGAJSA-N 0.000 description 1
- 125000003275 alpha amino acid group Chemical group 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 238000013475 authorization Methods 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 210000004027 cell Anatomy 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- ILRSCQWREDREME-UHFFFAOYSA-N dodecanamide Chemical compound CCCCCCCCCCCC(N)=O ILRSCQWREDREME-UHFFFAOYSA-N 0.000 description 1
- 239000002360 explosive Substances 0.000 description 1
- 231100000001 growth retardation Toxicity 0.000 description 1
- 108010040030 histidinoalanine Proteins 0.000 description 1
- 108010085325 histidylproline Proteins 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- JEIPFZHSYJVQDO-UHFFFAOYSA-N iron(III) oxide Inorganic materials O=[Fe]O[Fe]=O JEIPFZHSYJVQDO-UHFFFAOYSA-N 0.000 description 1
- 108010038320 lysylphenylalanine Proteins 0.000 description 1
- 230000013011 mating Effects 0.000 description 1
- 238000000034 method Methods 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 239000003973 paint Substances 0.000 description 1
- 238000005192 partition Methods 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 230000000630 rising effect Effects 0.000 description 1
- 238000007790 scraping Methods 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000002699 waste material Substances 0.000 description 1
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B1/00—Cleaning by methods involving the use of tools
- B08B1/10—Cleaning by methods involving the use of tools characterised by the type of cleaning tool
- B08B1/12—Brushes
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B1/00—Cleaning by methods involving the use of tools
- B08B1/30—Cleaning by methods involving the use of tools by movement of cleaning members over a surface
- B08B1/32—Cleaning by methods involving the use of tools by movement of cleaning members over a surface using rotary cleaning members
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B15/00—Preventing escape of dirt or fumes from the area where they are produced; Collecting or removing dirt or fumes from that area
- B08B15/04—Preventing escape of dirt or fumes from the area where they are produced; Collecting or removing dirt or fumes from that area from a small area, e.g. a tool
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B3/00—Cleaning by methods involving the use or presence of liquid or steam
- B08B3/02—Cleaning by the force of jets or sprays
-
- C—CHEMISTRY; METALLURGY
- C09—DYES; PAINTS; POLISHES; NATURAL RESINS; ADHESIVES; COMPOSITIONS NOT OTHERWISE PROVIDED FOR; APPLICATIONS OF MATERIALS NOT OTHERWISE PROVIDED FOR
- C09D—COATING COMPOSITIONS, e.g. PAINTS, VARNISHES OR LACQUERS; FILLING PASTES; CHEMICAL PAINT OR INK REMOVERS; INKS; CORRECTING FLUIDS; WOODSTAINS; PASTES OR SOLIDS FOR COLOURING OR PRINTING; USE OF MATERIALS THEREFOR
- C09D133/00—Coating compositions based on homopolymers or copolymers of compounds having one or more unsaturated aliphatic radicals, each having only one carbon-to-carbon double bond, and at least one being terminated by only one carboxyl radical, or of salts, anhydrides, esters, amides, imides, or nitriles thereof; Coating compositions based on derivatives of such polymers
-
- C—CHEMISTRY; METALLURGY
- C09—DYES; PAINTS; POLISHES; NATURAL RESINS; ADHESIVES; COMPOSITIONS NOT OTHERWISE PROVIDED FOR; APPLICATIONS OF MATERIALS NOT OTHERWISE PROVIDED FOR
- C09D—COATING COMPOSITIONS, e.g. PAINTS, VARNISHES OR LACQUERS; FILLING PASTES; CHEMICAL PAINT OR INK REMOVERS; INKS; CORRECTING FLUIDS; WOODSTAINS; PASTES OR SOLIDS FOR COLOURING OR PRINTING; USE OF MATERIALS THEREFOR
- C09D5/00—Coating compositions, e.g. paints, varnishes or lacquers, characterised by their physical nature or the effects produced; Filling pastes
- C09D5/08—Anti-corrosive paints
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08K—Use of inorganic or non-macromolecular organic substances as compounding ingredients
- C08K3/00—Use of inorganic substances as compounding ingredients
- C08K3/18—Oxygen-containing compounds, e.g. metal carbonyls
- C08K3/24—Acids; Salts thereof
- C08K3/26—Carbonates; Bicarbonates
- C08K2003/265—Calcium, strontium or barium carbonate
