CN107266550A - A kind of fish soluble slurry protein powder - Google Patents
A kind of fish soluble slurry protein powder Download PDFInfo
- Publication number
- CN107266550A CN107266550A CN201710562859.5A CN201710562859A CN107266550A CN 107266550 A CN107266550 A CN 107266550A CN 201710562859 A CN201710562859 A CN 201710562859A CN 107266550 A CN107266550 A CN 107266550A
- Authority
- CN
- China
- Prior art keywords
- fish
- protein powder
- protein
- parts
- preparation
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K10/00—Animal feeding-stuffs
- A23K10/20—Animal feeding-stuffs from material of animal origin
- A23K10/22—Animal feeding-stuffs from material of animal origin from fish
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/142—Amino acids; Derivatives thereof
- A23K20/147—Polymeric derivatives, e.g. peptides or proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/461—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/06—Preparation of peptides or proteins produced by the hydrolysis of a peptide bond, e.g. hydrolysate products
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Zoology (AREA)
- Health & Medical Sciences (AREA)
- Polymers & Plastics (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Food Science & Technology (AREA)
- Genetics & Genomics (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Animal Husbandry (AREA)
- Wood Science & Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Toxicology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- Microbiology (AREA)
- Marine Sciences & Fisheries (AREA)
- Biophysics (AREA)
- Physiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The invention discloses a kind of fish soluble slurry protein powder, contain the active peptides that amino acid sequence is HSHACKLCVCVNCFCCGAKCYLCRVLHPGKLCVCVNCSK.Have the beneficial effect that：The present invention, for raw material, both protects environment with the molten slurry of fish, and has carried out reasonable utilization to resource, adds the added value of the molten slurry of fish；Albumen powder prepared by the present invention, molecular weight is small, no fishy smell, and purity of protein and activity are high, and product quality is excellent；Deodorant liquid of the present invention can both reach the effect of deodorization, moreover it is possible to suppress protein oxidation, and albumen powder product is remained no fishy smell state within the shelf-life with the fishy smell substance reaction that has been produced in protein；Infrared ray temperature control is used during present invention enzymolysis, the production cycle is greatly shortened, time cost and human cost is reduced, processing method is simple, and reappearance is high, is adapted to large-scale production.
Description
Technical field
The present invention relates to food processing technology field, specifically a kind of fish soluble slurry protein powder.
Background technology
The molten slurry of fish is the squeezing waste water produced in fish meal production process.In early stage fish meal production process, the molten slurry of fish is logical
It is often not recovered directly to be discharged into environment, cause serious environmental pollution.Containing abundant high-quality protein in the molten slurry of fish, according to
P.J.BECHTEL, Univ.of Alaska report that the molten slurry of fish contains albumen 6%, and papain digestion rate is more than 95%, solubility
Albumen accounts for 70%, and the molten slurry albumen of the fish after being reclaimed using proper method can be used for feed industry, the raw material as animal feed.
In recent years, the existing more research of method recycled about the molten slurry of fish, such as adds fish molten slurry and (Chinese patent is dried in fish meal
CN200710030735.9), or after de-oiling, the processing of unsticking polysaccharide it is dried to fish soluble slurry protein powder (Chinese patent
CN200710120346.5) etc.., can be molten by fish because the molten slurry of fish is containing the soluble protein and free amino acid in Fish tissue
Slurry is processed into albumen powder.But protein molecular weight is larger in the molten slurry of fish, and there is stronger fishy odor, it is necessary to resolve into small molecule
Albumen and deodorization.
Prior art such as Authorization Notice No. utilizes marine collagen egg for the B of CN 102994601 Chinese invention patent one kind
The method that white enzyme MCP-01 prepares collagen protein powder, comprises the following steps：（1）Marine collagen protease MCP-01 is dissolved in
In Tris-HCl buffer solutions, the enzyme liquid that enzyme concentration is 0.3~0.5mg/mL is made into；（2）Can not colloidal sol by ox tendon I types
Former albumen is added in enzyme liquid, is reacted in water-bath, under the conditions of 4 DEG C, and collagen protein powder is made in ultrafiltration after centrifugation.This method
The collagen protein powder molecular weight of production is small but bioactivity of small peptide is not strong, and feature is weaker.
