CN107441680A - A kind of multiple location health and fitness facilities - Google Patents
A kind of multiple location health and fitness facilities Download PDFInfo
- Publication number
- CN107441680A CN107441680A CN201710609450.4A CN201710609450A CN107441680A CN 107441680 A CN107441680 A CN 107441680A CN 201710609450 A CN201710609450 A CN 201710609450A CN 107441680 A CN107441680 A CN 107441680A
- Authority
- CN
- China
- Prior art keywords
- arm
- balance weight
- chest expanding
- multiple location
- steel wire
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- A—HUMAN NECESSITIES
- A63—SPORTS; GAMES; AMUSEMENTS
- A63B—APPARATUS FOR PHYSICAL TRAINING, GYMNASTICS, SWIMMING, CLIMBING, OR FENCING; BALL GAMES; TRAINING EQUIPMENT
- A63B23/00—Exercising apparatus specially adapted for particular parts of the body
- A63B23/035—Exercising apparatus specially adapted for particular parts of the body for limbs, i.e. upper or lower limbs, e.g. simultaneously
- A63B23/12—Exercising apparatus specially adapted for particular parts of the body for limbs, i.e. upper or lower limbs, e.g. simultaneously for upper limbs or related muscles, e.g. chest, upper back or shoulder muscles
- A63B23/1245—Primarily by articulating the shoulder joint
- A63B23/1254—Rotation about an axis parallel to the longitudinal axis of the body, e.g. butterfly-type exercises
-
- A—HUMAN NECESSITIES
- A63—SPORTS; GAMES; AMUSEMENTS
- A63B—APPARATUS FOR PHYSICAL TRAINING, GYMNASTICS, SWIMMING, CLIMBING, OR FENCING; BALL GAMES; TRAINING EQUIPMENT
- A63B21/00—Exercising apparatus for developing or strengthening the muscles or joints of the body by working against a counterforce, with or without measuring devices
- A63B21/06—User-manipulated weights
- A63B21/062—User-manipulated weights including guide for vertical or non-vertical weights or array of weights to move against gravity forces
- A63B21/0626—User-manipulated weights including guide for vertical or non-vertical weights or array of weights to move against gravity forces with substantially vertical guiding means
- A63B21/0628—User-manipulated weights including guide for vertical or non-vertical weights or array of weights to move against gravity forces with substantially vertical guiding means for vertical array of weights
Landscapes
- Health & Medical Sciences (AREA)
- Orthopedic Medicine & Surgery (AREA)
- General Health & Medical Sciences (AREA)
- Physical Education & Sports Medicine (AREA)
- Life Sciences & Earth Sciences (AREA)
- Biophysics (AREA)
- Rehabilitation Tools (AREA)
Abstract
The present invention provides a kind of multiple location health and fitness facilities,Including seat cushion,Chest expanding arm and balance weight mechanism,Seat cushion lower end is provided with support base,Support base both sides are provided with longitudinal rotating shaft,Longitudinal rotating shaft upper end is connected with chest expanding arm lower end,Chest expanding arm upper end is provided with rocking arm,Transmission mechanism is provided between chest expanding arm and balance weight mechanism,Support base bottom is connected with bottom connecting shaft,Bottom connecting shaft lower end is connected with balance weight mechanism bottom,Seat cushion end is connected with backrest,Backrest upper end in the middle part of balance weight mechanism with being connected,Enhancing body resistance instrument base is provided with support base,Backrest upper end is provided with middle part connecting shaft,Effectively improve the overall stability of apparatus,And it is provided with balance weight mechanism,Adjustment of weight can effectively be carried out,It disclosure satisfy that needed for a wide range of user,The gearratio of transmission mechanism is high in apparatus,The good antiskid effect of rocking arm,The reliability of apparatus is high,Train on is good,It disclosure satisfy that used in family expenses and gymnasium.
Description
Technical field
The invention belongs to field of exercise, and in particular to a kind of multiple location health and fitness facilities.
