CN107144694A - Antigen, kit and application for detecting tuberculosis infection T cell - Google Patents
Antigen, kit and application for detecting tuberculosis infection T cell Download PDFInfo
- Publication number
- CN107144694A CN107144694A CN201710197679.1A CN201710197679A CN107144694A CN 107144694 A CN107144694 A CN 107144694A CN 201710197679 A CN201710197679 A CN 201710197679A CN 107144694 A CN107144694 A CN 107144694A
- Authority
- CN
- China
- Prior art keywords
- seq
- cfp
- esat
- kit
- detection
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56911—Bacteria
- G01N33/5695—Mycobacteria
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N21/00—Investigating or analysing materials by the use of optical means, i.e. using sub-millimetre waves, infrared, visible or ultraviolet light
- G01N21/62—Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light
- G01N21/63—Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light optically excited
- G01N21/64—Fluorescence; Phosphorescence
- G01N21/6428—Measuring fluorescence of fluorescent products of reactions or of fluorochrome labelled reactive substances, e.g. measuring quenching effects, using measuring "optrodes"
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N21/00—Investigating or analysing materials by the use of optical means, i.e. using sub-millimetre waves, infrared, visible or ultraviolet light
- G01N21/75—Systems in which material is subjected to a chemical reaction, the progress or the result of the reaction being investigated
- G01N21/76—Chemiluminescence; Bioluminescence
- G01N21/763—Bioluminescence
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/52—Use of compounds or compositions for colorimetric, spectrophotometric or fluorometric investigation, e.g. use of reagent paper and including single- and multilayer analytical elements
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/531—Production of immunochemical test materials
- G01N33/532—Production of labelled immunochemicals
- G01N33/535—Production of labelled immunochemicals with enzyme label or co-enzymes, co-factors, enzyme inhibitors or enzyme substrates
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/577—Immunoassay; Biospecific binding assay; Materials therefor involving monoclonal antibodies binding reaction mechanisms characterised by the use of monoclonal antibodies; monoclonal antibodies per se are classified with their corresponding antigens
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6863—Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
- G01N33/6866—Interferon
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N21/00—Investigating or analysing materials by the use of optical means, i.e. using sub-millimetre waves, infrared, visible or ultraviolet light
- G01N21/62—Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light
- G01N21/63—Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light optically excited
- G01N21/64—Fluorescence; Phosphorescence
- G01N21/6428—Measuring fluorescence of fluorescent products of reactions or of fluorochrome labelled reactive substances, e.g. measuring quenching effects, using measuring "optrodes"
- G01N2021/6439—Measuring fluorescence of fluorescent products of reactions or of fluorochrome labelled reactive substances, e.g. measuring quenching effects, using measuring "optrodes" with indicators, stains, dyes, tags, labels, marks
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/195—Assays involving biological materials from specific organisms or of a specific nature from bacteria
- G01N2333/35—Assays involving biological materials from specific organisms or of a specific nature from bacteria from Mycobacteriaceae (F)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/52—Assays involving cytokines
- G01N2333/555—Interferons [IFN]
- G01N2333/57—IFN-gamma
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/12—Pulmonary diseases
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Physics & Mathematics (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Analytical Chemistry (AREA)
- Cell Biology (AREA)
- Food Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Virology (AREA)
- Optics & Photonics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Tropical Medicine & Parasitology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Plasma & Fusion (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The invention discloses a kind of antigen for being used to detect tuberculosis infection T cell, the amino acid sequence of the antigen is as shown in SEQ ID NO.1~SEQ ID NO.26, appoint eight polypeptides taken in SEQ ID NO.1~SEQ ID NO.26, cooperate with ESAT 6 and the polypeptides of CFP 10 and derivative collective effect, the T cell of differential stimulus mycobacterium tuberculosis infection can specific secretion IFN γ, the sensitivity of increase detection.The invention provides a kind of new detection kit available for tuberculosis infection T cell, use the kit, direct human peripheral blood carries out antigenic stimulus, without separating peripheral blood mononuclear cells, detection has higher sensitivity and specificity, and it is easy to operate, testing cost is relatively low, with higher clinical value.
Description
Technical field
The present invention relates to biological technical field, in particular to the antigen for detecting tuberculosis infection T cell, reagent
Box and application.
Background technology
Tuberculosis is main through respiratory infectious, serious harm one of China and global Important Infectious Diseases.According to generation
There is 17-20 hundred million mycobacterium tuberculosis the infected in boundary's health organization, the whole world, and at least 2,000,000 people die from this disease and [thank and build every year
It is flat, the methodology of mycobacterium tuberculosis functional genome research, microorganism circular .2001.28 (5):92-97].Therefore, accurately
The method of screening the infected plays the part of extremely important effect in preventing and treating lungy or even final elimination.
Diagnosis of the existing diagnostic techniques to mycobacterium tuberculosis the infected is very difficult.In recent decades, clinically use
Tuberculin test (TST) carrys out diagnosis of tuberculosis mycobacterial infections person.But TST active ingredients are purified protein derivatives
(purified protein derivative of tuberc μ Lin, PPD), is the thick of mycobacterium tuberculosis culture supernatant
Extract, containing 200 Multiple components, with BCG vaccine (Bacillus Calmette-Guerin, BCG) inoculation and environment mycobacteria
There is cross reaction in infection.TST testing results can be immunized by present clinical widely used vaccine-BCG vaccine and disturb
[P.Andersen, et al.Lancet356 (2000) 1099-1104].From nineteen twenty-one and bright BCG vaccine till now, full generation
The existing 3,500,000,000 people's bcg vaccinations in boundary.Therefore TST is greatly affected to the diagnostic value of the infected, causes what TST was diagnosed
Accuracy is relatively low, therefore can not be judged whether to be truly present mycobacterium tuberculosis infection according to its result.
To in the diagnostic techniques of tuberculosis patient, Sputum smears acid-fast stain or Phlegm incubation, culture are difficult, take longer；
Lung's x-ray checks Pulmonary lesions, also could only be diagnosed after with typical clinical symptoms；Other serodiagnosis sides
Method and molecular diagnosis method lack specificity, and false positive rate is higher.Relevant researcher points out, different diagnostic test methods
Sensitivity and Specificity is as follows：Mycobacteria culture (being respectively 73% and 100%)；PCR (being respectively 42% and 100%)；Chest
Portion's x-ray (being respectively 67%~77% and 66%~76%)；Tuberculin test (being respectively 94% and 20%)；Serology (point
Wei 33% and 87%).As can be seen here, the Sensitivity and Specificity of existing mycobacterium tuberculosis detection method can not reach simultaneously
To optimal.