The content of the invention
It is an object of the invention to provide it is a kind of can obtain molecular weight it is small, without fishy smell, the molten slurry production albumen of the high fish of activity
Powder.
The present invention is directed to the problem of being mentioned in background technology, and the technical scheme taken is：A kind of fish soluble slurry protein powder, contains
Amino acid sequence is HSHACKLCVCVNCFCCGAKCYLCRVLHPGKLCVCVNCSK active peptides.
A kind of preparation method of fish soluble slurry protein powder, comprises the following steps：
Degreasing：Organic solvent is added in the molten slurry of fish, using soxhlet extraction degreasing, organic solvent is that acetone and ethanol are mixed
Thing, volume ratio is 1:1 ~ 3, the molten slurry of fish and organic solvent volume ratio are 1:2~3.Reaction temperature be 70 ~ 85 DEG C, the reaction time be 2 ~
3h, is repeated 2 ~ 4 times.Using similar compatibility principle, there be lipolyse while protein is not dissolved in the molten slurry of fish in organic solvent
Machine solvent, fat distills with organic solvent, is come with Separation of Proteins, obtains the molten slurry of the fish after degreasing；
Stepwise discretization：Pepsin is added in the molten slurry of fish, using infrared ray temperature control, is digested, pepsin addition 0.6 ~
1.4%, pH are 2.0 ~ 3.5, and hydrolysis temperature is 37 ~ 39 DEG C, and enzymolysis time is 10 ~ 15min.Digest in the enzyme that gone out after terminating, the molten slurry of fish
Protein there is the restriction enzyme sites of a large amount of pepsins, pepsin is to its enzymolysis efficiency is high and obtains protein molecule
Amount is small, is easily digested.Papain enzymolysis are added after regulation pH, using infrared ray temperature control, Papain
Enzyme addition is that 0.2 ~ 0.4%, pH is 6.0 ~ 7.0, and temperature is 50 ~ 55 DEG C, and enzymolysis time is 4 ~ 7min.After pepsin digestion
Protein expose the restriction enzyme sites of many papains, papain continues to digest to above-mentioned protein, further
Reduce the molecular weight of protein.Boiling water bath goes out 3 ~ 7min of enzyme, filters to take filtrate；
Deodorant：Deodorant liquid is added in filtrate, deodorant liquid composition and its parts by weight are：10 ~ 15 parts of sodium chloride, sodium acid carbonate 8 ~ 12
Part, 10 ~ 18 parts of purple perilla water, 6 ~ 10 parts of citric acid, 6 ~ 10 parts of lactic acid, 0.02 ~ 0.05 part of ethyl propionate, MENTHOL 0.1 ~ 0.3
80 ~ 100 parts of part and water.Stir, stand.In minced fillet fishy smell composition mainly degraded by TMAO, fat oxidation, sulfur-bearing
The approach such as nitrogen precursor material conversion are produced.Above-mentioned deodorant liquid can both reach with the fishy smell substance reaction that has been produced in protein
The effect of raw meat, moreover it is possible to suppress protein oxidation, makes albumen powder product remain no fishy smell state within the shelf-life.Ethyl propionate and
MENTHOL can promote other compositions and the reaction of fishy smell material in deodorant liquid, and can effectively cover fishy smell；
Ultrafiltration：By the filtrate ultrafiltration after deodorization, milipore filter specification is 1 ~ 2kDa, takes filtered solution.Molecular weight can remove by ultrafiltration
Big impurity, is purified to Fish protein, improves product quality；
Desalination：By filtered solution by ion exchange resin desalination, desalting liquids are obtained；
Spray drying：Desalting liquids spray drying is obtained into albumen powder product.It is containing amino acid sequence in albumen powder
HSHACKLCVCVNCFCCGAKCYLCRVLHPGKLCVCVNCSK active peptides.Above-mentioned active peptides can be by the oil in blood
Fat is wrapped up, and is excluded external, reduction blood viscosity, increases the mobility of blood.