Background technology
Body-building is a kind of universal motion, and body-building apparatus, is exactly the instrument required for this motion.The kind of health and fitness facilities
Class is much probably divided into：Rowing machine：It is mainly used to strengthen arm strength, latissimus dorsi and movement coordination ability；Body is suitable can fitness machine：
It is different from other physical training styles, user can different motor patterns and it is complete zero impact experience under, similar to going upstairs,
Walking, jog and freely changed between long-distance running.You can adjust your training mode to reach by this translative mode function immediately
To the target trained for specific muscle group；Elliptical machine：The movement locus of smooth flow and intersect gradient patented technology and allow use
Person is exercised one's muscles group with meeting the posture of biomethanics, adds the diversity and validity of exercise.The exercise of zero resistance is reduced
The generation of muscular strain；Exercycle：During exercise, as cycling, it is mainly used to strengthen leg power, strengthens cardiovascular work(
Energy；Marking vehicle：Mainly tempering leg, waist, abdominal muscles and cardio-pulmonary function；Treadmill：Mainly tempering leg, stern, waist, abdomen
Portion's muscle and cardio-pulmonary function；Beauty belt massage：Relaxing massage can be made to waist, back；Integrated multi device：Typically all include chest expanding
The function of the apparatuses such as device, chin-up, floor press, sit-ups.Chest expander, chin-up, floor press, are primarily used to
Temper upper limbs force and pectoralis major strength；Sit-ups, it is mainly used to temper psoas group, reduces waist and belly superabundant fats.
Such as, Chinese invention granted patent document, Authorization Notice No. is the B of CN 103272366 to prior art, and the invention is related to
A kind of chest expanding body-building device, including seat（11）, it is characterised in that：Seat（11）Both sides turn including a pair of actives being vertically arranged
Axle（5）, the pair of active rotating shaft（5）Respectively with a rocking arm（6）It is fixedly connected；The active rotating shaft（5）Pass through toothed type ratchet
Mechanism and driven spindle（3）It is rigidly connected, to the driven spindle（3）Carry out the transmission of chest expanding action single direction rotation；It is described from
Turn axle（3）With magnetic liquid torque-converters（2）Rotating disc（2b）Centre bore be fixedly connected, the rotating disc（2b）Upper and lower surface
Provided with magnetorheological liquid layer（2a）, the rotating disc（2b）With magnetorheological liquid layer（2a）Between sliding friction torque provide it is described from
Turn axle（3）Rotational resistance square；The driven spindle（3）Rotational resistance square with the magnetic liquid torque-converters（2）Magnetic field it is big
It is small change and change；The active rotating shaft（5）With reduction torsion spring（7）It is fixedly connected.But in actual applications, the body-building device is steady
Qualitative poor, the gearratio of power may not be high during use, therefore it need to be improved in terms of stability and gearratio is improved.
The content of the invention
The present invention provides that a kind of stability is good, reliability is high to solve above-mentioned technical problem, transmission efficiency and exercise is imitated
Fruit is good, uses a kind of good multiple location health and fitness facilities of body-sensing.
The present invention is for the scheme taken of solution above-mentioned technical problem：A kind of multiple location health and fitness facilities, including seat cushion, expansion
Chest arm and balance weight mechanism, seat cushion lower end are provided with support base, and support base both sides are provided with longitudinal rotating shaft, longitudinal rotating shaft upper end and chest expanding arm
Lower end connects, and chest expanding arm upper end is provided with rocking arm, transmission mechanism is provided between chest expanding arm and balance weight mechanism, and support base bottom is connected with
Bottom connecting shaft, bottom connecting shaft lower end are connected with balance weight mechanism bottom, and seat cushion end is connected with backrest, backrest upper end and balance weight mechanism
Middle part connects, and enhancing body resistance instrument base is provided with support base, and backrest upper end is provided with middle part connecting shaft, improves the overall stability of apparatus,
And balance weight mechanism is provided with, adjustment of weight can be effectively carried out, disclosure satisfy that needed for a wide range of user, the gearratio of transmission mechanism
Height, the good antiskid effect of rocking arm, it disclosure satisfy that used in family expenses and gymnasium.
Preferably, rocking arm includes holding area, strength bar and anti-slip ring, hold area and be located in the middle part of rocking arm, hold area surface
Semicircle salient point is furnished with, it is in bowing to hold area, and the bend angles alpha angle of arc is 130 ° ~ 147 °, and anti-slip ring, which is arranged at, holds area
Side, strength bar, which is arranged at, holds area lower end, and strength bar surface is furnished with circular hole, held in rocking arm area surface be furnished with it is semicircle convex
It point, can effectively increase the frictional force between hand and rocking arm, improve the reliability of holding, it is in bowing to hold area so that hold
Area extremely meets body mechanics when holding tight, and then arm strength is uniformly delivered on rocking arm, and the design not only reduces
Palm of the hand pressure, play the protection palm of the hand and avoid callous effect, can also make person taking exercise that there is optimal holding body-sensing, hold area one
The anti-slip ring that side is provided with, protective effect can be effectively played, prevent person taking exercise because hand pine and caused by rocking arm backswing hurt person taking exercise
Situation occur, strength bar surface is furnished with circular hole so that strength bar has certain flexibility in the case where intensity is constant, from
And rocking arm is born the load in exercise routine, and can is enough flexible, plays a part of protecting person taking exercise's both arms, again
The motion body-sensing of person taking exercise can be improved.