After mycobacterium tuberculosis infection human body, it can be recognized first by the immune system of human body, the T cell of activation body is immunized
Response, secretion produces interferon (IFN-γ), and the latter plays resisting tuberculosis infection effect.Part T cell is converted into immunological memory
Cell, after being met again with mycobacterium tuberculosis, secretion can produce IFN-γ again, play resisting tuberculosis infection effect.Antigen
It is closely related whether special IFN-γ yield infects or fall ill with body.Therefore, if special using mycobacterium tuberculosis
Antigen stimulate the T cell of the infected and patient in vitro, can induce these T cells, to produce high-caliber mycobacterium tuberculosis special
Different IFN-γ, and amount and the unused antigenic stimulus of the IFN-γ that non-tuberculous mycobacteria the infected or non-tuberculosis patient produce
The amount of generation is close, so as to realize the purpose of diagnosis.As can be seen here, find and find Specific Antigen of Mycobacterium Tuberculosis, it is right
The diagnostic reagent of development a new generation has important value and meaning.
1996, the method that Stover etc. is hybridized by subtrahend determined the domain that BCG is lost in succeeding generations in vitro, fixed
Justice is missing area (Region of Difference, RD), and runt domain is present in mycobacterium tuberculosis, and in BCG and mostly
[the laboratory diagnosis progress foreign medical science clinics of the full mycobacterium tuberculosis of Cheng Yu, Li Mao are raw for missing in the mycobacteria of ring of numbers border
Thing chemistry and ecsomatics fascicle .2002；23(6)：342-343.].Wherein, the early stage of RD1 regional codes point antigen target 6KD
(early secreting antigen target 6KD, ESAT-6) and culturing filtrate protein 10 KD (c μ Ltufiltrate
Protein 10KD, CFP-10) it is two kinds of small-molecular-weight secretory proteins, they are one of topmost antigen of T cell, can be lured
Lead stronger cell immune response.
For children or immunocompromised sample, there is document report, thorn is only used as using ESAT-6 and CFP-10 or its polypeptide
Swash original, its sensitivity is about 73.5%-88.9% Sun Lin, application of the ELISPOT detection techniques in children tuberculosis diagnosis, mark
Remember immunoassay and clinic .2008.6:349-353；Zhong Huaqing, interferon-γ release test answering in childhood tuberculosis infection
With value, laboratory medicine .2016.3:176-179；Li Hai, using enzyme-linked immunospot assay quick diagnosis childhood tuberculosis branch bar
The research of bacterium infection, Chinese mother and child care, 2012.11:1703-1706].For some special samples, such as children, immunocompromised
And sample is infected recently, ESAT-6 and CFP-10 polypeptides and the detection of derivative kit mycobacterium tuberculosis sample be not still high,
Clinical demand can not be met.
The content of the invention
For existing detection method for some special samples, recently such as children, immunocompromised and infection tuberculosis branch bar
The detection of bacterium sample is not enough, and it is an object of the invention to provide a kind of antigen for being used to detect that mycobacterium tuberculosis infects T cell
Composition, antigen composition collaboration ESAT-6 and CFP-10 polypeptides and derivative collective effect, differential stimulus tuberculosis branch
The fresh whole blood of bacillus infection, the specific secretion of gamma-IFN of energy, increases detection sensitivity, effectively improves recall rate, effectively keep away
Exempt from missing inspection.
It is a kind of to be used to detecting the antigen composition of tuberculosis infection T cell, the antigen composition include ESAT-6, CFP-10 and
Containing amino acid sequence such as wantonly eight polypeptides as shown in SEQ ID NO.1~SEQ ID NO.26 or wantonly more than eight polypeptides
Combination.
Antigen composition as described above, it is preferable that the combination of described eight polypeptides or wantonly more than eight polypeptides is adopted
There is the polypeptide of 85% homology with any shown sequence in the SEQ ID NO.1~SEQ ID NO.26, or use ESAT-
6-CFP-10 replaces described ESAT-6, CFP-10.
Antigen composition as described above, it is preferable that the amino acid sequence of the ESAT-6 as shown in SEQ ID NO.27,
The amino acid sequence of the CFP-10 is as shown in SEQ ID NO.28, the amino acid sequence such as SEQ of the ESAT-6-CFP-10
Shown in ID NO.29.
Antigen composition as described above, it is preferable that the polypeptide is artificial synthesized or naturally isolated.
It is a kind of to be used to detecting the kit of tuberculosis infection T cell, including antigen composition as described above and detection γ-dry
Disturb the reagent of element.
Kit as described above, it is preferable that the reagent of the detection gamma interferon include Enzyme-linked Immunosorbent Assay reagent,
Chemoluminescence method detection reagent, immunofluorescence detection agent.
The application of kit as described above, for detecting that T cell is secreted after antigen composition as described above stimulation
Cell factor, the cell factor be gamma interferon.
The application of kit as described above, it is preferable that the T cell derives from peripheral blood, cerebrospinal fluid, hydrothorax or ascites.
The application of kit as described above, it is preferable that ESAT-6 and CFP-10 or described described in the antigen composition
ESAT-6-CFP-10 final concentration of 4~200 μ g/mL, final concentration of 40~1000 μ g/mL of the polypeptide.
The application of kit as described above, it is preferable that the reagent of the detection gamma interferon also includes using phosphate-buffered
Liquid makees negative control, and its testing result is designated as N；With the antigen composition as stimulated in vitro thing, its testing result is designated as T；
Make positive control with lectin and bovine serum albumin(BSA), its testing result is designated as P.
The application of kit as described above, it is preferable that for the content of the gamma interferon, testing result T-N >=0.15
~0.5IU/mL, judges infection mycobacterium tuberculosis；Testing result T-N 0.15~0.5IU/mL of ＜, judgement is uninfected by tuberculosis point
Branch bacillus.
Antigen and kit provided by the present invention for detecting tuberculosis T cell, have the characteristics that：
(1) high for immunocompromised sample positive rate, sensitivity is high.It is special for some for existing detection method
The detection of sample, such as children, immunocompromised and infection sample or latent infection person recently is not enough, and the present invention is provided to sensitiveness
The antigen polypeptide combination of high mycobacterium tuberculosis infection with specificity, the polypeptides in combination, which merges ESAT-6 and CFP-10, to be realized
Quick, special detection to tuberculosis patient or early infection person or latent infection person (not occurring tuberculosis illness), in resistance
Disconnected propagation lungy and prevalence, and control lungy is significant.Combined using the polypeptides in combination of the present invention
ESAT-6 and CFP-10 carries out fresh whole blood sample stimulation, with good diagnostic accordance rate.