Compared with prior art, the advantage of the invention is that：1）The present invention, for raw material, both protects environment with the molten slurry of fish,
Reasonable utilization has been carried out to resource again, the added value of the molten slurry of fish is added；2）Albumen powder prepared by the present invention, molecular weight is small, nothing
Fishy smell, purity of protein and activity are high, and product quality is excellent, is containing amino acid sequence in albumen powder
HSHACKLCVCVNCFCCGAKCYLCRVLHPGKLCVCVNCSK active peptides.Above-mentioned active peptides can be by the oil in blood
Fat is wrapped up, and is excluded external, reduction blood viscosity, increases the mobility of blood；3）Deodorant liquid of the present invention both can be with albumen
The fishy smell substance reaction produced in matter, reaches the effect of deodorization, moreover it is possible to suppress protein oxidation, makes albumen powder product in the shelf-life
Inside remain no fishy smell state；4）Use infrared ray temperature control during present invention enzymolysis, greatly shorten the production cycle, reduce the time into
This and human cost, processing method are simple, and reappearance is high, are adapted to large-scale production.
Specific embodiment
The present invention program is described further below by embodiment：
Embodiment 1：
A kind of fish soluble slurry protein powder, is HSHACKLCVCVNCFCCGAKCYLCRVLHPGKLCVCVNCSK containing amino acid sequence
Active peptides.
A kind of preparation method of fish soluble slurry protein powder, comprises the following steps：
1）Degreasing：Organic solvent is added in the molten slurry of fish, using soxhlet extraction degreasing, organic solvent is that acetone and ethanol are mixed
Thing, volume ratio is 1:1 ~ 3, the molten slurry of fish and organic solvent volume ratio are 1:2~3.Reaction temperature be 70 ~ 85 DEG C, the reaction time be 2 ~
3h, is repeated 2 ~ 4 times.Using similar compatibility principle, there be lipolyse while protein is not dissolved in the molten slurry of fish in organic solvent
Machine solvent, fat distills with organic solvent, is come with Separation of Proteins, obtains the molten slurry of the fish after degreasing；
2）Stepwise discretization：Pepsin is added in the molten slurry of fish, using infrared ray temperature control, is digested, pepsin addition 0.6 ~
1.4%, pH are 2.0 ~ 3.5, and hydrolysis temperature is 37 ~ 39 DEG C, and enzymolysis time is 10 ~ 15min.Digest in the enzyme that gone out after terminating, the molten slurry of fish
Protein there is the restriction enzyme sites of a large amount of pepsins, pepsin is to its enzymolysis efficiency is high and obtains protein molecule
Amount is small, is easily digested.Papain enzymolysis are added after regulation pH, using infrared ray temperature control, Papain
Enzyme addition is that 0.2 ~ 0.4%, pH is 6.0 ~ 7.0, and temperature is 50 ~ 55 DEG C, and enzymolysis time is 4 ~ 7min.After pepsin digestion
Protein expose the restriction enzyme sites of many papains, papain continues to digest to above-mentioned protein, further
Reduce the molecular weight of protein.Boiling water bath goes out 3 ~ 7min of enzyme, filters to take filtrate；
3）Deodorant：Deodorant liquid is added in filtrate, deodorant liquid composition and its parts by weight are：10 ~ 15 parts of sodium chloride, sodium acid carbonate 8 ~
12 parts, 10 ~ 18 parts of purple perilla water, 6 ~ 10 parts of citric acid, 6 ~ 10 parts of lactic acid, 0.02 ~ 0.05 part of ethyl propionate, MENTHOL 0.1 ~
0.3 part and 80 ~ 100 parts of water.Stir, stand.In minced fillet fishy smell composition mainly degraded by TMAO, fat oxidation,