Preferably, rocking arm and chest expanding arm surface are provided with nonskid coating, nonskid coating is made up of following component and parts by weight：
Silica 5-12 parts, titanium dioxide 3-8 parts, water 80-120 parts, glue 56-98 parts, aziridines 5.3-8.7 parts, rocking arm and
Chest expanding arm surface is coated with non-skid coating, and nonskid coating is formed after drying process, and being added with for nonskid coating is shaken beneficial to raising
Arm and chest expanding arm non-skid property, increase the coefficient of friction of rocking arm and chest expanding arm, person taking exercise is avoided in exercise routine rubber sleeve, so as to carry
The high security performance of this apparatus.
Preferably, transmission mechanism, which includes ring-type, draws pin, power wheel, reel, steel wire rope, rear drive, ring-type draws pin
It is connected through chest expanding arm lower end with power wheel, for power wheel with being connected in the middle part of longitudinal rotating shaft, longitudinal rotating shaft bottom is provided with fix bar, Gu
Reel is connected with the outside of fixed pole, reel is engaged with power wheel gear, and reel is connected by steel wire rope with rear drive, after
Drive is arranged at the seat cushion back lower place, and drive is connected with balance weight mechanism after steel wire rope passes through, and transmission mechanism is by chest expanding arm and matches somebody with somebody
Power between heavy-duty machine structure is mutually transmitted, and is done by steel wire rope through connection, is made the stable transmission of power firm, steel wire rope passed through individual cunning
Wheel, avoids that the hollow length of steel wire rope is long, so as to ensure that driving force that steel wire rope can be stablized, and is not easy to shake, also protects
The maximum transmission ratio of transmission mechanism is demonstrate,proved, power wheel, reel and the installation of rear drive are stable and firm, rotate smoothness, improve
The transmission fluency of transmission mechanism.
Preferably, power wheel rim surface is provided with positioning hole, positioning holes center inwall is provided with groove, groove and ring-type
The bulge loop of pin lower surface is drawn to be nested for drawing and pulling type, it is 1.06 ~ 1.13 that positioning bore dia draws pin base diameter ratio with ring-type:
1, the positioning hole of power wheel surface is available for ring-type to draw pin plug, and ring-type draws pin to be inserted in through chest expanding arm in positioning hole, therefore adjustable
Ring-type draws the positioning hole that pin is inserted, and to adjust the initial position of chest expanding arm, the initial position of chest expanding arm is adjustable, is advantageous to person taking exercise
The most comfortable, most suitable arm motion stroke can be found, exercise routine is reached exercise purpose, and can protects both arms,
Avoid overexertion or because of the phenomenon that angle out of strength is uncomfortable and sprains, positioning bore dia and ring-type draw pin base diameter provided with than
Example, be advantageous in the case of both fix reliably, make ring-type draw pin plug more convenient, reduce the dynamics needed for adjusting.
Preferably, balance weight mechanism includes stile frame plate, counterweight shows meter, balancing weight latch, balancing weight, steel wire rope and guarantor
Shield, counterweight show that meter is arranged at side in the middle part of stile frame plate, and protective cover is arranged at stile frame plate upper end, and balancing weight is arranged at vertical
Frame plate bottom, balancing weight front side upper end are provided with balancing weight latch, steel wire rope, steel wire penetrating stile are connected with the top of balancing weight
It is connected at the top of frame plate with transmission mechanism.Weight that can be required for convenient regulation by balancing weight latch in balance weight mechanism, and can lead to
The convenient accurately reading of counterweight display meter is crossed, to set suitable weight during whole take exercise, balancing weight passes through steel
Cord takes drawing, makes balancing weight motion stabilization reliable, the security performance of this apparatus of the design raising of protective cover.
Preferably, be connected with cross bar in the middle part of support base leading portion, cross bar reverse side is provided with glove ring, the length of cross bar and
The distance ratio of left and right chest expanding arm is 0.91 ~ 0.97:1, cross bar can effectively prevent that body touches transmission mechanism in exercise routine, keeps away
Person taking exercise is exempted from and accidental injury situation has occurred, also transmission mechanism has been played a very good protection, and cross bar reverse side is provided with and put
Thing ring, the indispensable of person taking exercise's holding water cup, towel is available for, improves the utilization rate of this apparatus, also brought for person taking exercise
Convenient, the length of cross bar and the distance of left and right chest expanding arm are provided with ratio, are advantageous to prevent with cross bar to bump against when chest expanding arm rest from holding together, again
Can maximize the protection domain of cross bar.