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08K—Use of inorganic or non-macromolecular organic substances as compounding ingredients
- C08K3/00—Use of inorganic substances as compounding ingredients
- C08K3/38—Boron-containing compounds
- C08K2003/387—Borates
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08L—COMPOSITIONS OF MACROMOLECULAR COMPOUNDS
- C08L2205/00—Polymer mixtures characterised by other features
- C08L2205/03—Polymer mixtures characterised by other features containing three or more polymers in a blend
- C08L2205/035—Polymer mixtures characterised by other features containing three or more polymers in a blend containing four or more polymers in a blend
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Materials Engineering (AREA)
- Wood Science & Technology (AREA)
- Organic Chemistry (AREA)
- Cleaning In General (AREA)
Abstract
The present invention provides a kind of Multifunctional ad paper washer, belongs to cleaning equipment technical field；Washer includes casing, handle, water pump, motor, damper, lithium battery, brush, single-chip microcomputer, bar linkage structure, casing upper end is connected with handle, handle is provided with controlling switch, single-chip microcomputer is housed above box house, lithium battery is housed below box house, body side is equipped with water pump, casing leading portion is connected with linkage, linkage upper end is equipped with motor, and motor output end is connected with damper, damper connection brush.The present apparatus is convenient for carrying, simple in construction, and operation is easy, is adapted to the cleaning of various environment.Use manpower and material resources sparingly, improve operating efficiency, and the good noresidue of cleaning performance；The characteristics of integrating water spray, dust suction, striking off.
Description
Technical field
The present invention relates to a kind of poster paper cleaning device, is directed primarily to a kind of Multifunctional ad paper washer.
Background technology
At present, in each corner of cell corridor, public place it can be seen that being posted in the publicity small advertisement of wall.
Without the small advertisement not glued, it is very proper to be compared to city " psoriasis "：It is equally horrible, it is equally obstinate.Put up small advertisement
Person thinks that this behavior is an ordinary incident, anyway municipal administration will not also manage these minor matters.So small advertisement everywhere may be used in the street
See, but put up small advertisement everywhere and have and much endanger.These small advertisements are mainly manually struck off with small scoop at present, are existed
Scrape unclean, waste time and energy, the problem of efficiency is low.
Such as, Chinese invention granted patent document, Authorization Notice No. CN105057240B, the invention is related to one kind to prior art
Hand-held poster paper cleaner, by casing, handle, controlling switch, water pump, motor, damper, brush, sparge pipe, linkage
Composition.Single-chip microcomputer and lithium battery are separately fixed on casing internal partition and bottom plate, and water pump is arranged on casing lateral wall, handle position
In casing top, there is controlling switch on hand-held pole, linkage is located at casing leading section.Lithium battery provides for motor and water pump
Power supply, single-chip microcomputer plug-in controlled motor rotating；Motor is connected in horizontal version by support base, damper upper end and motor
Axis connection is exported, damper lower end is connected with motor output shaft, and damper lower end is connected with brush；Sparge pipe is connected to rear gusset
Outside；Water pump is connected with sparge pipe by water-supply-pipe；The start and stop of motor and water pump are by controlling the controlling switch on hand-held pole, even
Linkage is according to the different adjustment postures in real time of location advertising.Although the invention can improve the efficiency for scrubbing small advertisement, in length
It can cause the sparge pipe mouth of pipe that the situation got rusty occurs under the cleaning of time, also result in the small advertisement needs for washing to get off from wall
Manually go to pick up.