The approach such as sulfur-bearing nitrogen precursor material conversion are produced.Above-mentioned deodorant liquid can both reach with the fishy smell substance reaction that has been produced in protein
To the effect of deodorization, moreover it is possible to suppress protein oxidation, albumen powder product is set to remain no fishy smell state within the shelf-life.Propionic acid second
Ester and MENTHOL can promote other compositions and the reaction of fishy smell material in deodorant liquid, and can effectively cover fishy smell；
4）Ultrafiltration：By the filtrate ultrafiltration after deodorization, milipore filter specification is 1 ~ 2kDa, takes filtered solution.Molecule can remove by ultrafiltration
The big impurity of amount, is purified to Fish protein, improves product quality；
5）Desalination：By filtered solution by ion exchange resin desalination, desalting liquids are obtained；
6）Spray drying：Desalting liquids spray drying is obtained into albumen powder product.It is containing amino acid sequence in albumen powder
HSHACKLCVCVNCFCCGAKCYLCRVLHPGKLCVCVNCSK active peptides.Above-mentioned active peptides can be by the oil in blood
Fat is wrapped up, and is excluded external, reduction blood viscosity, increases the mobility of blood.
Embodiment 2：
A kind of fish soluble slurry protein powder, is HSHACKLCVCVNCFCCGAKCYLCRVLHPGKLCVCVNCSK containing amino acid sequence
Active peptides.
A kind of preparation method of fish soluble slurry protein powder, comprises the following steps：
1）Degreasing：Organic solvent is added in the molten slurry of fish, using soxhlet extraction degreasing, organic solvent is that acetone and ethanol are mixed
Thing, volume ratio is 1:2, the molten slurry of fish and organic solvent volume ratio are 1:2.4.Reaction temperature is 76 DEG C, and the reaction time is 2.6h, weight
It is multiple 2 times.Using similar compatibility principle, lipolyse is in organic solvent in the molten slurry of fish, while protein does not dissolve in organic solvent,
Fat distills with organic solvent, is come with Separation of Proteins, obtains the molten slurry of the fish after degreasing；
2）Stepwise discretization：Pepsin is added in the molten slurry of fish, using infrared ray temperature control, is digested, pepsin addition 1.2%,
PH is 2.0, and hydrolysis temperature is 38 DEG C, and enzymolysis time is 12min.The protein digested in the enzyme that gone out after terminating, the molten slurry of fish is present greatly
Measure the restriction enzyme site of pepsin, pepsin is high to its enzymolysis efficiency and protein molecular weight that obtain is small, easily by people
Body is digested and assimilated.Papain enzymolysis are added after regulation pH, using infrared ray temperature control, papain addition is
0.3%, pH are 6.5, and temperature is 53 DEG C, and enzymolysis time is 6min.Protein after pepsin digestion exposes many pawpaw eggs
The restriction enzyme site of white enzyme, papain continues to digest to above-mentioned protein, further reduces the molecular weight of protein.Boiling water bath
Go out enzyme 3min, filters to take filtrate；
3）Deodorant：Deodorant liquid is added in filtrate, deodorant liquid composition and its parts by weight are：13 parts of sodium chloride, 10 parts of sodium acid carbonate,
90 parts of 16 parts of purple perilla water, 7 parts of citric acid, 7 parts of lactic acid, 0.04 part of ethyl propionate, 0.2 part of MENTHOL and water.Stir, it is quiet
Put.In minced fillet fishy smell composition mainly degraded by TMAO, fat oxidation, sulfur-bearing nitrogen precursor material conversion etc. approach produce.