Beneficial effects of the present invention are：1）The good antiskid effect of health and fitness facilities rocking arm of the present invention, greatly reduces person taking exercise
Situation of injuring unexpectedly；2）This apparatus has cross bar and protective cover, can effectively prevent that person taking exercise is injured, improves instrumentation safety
Property；3）The transmission mechanism transmission efficiency of this apparatus, transmission is smooth, ensure that the actual counterweight of person taking exercise, improves person taking exercise
Temper body-sensing；4）This apparatus balance weight mechanism stability is high, good reliability, conveniently adjusted counterweight, and can intuitively read and currently match somebody with somebody
Weight values, it is easy to person taking exercise to carry out regular exercise；5）The service life length of the present apparatus, train on is good, and it is convenient to take exercise, and can expire
It is enough to family expenses and gymnasium is used.
Present invention employs above-mentioned technical proposal to provide a kind of multiple location health and fitness facilities, compensate for the deficiencies in the prior art,
It is reasonable in design, it is easy to operate.
Brief description of the drawings
Fig. 1 is a kind of structural representation of multiple location health and fitness facilities of the present invention；
Fig. 2 is a kind of top view of multiple location health and fitness facilities of the present invention；
Fig. 3 is the structural representation that a kind of ring-type of multiple location health and fitness facilities of the present invention draws pin；
Fig. 4 is a kind of partial enlarged drawing at a positions of multiple location health and fitness facilities of the present invention；
Fig. 5 is a kind of sectional view of the power wheel of multiple location health and fitness facilities of the present invention；
Fig. 6 is a kind of structural representation of the rocking arm of multiple location health and fitness facilities of the present invention；
Fig. 7 is a kind of schematic diagram in the holding area of rocking arm of multiple location health and fitness facilities of the present invention.
Description of reference numerals：1 rocking arm；2 backrests；3 chest expanding arms；4 seat cushions；5 longitudinal rotating shafts；6 support bases；7 stile frame plates；8
Counterweight display meter；9 balancing weight latches；10 balancing weights；11 ring-types draw pin；12 reels；13 power wheels；14 bottom connecting shafts；In 15
Portion's connecting shaft；16 hold area；17 strength bars；18 anti-slip rings；19 steel wire ropes；20 protective covers；Drive after 21；22 cross bars；23 gloves
Ring；24 bulge loops；25 grooves.
Embodiment
It is described in further detail below in conjunction with drawings and examples：
Embodiment 1：
As shown in Fig. 1 ~ 7, a kind of multiple location health and fitness facilities, including seat cushion 4, chest expanding arm 3 and balance weight mechanism, the lower end of seat cushion 4 are provided with
Support base 6, the both sides of support base 6 are provided with longitudinal rotating shaft 5, and longitudinal upper end of rotating shaft 5 is connected with the lower end of chest expanding arm 3, and the upper end of chest expanding arm 3 is set
There is rocking arm 1, transmission mechanism is provided between chest expanding arm 3 and balance weight mechanism, the bottom of support base 6 is connected with bottom connecting shaft 14, and bottom connects
The lower end of axle 14 is connected with balance weight mechanism bottom, and the end of seat cushion 4 is connected with backrest 2, and the upper end of backrest 2 is connected with balance weight mechanism middle part,
Enhancing body resistance instrument base is provided with support base 6, and the upper end of backrest 2 is provided with middle part connecting shaft 15, can improve the overall stability of apparatus, and set
There is balance weight mechanism, can effectively carry out adjustment of weight, disclosure satisfy that needed for a wide range of user, the gearratio of transmission mechanism is high, shakes
The good antiskid effect of arm 1, it disclosure satisfy that used in family expenses and gymnasium.