The content of the invention
Simple in construction it is an object of the invention to provide a kind of Multifunctional ad paper washer, operation is easy, cleaning speed
It hurry up, effect is good, and cleannes are high, the characteristics of integrating water spray, dust suction, strike off；The sparge pipe mouth of pipe has added antirust coat to make for a long time
Got rusty with also occurring without.
The present invention is for the scheme taken of solution above-mentioned technical problem：A kind of Multifunctional ad paper washer, including case
Body, damper, brush, bar linkage structure, casing upper end are connected with handle, and handle is provided with controlling switch, filled above box house
There is single-chip microcomputer, lithium battery is housed below box house, body side is equipped with water pump, and casing leading portion is connected with linkage, connecting rod
Mechanism upper end is equipped with motor, and motor output end is connected with damper, damper connection brush；The present apparatus is convenient for carrying, structure letter
Single, operation is easy, is adapted to the cleaning of various environment.Use manpower and material resources sparingly, improve operating efficiency, and cleaning performance is good without residual
Stay；The characteristics of integrating water spray, dust suction, striking off.
Preferably, linkage includes left and right support angle, left and right support angle is connected with casing front end, left and right support angle and connecting rod
One end connection, the connecting rod other end is connected with preceding gusset；It is hinged in the middle part of connecting rod with support frame one end；The other end of support frame
Coordinate with slide rail；Slide rail is located at below the support angle of left and right；Slide rail is connected with casing front end；Preceding gusset is connected with horizontal version one end with bolt
Connect；The other end of horizontal version is also connected with bolt with rear gusset.Motor is connected in horizontal version by support base；Connected afterwards on the outside of gusset
Sparge pipe；Sparge pipe connects water pump by water pipe；Bar linkage structure is reasonable in design, by the posture of linkage regulation motor and then
The posture of whole device is controlled, artificial operating handle can be wiped advertisement different angle, different azimuth；Sparge pipe sprays
Hydraulic pressure advertisement can also be made to come off faster.
Preferably, the vertical median plane of slide rail overlaps with the plane of symmetry of left and right support angle；Symmetrical length is provided with slide rail side wall
Slotted eye, the width of long slot bore are equal with the fraising diameter on support frame；The width of long slot bore is equal with the diameter that reamed on support frame,
It can so make it that the cooperation between them is more preferable, operationalizes cleaning device more smooth, be not in Caton phenomenon.
Preferably, angle adjustable is 0 ° -50 ° between connecting rod and support frame；Slide rail, Ke Yirang are housed on linkage
Support frame slides up and down in slide rail；The connecting rod of connection support frame is had the angle swung up and down, can so cause each
Corner can clean to, and compared to same type cleaning device, the present apparatus improves than the cleaning efficiency of same type cleaning device
10.
Preferably, damper includes upper flange；Upper flange upper end is connected with motor output end；On upper flange and lower flange
Three column pin holes are furnished with respectively, and three column pin holes are coaxial；Column pin hole between upper flange and lower flange is placed with spacing washer；
Damping spring built in the column pin hole of lower flange；Upper flange is connected with lower flange by pin；Three are evenly equipped with lower flange outer rim
Screw；Lower flange is connected with brush.When the vibrations of brush vertical direction stress, disaccommodation can will be shaken by damper, mitigate shake
The dynamic influence to whole device；Brush bolt is connected with damper, can be to brush for the poster paper of unlike material and area
Changed, improve elimination efficiency and quality.
Preferably, being equipped with a dust exhaust apparatus among brush, dividing plate is provided with dust exhaust apparatus, diaphragm internal is provided with side
Hole；Dust exhaust apparatus be in order to which the rubbish for being washed down brush positive and negative rotation is directly by dust exhaust apparatus inspiration, dividing plate be in order to
Dust exhaust apparatus will not be blocked by not sucking the larger scraps of paper；It is that the scraps of paper that will be sucked in collect that diaphragm internal, which is provided with square hole,；
For this dust exhaust apparatus compared with common dust exhaust apparatus, the present apparatus can directly filter the larger scraps of paper, will not be other impurities to suction
It is attached to come in, because dust-absorbing strength is limited.