Above-mentioned deodorant liquid both can reach the effect of deodorization, moreover it is possible to suppress protein oxidation with the fishy smell substance reaction that has been produced in protein,
Albumen powder product is set to remain no fishy smell state within the shelf-life.Ethyl propionate and MENTHOL can promote other in deodorant liquid
The reaction of composition and fishy smell material, and can effectively cover fishy smell；
4）Ultrafiltration：By the filtrate ultrafiltration after deodorization, milipore filter specification is 1.5kDa, takes filtered solution.Molecule can remove by ultrafiltration
The big impurity of amount, is purified to Fish protein, improves product quality；
5）Desalination：By filtered solution by ion exchange resin desalination, desalting liquids are obtained；
6）Spray drying：Desalting liquids spray drying is obtained into albumen powder product.It is containing amino acid sequence in albumen powder
HSHACKLCVCVNCFCCGAKCYLCRVLHPGKLCVCVNCSK active peptides.Above-mentioned active peptides can be by the oil in blood
Fat is wrapped up, and is excluded external, reduction blood viscosity, increases the mobility of blood.
Embodiment 3：
A kind of fish soluble slurry protein powder, is HSHACKLCVCVNCFCCGAKCYLCRVLHPGKLCVCVNCSK containing amino acid sequence
Active peptides.
A kind of preparation method of fish soluble slurry protein powder, comprises the following steps：
1）Degreasing：Organic solvent is added in the molten slurry of fish, using soxhlet extraction degreasing, organic solvent is that acetone and ethanol are mixed
Thing, volume ratio is 1:1.5, the molten slurry of fish and organic solvent volume ratio are 1:2.7.Reaction temperature is 75 DEG C, and the reaction time is 2.3h,
It is repeated 3 times.Using similar compatibility principle, lipolyse is in organic solvent in the molten slurry of fish, while protein is insoluble in organic molten
Agent, fat distills with organic solvent, is come with Separation of Proteins, obtains the molten slurry of the fish after degreasing；
2）Stepwise discretization：Pepsin is added in the molten slurry of fish, using infrared ray temperature control, enzymolysis, pepsin addition 1%, pH
For 2.0, hydrolysis temperature is 38 DEG C, and enzymolysis time is 13min.The protein digested in the enzyme that gone out after terminating, the molten slurry of fish is present largely
The restriction enzyme site of pepsin, pepsin is high to its enzymolysis efficiency and protein molecular weight that obtain is small, easily by human body
Digest and assimilate.Papain enzymolysis are added after regulation pH, using infrared ray temperature control, papain addition is 0.3%,
PH is 6.5, and temperature is 53 DEG C, and enzymolysis time is 6min.Protein after pepsin digestion exposes many papains
Restriction enzyme site, papain to above-mentioned protein continue digest, further reduce protein molecular weight.Boiling water bath goes out enzyme
4min, filters to take filtrate；
3）Deodorant：Deodorant liquid is added in filtrate, deodorant liquid composition and its parts by weight are：14 parts of sodium chloride, 10 parts of sodium acid carbonate,
90 parts of 14 parts of purple perilla water, 8 parts of citric acid, 8 parts of lactic acid, 0.04 part of ethyl propionate, 0.2 part of MENTHOL and water.Stir, it is quiet
Put.In minced fillet fishy smell composition mainly degraded by TMAO, fat oxidation, sulfur-bearing nitrogen precursor material conversion etc. approach produce.
Above-mentioned deodorant liquid both can reach the effect of deodorization, moreover it is possible to suppress protein oxidation with the fishy smell substance reaction that has been produced in protein,
Albumen powder product is set to remain no fishy smell state within the shelf-life.Ethyl propionate and MENTHOL can promote other in deodorant liquid
The reaction of composition and fishy smell material, and can effectively cover fishy smell；
4）Ultrafiltration：By the filtrate ultrafiltration after deodorization, milipore filter specification is 1.3kDa, takes filtered solution.Molecule can remove by ultrafiltration
The big impurity of amount, is purified to Fish protein, improves product quality；
5）Desalination：By filtered solution by ion exchange resin desalination, desalting liquids are obtained；
6）Spray drying：Desalting liquids spray drying is obtained into albumen powder product.It is containing amino acid sequence in albumen powder
HSHACKLCVCVNCFCCGAKCYLCRVLHPGKLCVCVNCSK active peptides.Above-mentioned active peptides can be by the oil in blood
Fat is wrapped up, and is excluded external, reduction blood viscosity, increases the mobility of blood.