(2) the detection used time is short, easy to operate, and diagnosis is quick.Compared with traditional mycobacterium tuberculosis is detected, the present invention is utilized
The specific antigen protein detection used time that the peptide composition of offer merges IFN-γ is short, and diagnosis is quick.Traditional tuberculosis branch bar
Bacterium culture diagnosis is taken time the 1-2 months, and TST detections need 3 days, and present invention whole detection time can be completed in 1-2 days.
(3) early detection can be carried out to mycobacterium tuberculosis infection.Because mycobacterium tuberculosis once infects human body, first
Just recognized by the immune system of body, activation humoral and cellular immune response response, disease time 1-2 months after infection, therefore,
The polypeptide pond provided using the present invention merges the cellular immunology detection method of the specific antigen protein of whole blood IFN-gamma
Diagnosis quickly is made, is diagnosed to be whether sample infects the infection of tuberculosis branch.And in existing technology, X-ray diagnosis is only in sense
Ran Zhe lungs can just make diagnosis after there is obvious pathological change, and this usually requires long time.Antigen and antibody
Only detected in the case where disease symptomses are in active stage, but mycobacteria is widely present in environment, itself and tuberculosis branch bar
The common antigen of bacterium, may interfere with the diagnostic result of experiment.It can be seen that, the present invention infects or immunocompromised mycobacterium tuberculosis recently
The early detection of person is significant, has positive meaning to control lungy and elimination.
Present invention also offers a kind of method that detection is infected for mycobacterium tuberculosis, it is demonstrated experimentally that the present invention can be straight
Connect and carry out antigenic stimulus using peripheral blood, without separating peripheral blood mononuclear cells, experimental data shows that the present invention is used for tuberculosis
Mycobacterial infections detection has higher sensitivity and specificity, is prevented effectively from false negative, and easy to operate, testing cost compared with
It is low, with higher clinical value.
Embodiment
The concrete principle of the present invention：After organism infection mycobacterium tuberculosis, " Memorability " T lymphs formed in blood are thin
Born of the same parents, it can be produced in the specific antigen of contact mycobacterium tuberculosis again and secrete corresponding cell factor (γ-interference
Element).Pass through the quantitative detection to gamma interferon, it can be determined that with the presence or absence of thin for the specific T lymphs of mycobacterium tuberculosis
Born of the same parents' immune response.
Around this principle, choose and be present in mycobacterium tuberculosis, but in BCG vaccine and most of non-tuberculous mycobacterias
ESAT-6, CFP-10 and specific polypeptide of middle general absence, table is merged using technique for gene engineering by ESAT-6 and CFP-10
Reach, and specific polypeptide fragment turns into the mycobacterium tuberculosis differential stimulus antigen applied in detection kit jointly, it is and new
The fresh lymphocyte taken is incubated after being sufficiently mixed, and collects blood plasma, and lymph is detected using DASELISA immunization principle
The concentration of gamma interferon in cell, calculates the concentration of gamma interferon in sample, so as to judge whether to infect mycobacterium tuberculosis.
The specific polypeptide that the present invention is provided, merges the differential stimulus part that ESAT-6 and CFP-10 constitutes kit, can improve
To some special samples, such as children, immunocompromised and the recall rate for infecting sample recently.Wherein, lymphocyte derives from periphery
Blood, cerebrospinal fluid, hydrothorax or ascites, the present invention illustrate the present invention by taking anticoagulant heparin whole blood as an example.
The invention will be further described with reference to embodiments, but protection scope of the present invention is not limited to these realities
Apply example.Every change or equivalent substitute without departing substantially from present inventive concept is included within protection scope of the present invention.Following reality
The experimental method for applying unreceipted actual conditions in example is routinely experimental method；Test reagent is commercially available purchase unless otherwise instructed
Buy product.Commercial reagent box used below is thin for the mycobacterium tuberculosis specificity of Wuhan Hygiea Bioscience Co., Ltd.
Born of the same parents' immune response detection kit (ELISA)；Tuberculosis infection sample involved in the present invention is the screening of volunteer's case
Standard is：Issued according to the Ministry of Public Health《Diagnosis of pulmonary tuberculosis standard》National standard (WS288-2008), clinical manifestation symptom, sign
And imaging examination of chest is diagnosed as phthisical patient, wherein bacteriology positive or negative tuberculosis patient refers to clinical diagnosis
For in patient lungy, through bacteriology checking (Sputum smears acid-fast stain microexamination and/or Roche solid medium bacterium
Solid culture) positive or negative tuberculosis patient；And lung outer tuberculosis (such as bone tuberculosis, nephrophthisis, intestinal tuberculosis, scrofula
Deng) patient.Healthy sample is healthy volunteer, and its screening criteria is：Without tuberculosis clinical symptoms, without other diseases or infection.
The polypeptide of embodiment 1 stimulates validity to screen
In order to realize the purpose of the present invention, the polypeptide that the present invention is screened is the specific protein of pathogenic mycobacterium tuberculosis
Come from：Ag85B, Mpt64, RV1985C, RV1989c, Rv3425, the combination of lymphocyte can be directed to by screening in these protein
The polypeptide in site, the specific secretion of patient's fresh whole blood of the polypeptide energy differential stimulus mycobacterium tuberculosis infection of screening
Gamma interferon (IFN-γ).Tested by clinical verification repeatedly, these polypeptides, which merge ESAT-6 and CFP-10, can improve detection
Sensitivity, the merging stimulant can specific effect in mycobacterium tuberculosis infect sample whole blood in lymphocyte epitopes,
The cell factor IFN-γ discharged by detecting in whole blood, so that whether reaction body infected mycobacterium tuberculosis indirectly.
Inventor is studied by lot of experiments, the final spy for obtaining nucleotide sequence as shown in SEQ ID NO.1~SEQ ID NO.26
Specific polypeptide fragment, appoints and takes eight kinds of polypeptides therein to be used in combination with ESAT-6 and CFP-10 or ESAT-6-CFP-10, be configured to
Agent solution is stimulated, for stimulating fresh whole blood, the gamma interferon after detection stimulation in whole blood can determine whether whether whole blood infects knot
Core mycobacterium.
The polypeptide fragment of the present invention, its amino acid sequence is as follows, these polypeptide fragments can by artificial synthesized or
Be it is naturally isolated, the polypeptide in the present embodiment and following examples be by artificial synthesized, wherein, SEQ ID NO.1~
SEQ ID NO.6 come from Mpt649, SEQ ID NO.11~SEQ ID from Ag85B, SEQ ID NO.7~SEQ ID NO.10
NO.16 comes from RV1989c, SEQ ID NO.22~SEQ ID from RV1985C, SEQ ID NO.17~SEQ ID NO.21
NO.26 comes from Rv3425.