Rocking arm 1 includes holding area 16, strength bar 17 and anti-slip ring 18, holds area 16 and is located at the middle part of rocking arm 1, holds the table of area 16
Face is furnished with semicircle salient point, and it is in bowing to hold area 16, and the bend angles alpha angle of arc is 139 °, and anti-slip ring 18 is arranged at holding
The side of area 16, strength bar 17, which is arranged at, holds the lower end of area 17, and the surface of strength bar 17 is furnished with circular hole, and the surface of area 16 is held in rocking arm 1
Semicircle salient point is furnished with, can effectively increase the frictional force between hand and rocking arm 1, improves the reliability of holding, it is in arc to hold area 16
Sigmoid so that 160 points of area of holding meets body mechanics when holding tight, and then makes arm strength uniformly be delivered to rocking arm 1
On, the design not only reduces palm of the hand pressure, plays the protection palm of the hand and avoids callous effect, person taking exercise can also had most preferably
Hold body-sensing, hold the anti-slip ring 18 that is provided with of the side of area 16, protective effect can be effectively played, prevent person taking exercise because hand pine and caused by
The situation that rocking arm backswing hurts person taking exercise occurs, and the surface of strength bar 17 is furnished with circular hole so that strength bar 17 is constant in intensity
In the case of there is certain flexibility so that rocking arm 1 can either bear the load in exercise routine, and can is enough flexible,
Play a part of protecting person taking exercise's both arms, the motion body-sensing of person taking exercise can be improved again.
Rocking arm 1 and the surface of chest expanding arm 3 are provided with nonskid coating, and nonskid coating is made up of following component and parts by weight：Titanium dioxide
7.5 parts of silicon, 4.9 parts of titanium dioxide, 86 parts of water, 78 parts of glue, 6.7 parts of aziridines, rocking arm 1 and the surface of chest expanding arm 3 are coated with
Non-skid coating, forms nonskid coating after drying process, and being added with for nonskid coating is anti-skidding beneficial to raising rocking arm 1 and chest expanding arm 3
Performance, increase the coefficient of friction of rocking arm 1 and chest expanding arm 3, person taking exercise is avoided in exercise routine rubber sleeve, so as to improve this apparatus
Security performance.
The preparation method of nonskid coating of the present invention is：By formula ratio, the solid in composition is first subjected to fine grinding, makes particle small
In 100 mesh, remaining composition and accelerator are added, is put into homogenizer, 24min is stirred under 65 DEG C of environment, produced anti-skidding
Coating, by rocking arm 1 and the surface derusting of chest expanding arm 3, deoil, drying process totally afterwards apply be covered with non-skid coating, by drying process
Obtain nonskid coating.
Accelerator is active peptides in above-mentioned preparation method, and the amino acid sequence of active peptides is：
HSHACASYYCSKHSHACKTACAKFCGTASCTHYLSCTHYVLHPGKLCACVNCSR, the addition of accelerator shorten coating
Preparation time, and each component can be mixed uniformly in preparation process, improve the performance of coating so that nonskid coating exists
Confficient of static friction is all higher than 0.8 in dry, wet, oily state, makes have excellent non-skid property, and there also have this corrosion-inhibiting coating to be very strong
Adhesive force and impact strength, the stability of molecule of coating is improved, enable nonskid coating for a long time effectively in rocking arm 1 and chest expanding
Play anti-skidding effect in the surface of arm 3.
Transmission mechanism includes ring-type and draws pin 11, power wheel 13, reel 12, steel wire rope 19, rear drive 21, and ring-type draws pin
11 are connected through the lower end of chest expanding arm 3 with power wheel 13, and power wheel 13 is connected with longitudinal middle part of rotating shaft 5, and longitudinal bottom of rotating shaft 5 is provided with
Fix bar, fix bar outside are connected with reel 12, and reel 12 engages with the gear of power wheel 13, and reel 12 passes through steel wire rope
19 are connected with rear drive 21, and rear drive 21 is arranged at the back lower place of seat cushion 4, drive 21 and counter weight machine after steel wire rope 19 passes through
Structure connects.Transmission mechanism mutually transmits the power between chest expanding arm 3 and balance weight mechanism, is done by steel wire rope 19 through connection, makes power
Stable transmission it is firm, steel wire rope 19 passed through individual pulley, and it is long to avoid 19 hollow length of steel wire rope, so as to ensure that steel wire
The driving force that rope 19 can be stablized, and be not easy to shake, it also ensure that the maximum transmission ratio of transmission mechanism, power wheel 12, reel
12 and rear drive 21 install stable and firm, rotate smooth, improve the transmission fluency of transmission mechanism.
The rim surface of power wheel 12 is provided with positioning hole, and positioning holes center inwall is provided with groove 25, and groove 25 is drawn with ring-type
The bulge loop 24 of the lower surface of pin 11 is nested for drawing and pulling type, and it is 1.08 that positioning bore dia draws the base diameter ratio of pin 11 with ring-type:
1, the positioning hole on the surface of power wheel 12 is available for ring-type to draw pin 11 to plug, and ring-type draws pin 11 to be inserted in through chest expanding arm 3 in positioning hole, therefore
Adjustable ring-type draws the positioning hole that pin 11 is inserted, and to adjust the initial position of chest expanding arm 3, the initial position of chest expanding arm 3 is adjustable, has
The most comfortable, most suitable arm motion stroke can be found beneficial to person taking exercise, exercise routine is reached exercise purpose, and can
Both arms are protected, avoid overexertion or because the phenomenon that angle out of strength is uncomfortable and sprains, positioning bore dia draw the bottom of pin 11 with ring-type
Diameter is provided with ratio, is advantageous in the case of both fix reliably, makes ring-type draw pin 11 to plug more convenient, reduces regulation institute
The dynamics needed.