Routine operation in the operating procedure of the present invention is well known to those skilled in the art, herein without repeating.
Technical scheme is described in detail embodiment described above, it should be understood that it is described above only
For the specific embodiment of the present invention, it is not intended to limit the invention, all any modifications made in the spirit of the present invention,
Supplement or similar fashion replacement etc., should be included in the scope of the protection.
SEQUENCE LISTING
<110>Zhejiang Feng Yu marine organisms Products Co., Ltd
<120>A kind of fish soluble slurry protein powder
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 39
<212> PRT
<213>It is artificial synthesized
<400> 1
His Ser His Ala Cys Lys Leu Cys Val Cys Val Asn Cys Phe Cys Cys
1 5 10 15
Gly Ala Lys Cys Tyr Leu Cys Arg Val Leu His Pro Gly Lys Leu Cys
20 25 30
Val Cys Val Asn Cys Ser Lys
35
Claims (10)
1. a kind of fish soluble slurry protein powder, it is characterised in that：Described albumen powder contains amino acid sequence
HSHACKLCVCVNCFCCGAKCYLCRVLHPGKLCVCVNCSK active peptides.
2. a kind of fish soluble slurry protein powder according to claim 1, it is characterised in that：The preparation method bag of described albumen powder
Include degreasing, distribution enzymolysis, deodorant, ultrafiltration, desalination and spray drying.
3. a kind of preparation method of fish soluble slurry protein powder according to claim 2, it is characterised in that：Described defatting step
To add organic solvent in the molten slurry of fish, using soxhlet extraction degreasing, reaction temperature is 70 ~ 85 DEG C, and the reaction time is 2 ~ 3h,
Repeat 2 ~ 4 times, obtain the molten slurry of the fish after degreasing；Organic solvent is acetone and alcohol mixture, and volume ratio is 1:1 ~ 3, the molten slurry of fish
It is 1 with organic solvent volume ratio:2~3.
4. a kind of preparation method of fish soluble slurry protein powder according to claim 2, it is characterised in that：Described stepwise discretization
Step is adds pepsin in the molten slurry of fish, and using infrared ray temperature control, enzymolysis adds again after digesting the enzyme that gone out after terminating, regulation pH
Enter papain enzymolysis, using infrared ray temperature control, go out enzyme, filters to take filtrate.
5. a kind of preparation method of fish soluble slurry protein powder according to claim 2, it is characterised in that：Described deodorant step
To add deodorant liquid in filtrate, stir, stand；Deodorant liquid composition and its parts by weight are：10 ~ 15 parts of sodium chloride, carbonic acid
8 ~ 12 parts of hydrogen sodium, 10 ~ 18 parts of purple perilla water, 6 ~ 10 parts of citric acid, 6 ~ 10 parts of lactic acid, 0.02 ~ 0.05 part of ethyl propionate, MENTHOL
0.1 ~ 0.3 part and 80 ~ 100 parts of water.
6. a kind of preparation method of fish soluble slurry protein powder according to claim 2, it is characterised in that：Described ultrafiltration step
By the filtrate ultrafiltration after deodorization, to take filtered solution, milipore filter specification is 1 ~ 2kDa.
7. a kind of preparation method of fish soluble slurry protein powder according to claim 2, it is characterised in that：Described desalting steps
For by ion exchange resin desalination, filtered solution is obtained into desalting liquids.
8. a kind of preparation method of fish soluble slurry protein powder according to claim 2, it is characterised in that：Described spray drying
Step is that desalting liquids spray drying is obtained into albumen powder product.