Preferably, scribbling antirust coat at the mouth of pipe of sparge pipe, antirust coat is made up of following component and parts by weight：
It is acrylic resin 60-80 parts, melamine resin 30-40 parts, butyl benzyl phthalate 5-10 parts, Firebrake ZB 1-4 parts, antibacterial
Agent 0.3-0.42 parts, antimony oxide 3-10 parts, N, N- double hydroxyethyl laurylamide 1-5 parts, zinc sulfate 1-5 parts, mica
Powder 20-30 parts, powdered whiting 22-28 parts, polyethylene glycol 1-5 parts, dimethyl silicone polymer 0.2-0.6 parts, silica
0.2-0.6, water 70-80 parts, sorbitan monooleate 5-10 parts, the poly- 1- decene 0.2-0.5 of hydrogenation；This coating is coated
Pass through drying and processing to the sparge pipe mouth of pipe.Be advantageous to improve the tack for rising coating and substrate, the rust-preventing characteristic protection sparge pipe mouth of pipe；
The service life that the sparge pipe mouth of pipe can so be extended passes through；Addition hydrogenates poly- 1- decene and further increases the anti-of coating
Rust property, while this coating also has the function that anti-corrosion, sterilization.
Compared with prior art, beneficial effects of the present invention are：Low, present apparatus structure letter of scraping efficiency compared to artificial shovel
It is single, it is convenient for carrying, operation is easy, and cleaning speed is fast, and effect is good, and cleannes are high, and manpower thing is also saved while improving efficiency
Power；The characteristics of integrating water spray, dust suction, striking off, the water spray mouth of pipe can allow the service life of the part longer added with coating.
Present invention employs above-mentioned technical proposal to provide a kind of Multifunctional ad paper washer, compensate for prior art not
Foot, it is reasonable in design, it is easy to operate.
Brief description of the drawings
Fig. 1 is a kind of Multifunctional ad paper cleaner structure schematic diagram of the present invention；
Fig. 2 is a kind of Multifunctional ad paper washer casing schematic diagram of the present invention；
Fig. 3 is a kind of Multifunctional ad paper washer linkage cooperation schematic diagram of the present invention；
Fig. 4 is a kind of Multifunctional ad paper washer connecting rod schematic diagram of the present invention；
Fig. 5 is a kind of Multifunctional ad paper washer slide rail axonometric drawing of the present invention；
Fig. 6 is a kind of left support angle schematic diagram of Multifunctional ad paper washer of the present invention；
Fig. 7 is a kind of Multifunctional ad paper washer support frame schematic diagram of the present invention；
Fig. 8 is a kind of Multifunctional ad paper washer horizontal stroke version of the present invention and gusset mating connection schematic diagram；
Fig. 9 is a kind of Multifunctional ad paper washer horizontal stroke version schematic diagram of the present invention；
Figure 10 is gusset schematic diagram before a kind of Multifunctional ad paper washer of the present invention；
Figure 11 is gusset schematic diagram after a kind of Multifunctional ad paper washer of the present invention；
Figure 12 is a kind of Multifunctional ad paper washer damper explosive view of the present invention；
Figure 13 is a kind of Multifunctional ad paper washer upper flange top view of the present invention；
Figure 14 is a kind of Multifunctional ad paper washer upper flange sectional view of the present invention；
Figure 15 is a kind of Multifunctional ad paper washer lower flange top view of the present invention；
Figure 16 is a kind of Multifunctional ad paper washer lower flange sectional view of the present invention；
Figure 17 is a kind of Multifunctional ad paper washer connecting key schematic diagram of the present invention.
Figure 18 is a kind of Multifunctional ad paper washer a portions of the invention upward view.
Description of reference numerals：1 water pump；2 slide rails；3 support frames；4 connecting rods；5 brushs；Gusset after 6；7 sparge pipes；8 motors；
9 dampers；10 horizontal versions；Gusset before 11；12nd, 13 or so support angle；14 casings；15 controlling switches；16 handles；17 single-chip microcomputers；18 lithiums
Battery；19 pins；20 damping springs；21 lower flanges；22 pads；23 upper flanges；24 connecting keys；25 dust exhaust apparatuses.