Balance weight mechanism includes stile frame plate 7, counterweight display meter 8, balancing weight latch 9, balancing weight 10, steel wire rope 19 and protection
Cover 20, counterweight display meter 8 are arranged at the middle part side of stile frame plate 7, and protective cover 20 is arranged at the upper end of stile frame plate 7, balancing weight 10
The bottom of stile frame plate 7 is arranged at, the front side upper end of balancing weight 10 is provided with balancing weight latch 9, and the top of balancing weight 10 is connected with steel wire rope
19, steel wire rope 19 is connected through the top of stile frame plate 7 with transmission mechanism, convenient can be adjusted by balancing weight latch 9 in balance weight mechanism
Weight required for section, and can show that meter 8 is convenient by counterweight and accurately read, it is suitable to be set during whole take exercise
The weight of conjunction, balancing weight 10 take drawing by steel wire rope 19, make the motion stabilization of balancing weight 10 reliable, the design raising of protective cover 20
The security performance of this apparatus.
Be connected with cross bar 22 in the middle part of the leading portion of support base 6, the reverse side of cross bar 22 is provided with glove ring 23, the length of cross bar 22 and
The distance ratio of left and right chest expanding arm 3 is 0.95:1, cross bar 22 can effectively prevent that body touches transmission mechanism in exercise routine, avoids
There is accidental injury situation in person taking exercise, and also transmission mechanism is played a very good protection, and cross bar 22 reverse side is provided with and put
Thing ring 23, the indispensable of person taking exercise's holding water cup, towel is available for, improves the utilization rate of this apparatus, also brought for person taking exercise
Facility, the length of cross bar 22 and the distance of left and right chest expanding arm 3 are provided with ratio, are advantageous to prevent when chest expanding arm 3 from drawing close and cross bar
22 bump against, and and can maximizes the protection domain of cross bar 22.
Embodiment 2：
As shown in Fig. 1 ~ 7, a kind of multiple location health and fitness facilities, in actual use, first adjust balancing weight latch 9 to counterweight and show meter
The balance weight that 8 display anticipations are taken exercise, it is rear to transfer to ring-type to draw pin 11, the initial position of adjustment chest expanding arm 3, to reach the most comfortable
Arm motion curve, after by ring-type drawing pin 11 insert in 13 outer annular distance of power wheel, chest expanding arm 3 is connected with power wheel 13, adjustment
After, person taking exercise is seated on seat cushion 4, and back is against backrest 2 vertically, and both hands stretch the holding area 16 for holding rocking arm 1, person taking exercise
Firmly chest expanding arm 3 is deployed toward both sides, the motion of chest expanding arm 3, drives power wheel 13 to rotate, and then causes reel 12 to steel wire
Rope 19 carries out coiling action, and steel wire rope 19, which moves, causes rear drive 21 to rotate, the motion through the steel wire rope of drive 21 later
Drive the steel wire rope in stile frame plate 7 up to move so that corresponding balancing weight 10 has been pulled upwardly, now the both arms of person taking exercise to
Both sides are in maximum open configuration, and person taking exercise slightly reduces arm strength, because the self gravitation effect of balancing weight 10, balancing weight 10 are downward
Mobile, now steel wire rope 19 carries out reverse restoring action because of moving down for balancing weight 10, so as to drive power wheel 13 to return to just
Beginning position, chest expanding arm 3 also recovers initially to draw close state, in recovery process, because steel wire rope 19 is by many places power transmission, therefore
Speed is suitable for the intercept speed of human arm during recovery, both arms will not be caused to pull, and it is in draw close shape forward now to temper both arms
State, chest expanding training is completed, after repeatedly reciprocal, you can reach both arms, chest and abdomen and the exercise at back, complete to leave seat after taking exercise
Pad makes this apparatus keep nature.
It is in bowing to hold area 16, and the bend angles alpha angle of arc is not limited only to 130 ° ~ 147 °, should also including 130 ° or
130.1 ° or 130.2 ° or 130.3 ° or 130.4 ° ... or 146.9 ° or 147 °.