9. a kind of preparation method of fish soluble slurry protein powder according to claim 4, it is characterised in that：Described pepsin
Addition 0.6 ~ 1.4%, pH is 2.0 ~ 3.5, and hydrolysis temperature is 37 ~ 39 DEG C, and enzymolysis time is 10 ~ 15min.
10. a kind of preparation method of fish soluble slurry protein powder according to claim 4, it is characterised in that：Described pawpaw egg
White enzyme addition is that 0.2 ~ 0.4%, pH is 6.0 ~ 7.0, and temperature is 50 ~ 55 DEG C, and enzymolysis time is 4 ~ 7min.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710562859.5A CN107266550A (en) | 2017-07-11 | 2017-07-11 | A kind of fish soluble slurry protein powder |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710562859.5A CN107266550A (en) | 2017-07-11 | 2017-07-11 | A kind of fish soluble slurry protein powder |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107266550A true CN107266550A (en) | 2017-10-20 |
Family
ID=60073516
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710562859.5A Pending CN107266550A (en) | 2017-07-11 | 2017-07-11 | A kind of fish soluble slurry protein powder |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107266550A (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114041522A (en) * | 2021-11-22 | 2022-02-15 | 海南华研胶原科技股份有限公司 | Preparation method of hydrolyzed fish soluble protein powder |
-
2017
- 2017-07-11 CN CN201710562859.5A patent/CN107266550A/en active Pending
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114041522A (en) * | 2021-11-22 | 2022-02-15 | 海南华研胶原科技股份有限公司 | Preparation method of hydrolyzed fish soluble protein powder |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN101418328A (en) | Method for producing fish scale collagen protein | |
| KR101071338B1 (en) | Method of Producing Collagen Peptide from Marine Organism and Collagen Peptide Produced by the Method | |
| CN105969830A (en) | Method for extracting active collagen peptide from pigskin | |
| WO2017209587A1 (en) | Method for the extraction and purification of native marine collagen from sardina pilchardus sardine scales | |
| Suo-Lian et al. | Technology for extracting effective components from fish scale | |
| CN107348405A (en) | A kind of small fish albumen powder product | |
| CN103374594A (en) | Method for preparing fish skin gelatin by biological enzymolysis process | |
| CN107227331A (en) | A kind of method of the molten slurry production protein small peptide of utilization fish | |
| CN107475333A (en) | A kind of technology of preparing of fish soluble slurry protein powder | |
| CN107089869A (en) | A kind of preparation method of the molten slurry Protein fertilizer of fish | |
| KR100532153B1 (en) | producing method of protein hydrolysates from fish scale | |
| CN111493205A (en) | A kind of fish protein hydrolyzate and preparation method thereof | |
| CN107266550A (en) | A kind of fish soluble slurry protein powder | |
| CN105316382A (en) | Preparation method of fishbone collagen | |
| CN109880875B (en) | A kind of selenium-enriched tuna bone collagen peptide and preparation method thereof | |
| CN107494886A (en) | A kind of albumen powder product using the molten slurry production of fish | |
| CN114045323B (en) | Method for preparing fish skin and scale collagen peptide powder by multistage enzymolysis process | |
| CN107177651A (en) | Dual-enzyme hydrolysis method prepares the thick liquid of high F value oligopeptide | |
| CN114933648B (en) | Method for producing collagen dipeptide from fish scales | |
| JP5829844B2 (en) | Method for producing water-soluble elastin peptide | |
| CN117165645A (en) | Enzymatic method for preparing collagen peptide powder with beautifying effect | |
| CN110818791B (en) | Preparation method of fish collagen | |
| EP3967151A1 (en) | Valorisation of marine animal by-products | |
| CN107156861A (en) | A kind of processing method of Optimization of Low Value Fish Protein peptide product | |
| CN112544778A (en) | Preparation method of high-quality cartilage extract with high purity and good taste and application of prepared cartilage extract |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20171020 |
|
| RJ01 | Rejection of invention patent application after publication |