Embodiment
It is described in further detail below in conjunction with drawings and examples：
Embodiment 1：
As shown in Fig. 1 ~ 18, a kind of Multifunctional ad paper washer, including casing 14, damper 9, brush 5, bar linkage structure, case
The upper end of body 14 is connected with handle 16, and handle 16 is provided with controlling switch 15, and the inner upper of casing 14 is equipped with single-chip microcomputer 17, casing 14
Lower inside is equipped with lithium battery 18, and the side of casing 14 is equipped with water pump 1, and the leading portion of casing 14 is connected with linkage, on linkage
End is equipped with motor 8, and the output end of motor 8 is connected with damper 9, and damper 9 connects brush 5；The present apparatus is convenient for carrying, structure letter
Single, operation is easy, is adapted to the cleaning of various environment.Use manpower and material resources sparingly, improve operating efficiency, and cleaning performance is good without residual
Stay；The characteristics of integrating water spray, dust suction, striking off.Linkage includes left and right support angle 12,13, left and right support angle 12,13 and casing
14 front ends are connected, and left and right support angle 12,13 is connected with one end of connecting rod 4, and the other end of connecting rod 4 is connected with preceding gusset 11；Connection
The middle part of bar 4 is hinged with the one end of support frame 3；The other end of support frame 3 coordinates with slide rail 2；Slide rail 2 is located under left and right support angle 12,13
Side；Slide rail 2 is connected with the front end of casing 14；Preceding gusset 11 is connected with horizontal one end of version 10；The other end of horizontal version 10 also uses spiral shell
Bolt is connected with rear gusset 6.Motor 8 is connected in horizontal version 10 by support base；The outside of gusset 6 connection sparge pipe 7 afterwards；Sparge pipe 7
Water pump 1 is connected by water pipe；Bar linkage structure is reasonable in design, and whole device is controlled by the posture of linkage regulation motor
Posture, artificial operating handle can be wiped advertisement different angle, different azimuth；The hydraulic pressure that sparge pipe sprays can also
Advertisement is set to come off faster.2 vertical median plane of slide rail overlaps with the plane of symmetry of left and right support angle 12,13；It is provided with the side wall of slide rail 2 pair
The long slot bore of title, the width of long slot bore are equal with the fraising diameter on support frame 3；Reamed on the width and support frame of long slot bore straight
Footpath is equal, can so make it that the cooperation between them is more preferable, operationalize cleaning device more smooth, be not in interim card
Phenomenon.Angle adjustable between connecting rod 4 and support frame 3 is 45 °；Slide rail is housed on linkage, support frame can be allowed in cunning
Slided up and down in rail；The connecting rod of connection support frame is had the angle swung up and down, can so make it that each corner can
Clean to.Damper 9 includes upper flange 23；The upper end of upper flange 23 is connected with the output end of motor 8；On upper flange 23 and lower flange 21
Three column pin holes are furnished with respectively, and three column pin holes are coaxial；Column pin hole between upper flange 23 and lower flange 21 is placed with interval
Pad 22；Damping spring 20 built in the column pin hole of lower flange 21；Upper flange 23 is connected with lower flange 21 by pin 19；Lower flange
Three screws are evenly equipped with 21 outer rims；Lower flange 21 is connected with brush 5.When the vibrations of brush vertical direction stress are to pass through damping
Device can will shake disaccommodation, mitigate influence of the vibrations to whole device；Brush bolt is connected with damper, for unlike material
Brush can be changed with the poster paper of area, improve elimination efficiency and quality.A dust exhaust apparatus is housed among brush, inhaled
Dividing plate is provided with dirt device；Diaphragm internal is provided with square hole；Dust exhaust apparatus is the rubbish in order to which brush positive and negative rotation is washed down
For rubbish directly by dust exhaust apparatus inspiration, dividing plate is will not to block dust exhaust apparatus to not suck the larger scraps of paper；Diaphragm internal is set
It is that the scraps of paper that will be sucked in collect to have square hole, time saving and energy saving.