SEQ ID NO.1：RLWVYCGNGTPNEL
SEQ ID NO.2：LMIGTAAAVVLPGL
SEQ ID NO.3：VQFQSGGNNSPAVY
SEQ ID NO.4：MPVGGQSSFYSDWY
SEQ ID NO.5：SAAIGLSMAGSSAM
SEQ ID NO.6：PAFEWYYQSGLSIV
SEQ ID NO.7：YQSAIPPRGTQAVV
SEQ ID NO.8：IQMSDPAYNINISL
SEQ ID NO.9：KSLENYIAQTRDKF
SEQ ID NO.10：MLVTAVVLLCCSGV
SEQ ID NO.11：RKAFRRAITRPTHF
SEQ ID NO.12：MVDPQLDGPQLAAL
SEQ ID NO.13：KLDSPIIARITDTV
SEQ ID NO.14：RLAAQTALLESEAL
SEQ ID NO.15：ITIAVNADSMATWF
SEQ ID NO.16：REKPCRATTAGIPL
SEQ ID NO.17：LLFPAIYLADSAQA
SEQ ID NO.18：AVLDLTTPQAREAV
SEQ ID NO.19：KMLEAAYRLHTIDV
SEQ ID NO.20：TAYEQRTRPGQLQL
SEQ ID NO.21：GRWNPPLLFPAIYL
SEQ ID NO.22：RELAYSVETTAESL
SEQ ID NO.23：VSWTRSALSDLPRW
SEQ ID NO.24：LSDLPRWREPPQIY
SEQ ID NO.25：SLFFASGQLRELAY
SEQ ID NO.26：ALSDLPRWREPPQI.
It should be noted that the purpose of the present invention can be achieved in the polypeptide for having 85% homology with above-mentioned sequence.And use
The Detection results that ESAT-6-CFP-10 replaces ESAT-6, CFP-10 are identical.
ESAT-6 sequences used in the present invention are SEQ ID NO.27:
MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEA
YQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA；CFP-10 sequences are SEQ ID NO.28:
MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIR
QAGVQYSRADEEQQQALSSQMGF；ESAT-6-CFP-10 sequences are SEQ ID NO.29：
MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQNLARTIS
EAGQAMASTEGNVTGMFANVAMAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVV
RFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQALSSQMGF。
It is prepared by the detection kit of embodiment 2
For the kit for the T cell for detecting tuberculosis infection, including the antigen composition described in example 1 and inspection is performed as described above
The reagent of gamma interferon is surveyed, wherein, the reagent of detection gamma interferon includes enzyme linked immunosorbent detection reagent, chemoluminescence method and detected
Reagent, immunofluorescence detection agent.Lower mask body introduces this several kit：
Whether a kind of release in vitro ELISA detection body infects the detection kit of mycobacterium tuberculosis, the reagent
Box with the ESAT-6 and CFP-10 or ESAT-6-CFP-10 in embodiment 1 respectively with SEQ ID NO.1~SEQ ID NO.26
Any eight polypeptides or more than eight be combined as mycobacterium tuberculosis differential stimulus antigen, (i.e. ESAT-6 and CFP-10
With in the specific polypeptide in SEQ ID NO.1 in embodiment 1~SEQ ID NO.26, or ESAT-6-CFP-10 and embodiment 1
Specific polypeptide in SEQ ID NO.1~SEQ ID NO.26 is used as mycobacterium tuberculosis differential stimulus antigen), it is and fresh
The anticoagulant heparin whole blood taken is incubated after being sufficiently mixed, and collects blood plasma, and people is detected using DASELISA immunization principle
The concentration of gamma interferon in blood plasma, calculates the concentration of gamma interferon in sample, so that judge whether to infect mycobacterium tuberculosis,
First, whole blood is gathered, being sub-packed in stimulation culture tube (stimulates part (negative control culture tube (N), tuberculosis stimulation culture tube
(T), positive control culture tube (P)), after culture, interferon content is detected with detection part.It is consisted of the following composition:
Stimulation unit point includes：Negative control culture tube (N)：Phosphate buffer, tuberculosis stimulation culture tube (T) of the concentration for 20mM：Eventually
The ESAT-6-CFP-10 fused antigens or ESAT-6 and CFP-10 that concentration is 4~200 μ g/mL are respectively 40~1000 μ with concentration
Any eight polypeptides of SEQ ID NO.1~SEQ ID NO.26, positive control culture tube (P) described in g/mL embodiment 1
The lectin for being 0.5mg/mL~5mg/mL for concentration, 10% bovine serum albumin(BSA)；Detection part coated elisa plate,
Gamma interferon calibration object, calibration object dilution, enzyme marking reagent, concentrated cleaning solution, developer A liquid, developer B liquid and terminate liquid,
Wherein, ELISA Plate is coated with anti-human gamma interferon antibody, gamma interferon calibration object and contains Monoclonal Antibodies Against Human Recombinant Interferon-gamma and cow's serum
Albumin, calibration object dilution are that concentration is horseradish peroxidating for phosphate buffer, the enzyme marking reagent added with casein (sodium)
The anti-human gamma interferon monoclonal antibody and cow's serum of substance markers, concentrated cleaning solution (20 multiple proportions)：For the phosphorus containing Tween-20
Phthalate buffer, developer A liquid are that hydrogen peroxide, developer B liquid are tetramethyl benzidine hydrochloric acid, and terminate liquid is 10% sulfuric acid.