Positioning bore dia draws the base diameter ratio of pin 11 to be not limited only to 1.06 ~ 1.13 with ring-type:1, it should also include 1.06:1 or
1.061:1 or 1.062:1 or 1.063:1 or 1.064:1 ... or 1.129:1 or 1.13:1.
The length of cross bar 22 is not limited only to 0.91 ~ 0.97 with the distance ratio of left and right chest expanding arm 3:1, it should also include 0.91:1 or
0.911:1 or 0.912:1 or 0.913:1 or 0.914:1 ... or 0.969:1 or 0.97:1.
Routine techniques connection or the prior art of prior art dawn known to those skilled in the art in above-described embodiment,
Therefore it is not described in detail herein.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, it can also make a variety of changes and modification.Therefore, it is all equivalent
Technical scheme fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
SEQUENCE LISTING
<110>Zhoushan Putuo branch company of Ling Shang developments of gym Co., Ltd
<120>A kind of multiple location health and fitness facilities
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 54
<212> PRT
<213>It is artificial synthesized
<400> 1
His Ser His Ala Cys Ala Ser Tyr Tyr Cys Ser Lys His Ser His Ala
1 5 10 15
Cys Lys Thr Ala Cys Ala Lys Phe Cys Gly Thr Ala Ser Cys Thr His
20 25 30
Tyr Leu Ser Cys Thr His Tyr Val Leu His Pro Gly Lys Leu Cys Ala
35 40 45
Cys Val Asn Cys Ser Arg
50
Claims (7)
1. a kind of multiple location health and fitness facilities, including seat cushion（4）, chest expanding arm（3）And balance weight mechanism, it is characterised in that the seat cushion
（4）Lower end is provided with support base（6）, the support base（6）Both sides are provided with longitudinal rotating shaft（5）, longitudinal rotating shaft（5）Upper end is with expanding
Chest arm（3）Lower end connects, the chest expanding arm（3）Upper end is provided with rocking arm（1）, the chest expanding arm（3）It is provided between balance weight mechanism
Transmission mechanism, the support base（6）Bottom is connected with bottom connecting shaft（14）, the bottom connecting shaft（14）Lower end and balance weight mechanism bottom
Portion connects, the seat cushion（4）End is connected with backrest（2）, the backrest（2）Upper end in the middle part of balance weight mechanism with being connected.
A kind of 2. multiple location health and fitness facilities according to claim 1, it is characterised in that the rocking arm（1）Including holding area
（16）, strength bar（17）And anti-slip ring（18）, the holding area（16）Positioned at rocking arm（1）Middle part, the holding area（16）Surface
It is furnished with semicircle salient point, the holding area（16）In bowing, the bend angles alpha angle of the arc is 130 ° ~ 147 °, described anti-
Slip ring（18）It is arranged at and holds area（16）Side, the strength bar（17）It is arranged at and holds area（17）Lower end, the strength bar
（17）Surface is furnished with circular hole.
A kind of 3. multiple location health and fitness facilities according to claim 1, it is characterised in that the rocking arm（1）With chest expanding arm（3）
Surface is provided with nonskid coating, and the nonskid coating is made up of following component and parts by weight：Silica 5-12 parts, titanium dioxide 3-
8 parts, water 80-120 parts, glue 56-98 parts, aziridines 5.3-8.7 parts.
4. a kind of multiple location health and fitness facilities according to claim 1, it is characterised in that the transmission mechanism is drawn including ring-type
Pin（11）, power wheel（13）, reel（12）, steel wire rope（19）, rear drive（21）, the ring-type drawing pin（11）Through chest expanding
Arm（3）Lower end and power wheel（13）Connection, the power wheel（13）With longitudinal rotating shaft（5）Middle part connects, longitudinal rotating shaft（5）
Bottom is provided with fix bar, and reel is connected with the outside of the fix bar（12）, the reel（12）With power wheel（13）Gear
Engagement, the reel（12）Pass through steel wire rope（19）With rear drive（21）Connection, the rear drive（21）It is arranged at seat
Pad（4）The back lower place, the steel wire rope（19）Through drive later（21）It is connected with balance weight mechanism.