Antirust coat is scribbled at the mouth of pipe of sparge pipe 7, antirust coat is made up of following component and preferred weight part：Acrylic acid
65 parts of resin, 35 parts of melamine resin, 6 parts of butyl benzyl phthalate, 3 parts of Firebrake ZB, 8 parts of antimony oxide, bacteriostatic agent
0.38 part, N, 3 parts of N- double hydroxyethyls laurylamide, 4 parts of zinc sulfate, 25 parts of mica powder, 23 parts of powdered whiting, poly- second two
3 parts of alcohol, 0.24 part of dimethyl silicone polymer, silica 0.3,70 parts of water, 0.2 part of sorbitan monooleate, hydrogenation
Poly- 0.33 part of 1- decene；This coating is coated to the sparge pipe mouth of pipe and passes through drying and processing, is advantageous to improve and rises coating and substrate
Tack, the rust-preventing characteristic protection sparge pipe mouth of pipe, it can so extend the service life of the sparge pipe mouth of pipe by the way that addition hydrogenation is poly-
1- decene, the rust-preventing characteristic of coating is further increased, while this coating also has the function that anti-corrosion, sterilization.
Bacteriostatic agent in antirust coat is antibacterial peptide, and the amino acid sequence of antibacterial peptide is：
HSHACTSYYCAKFCGTASCTHYLCRVLHPVCVNCSK, it can prevent the synthesis of Bacterial outer membrane proteins matter, so as to suppress
The formation of bacteria cell wall, prevent bacterium from maintaining normal cellular morphology, growth retardation, and can wear the cell membrane of bacterium
Hole, bacterial death is ultimately resulted in, antibacterial peptide is obviously improved the antibacterial effect of antirusting paint, avoids bacterium from being grown on the surface of sparge pipe 7
It is raw.
Embodiment 2：
As shown in Fig. 1 ~ 18, a kind of Multifunctional ad paper washer, during real work：Sparge pipe 7 is arranged on the outer of rear gusset 6
Side, water pump are connected with sparge pipe 7 by water-supply-pipe；The start and stop of motor 8 and water pump 1 are controlled by the controlling switch 15 on the holding rod of handle 16
System, rotating program built in single-chip microcomputer 17, the main story 5s of 17 controlled motor of single-chip microcomputer 8, reversion 5s, rotating rotate alternately,
So as to drive the rotation of brush 5；Lithium battery 18 is that the water pump 1 of motor 8 provides power supply；Damper 8 is housed in brush 5, damper 8
Uniform three screwed holes in the outside of lower flange 21, are bolted brush 5；It can conveniently to change under the scrubbing of varying environment
Put various sizes of brush；When the vertical direction stress of brush 5 shakes, disaccommodation can will be shaken by damper 8, mitigate vibrations
Influence to whole device.
The prior art of routine techniques dawn known to those skilled in the art in above-described embodiment, is not chatted in detail herein
State.
It will be apparent to those skilled in the art that technical scheme that can be as described above and design, make other various
Corresponding change and deformation, and all these changes and deformation should all belong to the protection domain of the claims in the present invention
Within.
SEQUENCE LISTING
<110>Pujiang County frontlighting Science and Technology Ltd.
<120>A kind of Multifunctional ad paper washer
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 36
<212> PRT
<213>It is artificial synthesized
<400> 1
His Ser His Ala Cys Thr Ser Tyr Tyr Cys Ala Lys Phe Cys Gly Thr
1 5 10 15
Ala Ser Cys Thr His Tyr Leu Cys Arg Val Leu His Pro Val Cys Val
20 25 30
Asn Cys Ser Lys
35
Claims (7)
1. a kind of Multifunctional ad paper washer, including casing（14）, damper（9）, brush（5）, bar linkage structure, its feature exists
In：The casing（14）Upper end is connected with handle（16）, the handle（16）It is provided with controlling switch (15), the casing
（14）Inner upper is equipped with single-chip microcomputer（17）, the casing（14）Lower inside is equipped with lithium battery（18）, the casing（14）Side
Face is equipped with water pump（1）, the casing（14）Front end is connected with linkage, and the linkage upper end is equipped with motor（8）, it is described
Motor（8）Output end and damper（9）Connection, the damper（9）Connect brush（5）.