Whether a kind of release in vitro chemoluminescence method detection body infects the kit of mycobacterium tuberculosis, this kit with
ESAT-6-CFP-10 or ESAT-6 and CFP-10 are respectively mycobacterium tuberculosis specificity with the specific polypeptide in embodiment 1
Stimulator antigen, is incubated after being sufficiently mixed with the fresh anticoagulant heparin whole blood taken, and blood plasma is collected, using double-antibody sandwich immunization
The concentration of gamma interferon, calculates the concentration of gamma interferon in sample in principle detection human plasma, so as to judge whether infection knot
Core mycobacteria, gathers whole blood first, and being sub-packed in stimulation culture tube (stimulates part (negative control culture tube (N), tuberculosis thorn
Swash culture tube (T), positive control culture tube (P)), cultivated, detect interferon content with detection part afterwards.Its by with
Lower composition composition：Stimulate part：Be in negative control culture tube (N) concentration be 20mM phosphate buffer, tuberculosis stimulate training
Support that pipe (T) is final concentration of 4~200 μ g/mLESAT-6-CFP-10 fused antigens or ESAT-6 and CFP-10 is respectively with concentration
Any eight polypeptides in 40~1000 μ g/mL embodiment 1 in SEQ ID NO.1~SEQ ID NO.26, and concentration is
20mg/mL~100mg/mL human serum albumin, the external source aggegation that positive control culture tube (P) is 0.5mg/mL~5mg/mL
Element, 10% bovine serum albumin(BSA)；Detection part coating luminescent screen, gamma interferon calibration object, calibration object dilution, the examination of enzyme mark
Agent, concentrated cleaning solution, luminous agent A liquid and luminous agent B liquid, wherein, luminescent screen is coated with anti-for detachable micropore lath luminescent screen
Human gamma-interferon antibody, gamma interferon calibration object is containing Monoclonal Antibodies Against Human Recombinant Interferon-gamma and bovine serum albumin(BSA), calibration object dilution
The anti-human gamma interferon list that liquid is the phosphate buffer containing casein (sodium), enzyme marking reagent is horseradish peroxidase mark
Clonal antibody and cow's serum, the phosphate buffer of concentrated cleaning solution (20 times) containing polysorbas20, luminous agent A liquid are urea peroxide
It is luminol with luminous agent B liquid.
Whether a kind of release in vitro immuno-fluorescence assay body infects the detection kit of mycobacterium tuberculosis, this reagent
Box with ESAT-6 and CFP-10 or ESAT-6-CFP-10 respectively with SEQ ID NO.1~SEQ ID NO.26 specificity it is many
Peptide is mycobacterium tuberculosis differential stimulus antigen, is incubated after being sufficiently mixed with the fresh anticoagulant heparin whole blood taken, and collects blood
Slurry, the concentration of gamma interferon in human plasma is detected using double-antibody sandwich immunization principle, calculates gamma interferon in sample
Concentration, so as to judge whether to infect mycobacterium tuberculosis, gathers whole blood first, and being sub-packed in stimulation culture tube (stimulates part (cloudy
Property control culture tube (N), tuberculosis stimulate culture tube (T), positive control culture tube (P)), after culture with detection part detect γ
Disturb cellulose content.It is consisted of the following composition：Stimulate part (negative control culture tube (N)：Concentration is 20mM phosphate-buffered
Liquid, tuberculosis stimulate culture tube (T)：Final concentration of 4~200 μ g/mL ESAT-6-CFP-10 fused antigens or ESAT-6 and CFP-
10 is right with any eight polypeptides of SEQ ID NO.1~SEQ ID NO.26 in 40~1000 μ g/mL embodiment 1, the positive respectively
It is the lectin that concentration is 0.5mg/mL~5mg/mL, 10% bovine serum albumin(BSA), test section subpackage according to culture tube (P)
Include：Test card, fluorescence immunoassay reagent, ID chips, wherein, the T lines of test card are coated with anti-human gamma interferon antibody, C lines coating
Goat anti-rabbit antibody；Fluorescence immunoassay reagent is the anti-human gamma interferon monoclonal antibody that fluorescent microsphere is marked, and rabbit igg antibody contains
The Tris-HCl buffer preservings of casein (sodium).
The detection method that embodiment 3 is detected with kit of the present invention to ex vivo whole blood
Detected using the kit prepared in embodiment 2, first carry out ex vivo whole blood stimulation：Before detection, it is to be ensured that
37 DEG C of constant incubator, stimulates culture tube (T), positive control culture tube (P) to carry out negative control culture tube (N), tuberculosis
3000~5000 revs/min centrifuge 1 minute, carry out mark on 3 kinds of culture tubes respectively, can add sample number or name.So
The uviol lamp of Biohazard Safety Equipment is opened afterwards, is irradiated 15~20 minutes.
1st, gather：Using venipuncture, whole blood sample is gathered using the vacuum blood collection tube of heparin lithium anti-freezing, collection capacity is not
Less than 4mL.
2nd, dispense：Mix the heparin tube for gathering whole blood sample is reverse 5~10 times, by 1mL/ pipes order be sub-packed in " N ",
In " T ", " P " pipe.
3rd, cultivate：Culture tube gentle inversion is mixed 5~10 times, 37 DEG C of constant incubator cultures 16~24 are put into rapidly small
When, keep culture tube upright in incubation.
4th, centrifuge：Culture tube after culture is centrifuged 2 minutes in 3000~5000 revs/min, blood plasma (note in EP pipes is taken
Meaning can not be drawn onto cellular layer), mark is carried out, is plasma sample to be checked, blood plasma can be preserved one week in 4 DEG C of conditions, and -20 DEG C can preserve
1 year.During using three kinds of detection kits, stimulation unit split-phase is same.
The use of three kinds of kit detection parts is introduced separately below：
(1) release in vitro ELISA
Before use, please kit is balanced to room temperature (about 30 minutes).Liquid reagent is gently vibrated to mixing, stood after use
Seal, put back to 2~8 DEG C of preservations.Unspent microplate must cover shrouding film and reinstate valve bag sealing, examination with drier one
Agent box Kaifeng preserves after 2~8 DEG C and is no more than 1 month.Gamma interferon calibration object after redissolution is diluted to can be in 2 after each concentration
~8 DEG C preserved no more than 1 month.
1st, the preparation of standard curve
The preparation of gamma interferon calibration object working solution：According to the volume indicated on label, calibrated to equipped with gamma interferon
Corresponding calibration object dilution is added in the cillin bottle of product (freeze-dried powder), is mixed, 80IU/mL gamma interferon calibration is configured to
Product working solution.It should be noted that：The volume of addition calibration object dilution may not needed for dissolving different batches gamma interferon calibration object
Together.
6 1.5mLEP pipes are taken, are respectively labeled as adding 900 μ L schools in SD1, SD2, SD3, SD4, SD5 and SD6, SD1 pipes
Quasi- product dilution (enzyme-linked), often pipe adds 300 μ L calibration objects dilutions (enzyme-linked) to SD2~SD6.
Take in 100 μ L 80IU/mL interferon calibration object working solution (in cillin bottle), the SD1 for being added to 900 μ L, shake
Mixing is swung, 8IU/mL working solutions are obtained.
More renew suction nozzle, take 300 μ L SD1, in the SD2 for being added to 300 μ L, concussion is mixed, and obtains 4IU/mL working solutions.
More renew suction nozzle, take 300 μ L SD2, in the SD3 for being added to 300 μ L, concussion is mixed, and obtains 2IU/mL working solutions.
More renew suction nozzle, take 300 μ L SD3, in the SD4 for being added to 300 μ L, concussion is mixed, and obtains 1IU/mL working solutions.