A kind of 5. multiple location health and fitness facilities according to claim 4, it is characterised in that the power wheel（12）Rim surface
Provided with positioning hole, the positioning holes center inwall is provided with groove（25）, the groove（25）Pin is drawn with ring-type（11）Bottom table
The bulge loop in face（24）It is nested for drawing and pulling type, the positioning bore dia draws pin with ring-type（11）Base diameter ratio be 1.06 ~
1.13:1。
6. a kind of multiple location health and fitness facilities according to claim 1, it is characterised in that the balance weight mechanism includes vertical frame
Plate（7）, counterweight display meter（8）, balancing weight latch（9）, balancing weight（10）, steel wire rope（19）And protective cover（20）, the counterweight
Display meter（8）It is arranged at stile frame plate（7）Middle part side, the protective cover（20）It is arranged at stile frame plate（7）Upper end, it is described to match somebody with somebody
Pouring weight（10）It is arranged at stile frame plate（7）Bottom, the balancing weight（10）Front side upper end is provided with balancing weight latch（9）, it is described to match somebody with somebody
Pouring weight（10）Top is connected with steel wire rope（19）, the steel wire rope（19）Through stile frame plate（7）Top is connected with transmission mechanism.
A kind of 7. multiple location health and fitness facilities according to claim 1, it is characterised in that the support base（6）In the middle part of leading portion
It is connected with cross bar（22）, the cross bar（22）Reverse side is provided with glove ring（23）, the cross bar（22）Length with left and right expand
Chest arm（3）Distance ratio be 0.91 ~ 0.97:1.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710609450.4A CN107441680A (en) | 2017-07-25 | 2017-07-25 | A kind of multiple location health and fitness facilities |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710609450.4A CN107441680A (en) | 2017-07-25 | 2017-07-25 | A kind of multiple location health and fitness facilities |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107441680A true CN107441680A (en) | 2017-12-08 |
Family
ID=60488054
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710609450.4A Pending CN107441680A (en) | 2017-07-25 | 2017-07-25 | A kind of multiple location health and fitness facilities |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107441680A (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114457649A (en) * | 2022-02-22 | 2022-05-10 | 苏亮 | Rolling device for road construction |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN103550913A (en) * | 2013-10-31 | 2014-02-05 | 张广舜 | Body building wrist force exerciser |
| CN105435425A (en) * | 2015-12-30 | 2016-03-30 | 布和 | Multi-functional portable body builder |
| CN205516172U (en) * | 2016-01-19 | 2016-08-31 | 武汉百利恒运动用品有限公司 | Chest muscle training ware |
-
2017
- 2017-07-25 CN CN201710609450.4A patent/CN107441680A/en active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN103550913A (en) * | 2013-10-31 | 2014-02-05 | 张广舜 | Body building wrist force exerciser |
| CN105435425A (en) * | 2015-12-30 | 2016-03-30 | 布和 | Multi-functional portable body builder |
| CN205516172U (en) * | 2016-01-19 | 2016-08-31 | 武汉百利恒运动用品有限公司 | Chest muscle training ware |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114457649A (en) * | 2022-02-22 | 2022-05-10 | 苏亮 | Rolling device for road construction |
| CN114457649B (en) * | 2022-02-22 | 2023-09-08 | 日照市岚山区市政工程有限公司 | Rolling device for road construction |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8702574B2 (en) | Method and system for performing linear and circular movement patterns | |
| US5468205A (en) | Portable door mounted exercise apparatus | |
| US7585263B2 (en) | Abdominal exercise machine | |
| US20140194260A1 (en) | Method of Using an Exercise Device Having an Adjustable Incline | |
| US11148001B2 (en) | Exercise system | |
| US20100204020A1 (en) | Exercise Device | |
| US20120190514A1 (en) | Exercise system using exercise resistance cables | |
| US20140194265A1 (en) | Dual-Mode Pushup Exercise Device | |
| JPS61502801A (en) | Resistance adjustable inertia exercise equipment | |
| US20050187080A1 (en) | Exercise system using exercise resistance cables | |
| US11590386B2 (en) | Exercise system and method | |
| US20120184414A1 (en) | Exercise ball | |
| CN109289154A (en) | A kind of rotating disc type chest expander | |
| CN107441680A (en) | A kind of multiple location health and fitness facilities | |
| US20230191183A1 (en) | Fitness and rehabilitation aid | |
| CN209422837U (en) | A kind of rotating disc type chest expander | |
| EP2892622B1 (en) | Gym machine for dip exercises and twist workout | |
| CN205699150U (en) | Slidingtype health and fitness facilities | |
| US6517469B1 (en) | Exercising device for conditioning the body | |
| CN115006784A (en) | High-tension dorsal muscle trainer based on physical education | |
| US20230347204A1 (en) | Hand grip exercise machine | |
| US20140141941A1 (en) | Rowing machine | |
| CN221045401U (en) | Push rod equipment for body building | |
| US20240001188A1 (en) | Methods and kits for portable, low impact resistance exercising | |
| CN207575660U (en) | A kind of multigym |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20171208 |