A kind of 2. Multifunctional ad paper washer according to claim 1, it is characterised in that：The linkage includes a left side
Right support angle（12）、（13）, the left and right support angle（12）、（13）With casing（14）Front end connects, the left and right support angle（12）、（13）
With connecting rod（4）One end connection, the connecting rod（4）The other end and preceding gusset（11）Connection；The connecting rod（4）Middle part
With support frame（3）One end is hinged；Support frame（3）The other end and slide rail（2）Coordinate；The slide rail（2）Positioned at left and right support angle
（12）、（13）Lower section；The slide rail（2）With casing（14）Front end connects；The preceding gusset（11）With horizontal version（10）One end spiral shell
Tether and connect；The horizontal version（10）Other end bolt and rear gusset（6）Connection.The motor（8）It is connected to by support base
Horizontal version（10）On；Gusset after described（6）Outside connects sparge pipe（7）；The sparge pipe（7）Water pump is connected by water pipe（1）.
A kind of 3. Multifunctional ad paper washer according to claim 2, it is characterised in that：The slide rail（2）In vertical
Heart face and left and right support angle（12）（13）The plane of symmetry overlap；The slide rail（2）Symmetrical long slot bore is provided with side wall, long slot bore
Width and support frame（3）On fraising diameter it is equal.
A kind of 4. Multifunctional ad paper washer according to claim 2, it is characterised in that：The connecting rod（4）With branch
Support（3）Between angle adjustable be 0 ° -50 °.
A kind of 5. Multifunctional ad paper washer according to claim 1, it is characterised in that：The damper（9）Including
Upper flange（23）；The upper flange（23）Upper end and motor（8）Output end connects；The upper flange（23）With lower flange（21）On
Three column pin holes are furnished with respectively, and three column pin holes are coaxial；The upper flange（23）With lower flange（21）Between column pin hole put
It is equipped with spacing washer（22）；The lower flange（21）Column pin hole built in damping spring（20）；The upper flange（23）It is convex with
Edge（21）Pass through pin（19）Connection；The lower flange（21）Three screws are evenly equipped with outer rim；The lower flange（21）With brush
Disk（5）Connection.
A kind of 6. Multifunctional ad paper washer according to claim 1, it is characterised in that：The brush（5）Centre dress
There is a dust exhaust apparatus（25）；Dust exhaust apparatus（25）The inside is provided with dividing plate；Diaphragm internal is provided with square hole.