More renew suction nozzle, take 300 μ L SD4, in the SD5 for being added to 300 μ L, concussion is mixed, obtain 0.5IU/mL work
Liquid.
More renew suction nozzle, take 300 μ L SD5, in the SD6 for being added to 300 μ L, concussion is mixed, obtain 0.25IU/mL work
Liquid.
2nd, the preparation of 1 × cleaning solution：20mL (20 times) of concentrated cleaning solution is added into the beaker of the pure water equipped with 380mL
In, mix, it is standby.
3rd, it is loaded
(1) standard curve：50 μ L SD1, SD2, SD3, SD4, SD5 and SD6 is respectively taken, is sequentially added into plate hole, it is parallel
Do holes.
(2) sample：50 μ L plasma samples to be checked are added per hole, slight concussion is mixed.Note：Plasma sample is needed before incubation
It is well mixed, to ensure that gamma interferon is uniformly distributed in coating plate hole.
(3) the μ L of enzyme marking reagent 50 are added per hole.
4th, incubate：It is gently mixed uniform, incubation 2 hours in 37 DEG C of constant incubator.
5th, wash：The liquid in hole is got rid of, 300 μ L 1 × cleaning solution washing is added per hole, pats dry, is repeated 5 times.
6th, develop the color：Each 50 μ L of developer A, B liquid are added per hole, gently vibration is mixed；Or 100 μ L developers are added per hole
Mixed liquor (developer mixed liquor prepared before use takes isometric developer A liquid to be well mixed with developer B liquid).
7th, incubate：Incubation in dark 15 minutes in 37 DEG C of constant incubator.
8th, terminate：50 μ L terminate liquids are added per hole.
(2) release in vitro chemoluminescence method
Before use, kit is balanced to room temperature (about 30 minutes).Liquid reagent is gently vibrated to mixing, after use immediately
Sealing, puts back to 2~8 DEG C of preservations.Gamma interferon calibration object after redissolution is diluted to after each concentration to be no more than in 2~8 DEG C of preservations
1 month.
1st, the preparation of standard curve
The preparation of gamma interferon calibration object working solution：According to the volume indicated on label, calibrated to equipped with gamma interferon
Calibration object dilution (luminous) is added in the cillin bottle of product (freeze-dried powder), is mixed, 80IU/mL gamma interferon calibration is configured to
Product working solution.
6 1.5mLEP pipes are taken, are respectively labeled as adding 900 μ L schools in SD1, SD2, SD3, SD4, SD5 and SD6, SD1 pipes
Quasi- product dilution (luminous), often pipe adds 300 μ L calibration objects dilutions (luminous) to SD2~SD6.
Take in 100 μ L 80IU/mL interferon calibration object working solution (in cillin bottle), the SD1 for being added to 900 μ L, shake
Mixing is swung, 8IU/mL working solutions are obtained.
More renew suction nozzle, take 300 μ L SD1, in the SD2 for being added to 300 μ L, concussion is mixed, and obtains 4IU/mL working solutions.
More renew suction nozzle, take 300 μ L SD2, in the SD3 for being added to 300 μ L, concussion is mixed, and obtains 2IU/mL working solutions.
More renew suction nozzle, take 300 μ L SD3, in the SD4 for being added to 300 μ L, concussion is mixed, and obtains 1IU/mL working solutions.
More renew suction nozzle, take 300 μ L SD4, in the SD5 for being added to 300 μ L, concussion is mixed, obtain 0.5IU/mL work
Liquid.
More renew suction nozzle, take 300 μ L SD5, in the SD6 for being added to 300 μ L, concussion is mixed, obtain 0.25IU/mL work
Liquid.
2nd, the preparation of 1 × cleaning solution：20mL (20 times) of concentrated cleaning solution is added into the beaker of the pure water equipped with 380mL
In, mix, it is standby.
3rd, it is loaded
(1) sample：50 μ L plasma samples to be checked are added per hole, slight concussion is mixed.Note：Plasma sample is needed before incubation
It is well mixed, to ensure that gamma interferon is uniformly distributed in luminous plate hole.
(2) standard curve：50 μ L SD1, SD2, SD3, SD4, SD5 and SD6 is respectively taken, is sequentially added into plate hole, it is parallel
Do holes.The hole of blank control 1 (plus the μ L of calibration object dilution (luminous) 50).
(3) the μ L of enzyme marking reagent 50 are added per hole.
4th, incubate：It is gently mixed uniform, incubation 1 hour in 37 DEG C of constant incubator.
5th, wash：The liquid in hole is got rid of, 300 μ L 1 × cleaning solution washing is added per hole, is washed 6 times using board-washing machine washing,
Last time is patted dry.
6th, light：100 μ L luminous agent mixed liquors are added per hole.
7th, incubate：Lucifuge is reacted 5 minutes in room temperature or 37 DEG C of constant incubator.
8th, determine：In 10 minutes luminous value (RLU) was read with chemical illumination immunity analysis instrument.
(3) release in vitro immunofluorescence technique
1st, test card and fluorescence immunoassay reagent, the μ L/ pipes of fluorescence immunoassay reagent 10 are dispensed into EP pipes needed for taking out, and are balanced
To room temperature (about 30 minutes).
2nd, inspection/insertion ID chips read data, it is ensured that kit matches with ID chip lot numbers into instrument.
3rd, every sample " N ", " T ", the μ L of " P " blood plasma 100 are taken respectively, are added in the fluorescence immunoassay reagent dispensed, are done
Good mark, is well mixed, is sample to be tested.
4th, the sample to be checked for taking 100 μ L well mixed is added in the well of test card, and each sample need to put three surveys
Examination card, is " N ", " T ", " P " stimulation blood plasma respectively.
5th, test is stuck in room temperature water placing flat 25~30 minutes, and test card is inserted into the sample card of fluorescence immunity analyzer
In groove, button starts scanning.Ensure that test card is in the right direction and makes its fully-inserted.
6th, data or direct print result are read from the display screen of fluorescence immunity analyzer.
To by 50, tuberculosis infection sample, wherein 65 years old age and sample above 20, healthy 20, sample, collection it is complete
Blood sample.Detected using the kit of the present invention with commercial reagent box.Commercial reagent box is Wuhan Hai Jili biotechnologies
The mycobacterium tuberculosis specific cell immunoreaction detection kit (ELISA) of Co., Ltd.Wherein tuberculosis stimulates training
Support to use in pipe and use respectively：(ESAT-6 and CFP-10 concentration is respectively 10 μ g/mL to stimulant 1, mixes 8 polypeptide (SEQ ID
NO.11~SEQ ID NO.18, each 100 μ g/mL), stimulant 2 (ESAT-6 and CFP-10 concentration respectively be 3 μ g/mL, mix 8
Polypeptide (SEQ ID NO.11~SEQ ID NO.18, concentration respectively be 100 μ g/mL), commercial reagent box stimulant respectively with whole blood
Sample is well mixed after 37 DEG C of baking ovens 20 ± 4 hours, and 6000rpm centrifugation 1min take supernatant to be entered respectively with above-mentioned detection method
OK.
The positive cutoff value of stimulant 1 is selected according to statistics software：As testing result T-N >=0.25IU/mL, it can determine whether
Mycobacterium tuberculosis is infected, testing result T-N ＜ 0.25IU/mL can determine whether to be uninfected by mycobacterium tuberculosis
The positive cutoff value of stimulant 2 is selected according to statistics software：As testing result T-N >=0.5IU/mL, it can determine whether
It is infection mycobacterium tuberculosis, testing result T-N ＜ 0.5IU/mL can determine whether to be uninfected by mycobacterium tuberculosis.
The testing result of the negative sample that is uninfected by healthy to 50 positive samples and 20 is as shown in table 1,2,3.
The release in vitro ELISA testing result of table 1.
| Stimulant 1 | Stimulant 2 | Commercial reagent box | |
| Positive sample | 48/50 (96%) | 48/50 (96%) | 45/50 (90%) |
| Negative sample | 20/20 (100%) | 20/20 (100%) | 20/20 (100%) |
The release in vitro chemoluminescence method testing result of table 2.
| Stimulant 1 | Stimulant 2 | Commercial reagent box | |
| Positive sample | 48/50 (96%) | 48/50 (96%) | 45/50 (90%) |
| Negative sample | 20/20 (100%) | 20/20 (100%) | 20/20 (100%) |
The release in vitro immuno-fluorescence assay result of table 3.
| Stimulant 1 | Stimulant 2 | Commercial reagent box | |
| Positive sample | 49/50 (98%) | 49/50 (98%) | 45/50 (90%) |
| Negative sample | 20/20 (100%) | 20/20 (100%) | 20/20 (100%) |
Testing result illustrates kit prepared by the present invention, and the increase of agent concentration, its T thorns are stimulated with ESAT-6 and CFP-10
Sharp value can increased, therefore result judgment value has certain change, therefore reference value can have certain limit, so, detection knot
Fruit T-N >=0.15~0.5IU/mL, is judged as infecting mycobacterium tuberculosis；Testing result T-N 0.15~0.5IU/mL of ＜, judge
To be uninfected by mycobacterium tuberculosis.Kit remolding sensitivity prior art prepared by the present invention detection commercial reagent box it is sensitive
Degree is high.
The specific polypeptide of embodiment 4 merges ESAT-6 and CFP-10 effect of stimulation
The various combination of polypeptide in embodiment 1 is detected, preferable Detection results are obtained, enumerated below to implementing
Several situations of polypeptide various combination detection in example 1, to illustrate Detection results.
Prepare tuberculosis stimulant 3~6 (following concentration is final concentration):
The formula of tuberculosis stimulant 3 is each 10 μ g/mL of ESAT-6 and CFP-10, each 100 μ g/ in polypeptide SEQ ID NO.1~8
mL；The formula of tuberculosis stimulant 4 is each 10 μ g/mL of ESAT-6 and CFP-10, each 100 μ g/mL in polypeptide SEQ ID NO.6~13；Knot
The formula of core stimulant 5 is each 10 μ g/mL of ESAT-6 and CFP-10, each 100 μ g/mL in polypeptide SEQ ID NO.11~18；Tuberculosis is pierced
It is each 10 μ g/mL of ESAT-6 and CFP-10, each 100 μ g/mL in polypeptide SEQ ID NO.19~26 to swash the formula of agent 6.
20 samples are taken, 10, tuberculosis infection sample, wherein healthy 10, sample, age over-65s 12 are male 12,
Female 8, using the tuberculosis stimulant 3~6 of above-mentioned recipe configuration, carries out the detection of method described in embodiment 3.Simultaneously to 20
Sample, is detected using commercial reagent box, and testing result is as shown in table 4,5,6.Commercial reagent box is Wuhan Hai Jili biological
The mycobacterium tuberculosis specific cell immunoreaction detection kit (ELISA) of Science and Technology Ltd..
The specific polypeptide of table 4. merges ESAT-6 and CFP-10 ELISA testing results
The specific polypeptide of table 5. merges ESAT-6 and CFP-10 chemoluminescence method testing results
The specific polypeptide of table 6. merges ESAT-6 and CFP-10 immuno-fluorescence assay results
Testing result illustrates the detection method and kit of the present invention, the detection commercial reagent box of remolding sensitivity prior art
Sensitivity it is high.
The specific polypeptide of embodiment 5 merges ESAT-6-CFP-10 effect of stimulation
Used in the present embodiment in ESAT-6-CFP-10 and specific polypeptide SEQ ID NO.1~26 wantonly 8 and with
On combination, to illustrate Detection results.Specifically:
Prepare tuberculosis stimulant 7~10 (following concentration is final concentration):
The formula of tuberculosis stimulant 7 is ESAT-6-CFP-10,10 μ g/mL, each 100 μ g/mL in polypeptide SEQ ID NO.1~8；
The formula of tuberculosis stimulant 8 is ESAT-6-CFP-10,10 μ g/mL, each 100 μ g/mL in polypeptide SEQ ID NO.6~13；Tuberculosis is stimulated
The formula of agent 9 is ESAT-6-CFP-10,10 μ g/mL, each 100 μ g/mL in polypeptide SEQ ID NO.11~18；Tuberculosis stimulant 10 is matched somebody with somebody
Side is ESAT-6-CFP-10,10 μ g/mL, each 100 μ g/mL in polypeptide SEQ ID NO.19~26.
20 samples are taken, 10, tuberculosis infection sample, wherein healthy 10, sample, age over-65s 11 are male 12,
Female 8, using the tuberculosis stimulant 7~10 of above-mentioned recipe configuration, carries out the detection of method described in embodiment 3.Simultaneously to 20
Example sample, is detected, testing result is as shown in table 7,8,9 using commercial reagent box.It is (enzyme-linked with interferon detection kit
Immunization) detection compare.
The mixed polypeptide of table 7. merges ESAT-6-CFP-10 ELISA testing results
The mixed polypeptide of table 8. merges ESAT-6-CFP-10 chemoluminescence method testing results
The mixed polypeptide of table 9. merges ESAT-6-CFP-10 immuno-fluorescence assay results
Testing result illustrates the detection method and kit of the present invention, the detection commercial reagent box of remolding sensitivity prior art
Sensitivity it is high.