A kind of 7. Multifunctional ad paper washer according to claim 1, it is characterised in that：The sparge pipe（7）Pipe
Kou Chu surfaces scribble antirust coat, and the antirust coat is made up of following component and parts by weight：It is acrylic resin 60-80 parts, close
Polyimide resin 30-40 parts, butyl benzyl phthalate 5-10 parts, Firebrake ZB 1-4 parts, antimony oxide 3-10 parts, N, N- are double
Ethoxy laurylamide 1-5 parts, zinc sulfate 1-5 parts, mica powder 20-30 parts, bacteriostatic agent 0.3-0.42 parts, powdered whiting
22-28 parts, polyethylene glycol 1-5 parts, dimethyl silicone polymer 0.2-0.6 parts, silica 0.2-0.6 parts, water 70-80 parts, mistake
Water sorbitol monooleate 0.1-0.3 parts, the poly- 1- decene 0.2-0.5 parts of hydrogenation.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710643580.XA CN107442468A (en) | 2017-07-31 | 2017-07-31 | A kind of Multifunctional ad paper washer |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710643580.XA CN107442468A (en) | 2017-07-31 | 2017-07-31 | A kind of Multifunctional ad paper washer |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107442468A true CN107442468A (en) | 2017-12-08 |
Family
ID=60489329
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710643580.XA Pending CN107442468A (en) | 2017-07-31 | 2017-07-31 | A kind of Multifunctional ad paper washer |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107442468A (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108405408A (en) * | 2018-04-28 | 2018-08-17 | 佛山市瑞生海特生物科技有限公司 | A kind of Portable advertisement cleaning plant carrying mini vacuum machine |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1968719A (en) * | 2004-06-16 | 2007-05-23 | 阿费内基有限公司 | Biofunctional coatings |
| CN103382336A (en) * | 2013-07-08 | 2013-11-06 | 吴江市物华五金制品有限公司 | Flame-retardant anti-corrosion paint |
| CN104588345A (en) * | 2015-01-28 | 2015-05-06 | 南京农业大学 | Portable spam cleaner |
| CN105057240A (en) * | 2015-07-30 | 2015-11-18 | 西北工业大学 | Portable advertising patch removing device |
-
2017
- 2017-07-31 CN CN201710643580.XA patent/CN107442468A/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1968719A (en) * | 2004-06-16 | 2007-05-23 | 阿费内基有限公司 | Biofunctional coatings |
| CN103382336A (en) * | 2013-07-08 | 2013-11-06 | 吴江市物华五金制品有限公司 | Flame-retardant anti-corrosion paint |
| CN104588345A (en) * | 2015-01-28 | 2015-05-06 | 南京农业大学 | Portable spam cleaner |
| CN105057240A (en) * | 2015-07-30 | 2015-11-18 | 西北工业大学 | Portable advertising patch removing device |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108405408A (en) * | 2018-04-28 | 2018-08-17 | 佛山市瑞生海特生物科技有限公司 | A kind of Portable advertisement cleaning plant carrying mini vacuum machine |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN205804244U (en) | A kind of multi-functional quick dumper | |
| CN211113390U (en) | Town road fallen leaves scavenging machine | |
| CN106175580A (en) | A kind of mini vacuum cleaner of Multifunctional hand-held | |
| CN107442468A (en) | A kind of Multifunctional ad paper washer | |
| CN206966178U (en) | Multifunction dust removing device is used in a kind of seed processing | |
| CN203841648U (en) | Dustpan | |
| CN107442469A (en) | A kind of simple wallpaper cleaning plant | |
| CN106063690A (en) | A kind of multifunctional dust vacuum cleaner | |
| CN207821765U (en) | A kind of more sucking mouth type suction nozzles and the Wet-dry type dust catcher for being equipped with the suction nozzle | |
| CN207996180U (en) | A kind of scrubbing brush and the dust catcher using the scrubbing brush | |
| CN107332503A (en) | A kind of Simple photovoltaic plate cleaning device | |
| CN206956634U (en) | A kind of cleaning car with the dust exhaust apparatus comprising swinging structure | |
| CN207626776U (en) | Hand-held kerbstone cleaning device | |
| CN209697287U (en) | A kind of artificial fog spray head protective cover of spraying machine | |
| CN208098753U (en) | A kind of tea processing cleaning device | |
| CN207760794U (en) | A kind of crawler type sprayer | |
| CN208055967U (en) | A kind of cleaning structure of town road burnisher | |
| CN206599752U (en) | A kind of New cleaner of adjustable hairbrush height | |
| CN214798394U (en) | Automatic cleaning device for power distribution cabinet | |
| CN112603195B (en) | Dust collector for cleaning cloth blanket | |
| CN208286963U (en) | A kind of watering besom | |
| CN107442467A (en) | A kind of hand-held poster paper cleaner | |
| CN220802504U (en) | Spraying dust collector for environmental protection | |
| CN106733791A (en) | A kind of ornamental plant cleaning device | |
| CN108018814A (en) | A kind of multipurpose refuse cleaning vehicle |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20171208 |
|
| RJ01 | Rejection of invention patent application after publication |