Embodiment 6 merges mixed polypeptide detection sensitivity and specificity
Sample：20, tuberculosis infection sample, tuberculosis negative sample 20.
Whole blood sample is gathered, respectively with stimulant 11 (ESAT-6 (10 μ g/mL) and CFP-10 (10 μ g/mL)+mixed polypeptide
(SEQ ID NO.6~SEQ ID NO.13)), (ESAT-6-CFP-10+ mixed polypeptides (the SEQ ID NO.6~SEQ of stimulant 12
ID NO.13)), stimulant 13 (ESAT-6 (10 μ g/mL) and CFP-10 (10 μ g/mL)), (ESAT-6-CFP-10 of stimulant 14
(10 μ g/mL)) and stimulant 15 (commercial reagent box) each 20 μ L in sterile culture pipe, often pipe add the fresh collection whole bloods of 1mL
Stimulate, detected by the method described in embodiment 3, commercial reagent box is operated by its specification.Testing result is shown in Table
10、11、12。
Table 10. merges mixed polypeptide sensitivity and specificity ELISA testing result
Table 11. merges mixed polypeptide sensitivity and specificity chemoluminescence method testing result
Table 12. merges mixed polypeptide sensitivity and specificity immuno-fluorescence assay result
Above-mentioned testing result illustrates that kit prepared by the present invention is used for the whole blood for detecting mycobacterium tuberculosis infection, and it is examined
Sensitivity is surveyed up to 95%, sensitivity and specificity are stronger, be prevented effectively from false negative and the missing inspection of prior art detection.
The kit sensitivity and specificity detection of the present invention of embodiment 7
Sample：100, tuberculosis infection sample, wherein 65 years old age and sample above 21, less than 6 years old age sample number 18
Example, 51, HIV samples, man 56, female 44.Tuberculosis negative sample 50, wherein 65 years old age and sample above 20,6 years old
Following age sample number 7,23, HIV samples, man 26, female 24.
Whole blood sample is gathered, respectively with stimulant (ESAT-6 and CFP-10+ mixed polypeptides (SEQ ID NO.11~SEQ
IDNO.18, each 100 μ g/mL), commercial reagent box stimulate, be well mixed after after 37 DEG C of baking ovens 20 ± 4 hours, mixing blood,
6000rpm centrifuges 1min, takes the detection kit, external for the release in vitro ELISA that supernatant prepared with embodiment 2 respectively
Discharge chemoluminescence method detection kit) and release in vitro immunofluorescence technique detection kit according to the side in embodiment 3
Method detected, commercial reagent box is operated by its specification.Testing result is shown in Table 13~18.
The tuberculosis infection sample ELISA testing result of table 13.
The healthy sample ELISA testing result statistics of table 14.
The tuberculosis infection simple chemical luminescence method testing result of table 15. is counted
The healthy simple chemical luminescence method testing result statistics of table 16
The tuberculosis infection sample immuno-fluorescence assay result of table 17 is counted
The healthy sample immuno-fluorescence assay result statistics of table 18
The above results show the kit of the present invention to children, immunocompromised and infect mycobacterium tuberculosis sample recently
Recall rate is higher, and sensitivity and specificity are stronger, is prevented effectively from false negative and the missing inspection of prior art detection.The present invention is to tuberculosis
Mycobacteria infects recently or the early detection of immunocompromised person is significant, has to control lungy and elimination positive
Meaning.
SEQUENCE LISTING
<110>Wuhan Hygiea Bioscience Co., Ltd.
<120>Antigen, kit and application for detecting tuberculosis infection T cell
<130>
<160> 29
<170> PatentIn version 3.5
<210> 1
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 1
Arg Leu Trp Val Tyr Cys Gly Asn Gly Thr Pro Asn Glu Leu
1 5 10
<210> 2
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 2
Leu Met Ile Gly Thr Ala Ala Ala Val Val Leu Pro Gly Leu
1 5 10
<210> 3
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 3
Val Gln Phe Gln Ser Gly Gly Asn Asn Ser Pro Ala Val Tyr
1 5 10
<210> 4
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 4
Met Pro Val Gly Gly Gln Ser Ser Phe Tyr Ser Asp Trp Tyr
1 5 10
<210> 5
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 5
Ser Ala Ala Ile Gly Leu Ser Met Ala Gly Ser Ser Ala Met
1 5 10
<210> 6
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 6
Pro Ala Phe Glu Trp Tyr Tyr Gln Ser Gly Leu Ser Ile Val
1 5 10
<210> 7
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 7
Tyr Gln Ser Ala Ile Pro Pro Arg Gly Thr Gln Ala Val Val
1 5 10
<210> 8
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 8
Ile Gln Met Ser Asp Pro Ala Tyr Asn Ile Asn Ile Ser Leu
1 5 10
<210> 9
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 9
Lys Ser Leu Glu Asn Tyr Ile Ala Gln Thr Arg Asp Lys Phe
1 5 10
<210> 10
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 10
Met Leu Val Thr Ala Val Val Leu Leu Cys Cys Ser Gly Val
1 5 10
<210> 11
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 11
Arg Lys Ala Phe Arg Arg Ala Ile Thr Arg Pro Thr His Phe
1 5 10
<210> 12
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 12
Met Val Asp Pro Gln Leu Asp Gly Pro Gln Leu Ala Ala Leu
1 5 10
<210> 13
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 13
Lys Leu Asp Ser Pro Ile Ile Ala Arg Ile Thr Asp Thr Val
1 5 10
<210> 14
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 14
Arg Leu Ala Ala Gln Thr Ala Leu Leu Glu Ser Glu Ala Leu
1 5 10
<210> 15
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 15
Ile Thr Ile Ala Val Asn Ala Asp Ser Met Ala Thr Trp Phe
1 5 10
<210> 16
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 16
Arg Glu Lys Pro Cys Arg Ala Thr Thr Ala Gly Ile Pro Leu
1 5 10
<210> 17
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 17
Leu Leu Phe Pro Ala Ile Tyr Leu Ala Asp Ser Ala Gln Ala
1 5 10
<210> 18
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 18
Ala Val Leu Asp Leu Thr Thr Pro Gln Ala Arg Glu Ala Val
1 5 10
<210> 19
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 19
Lys Met Leu Glu Ala Ala Tyr Arg Leu His Thr Ile Asp Val
1 5 10
<210> 20
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 20
Thr Ala Tyr Glu Gln Arg Thr Arg Pro Gly Gln Leu Gln Leu
1 5 10
<210> 21
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 21
Gly Arg Trp Asn Pro Pro Leu Leu Phe Pro Ala Ile Tyr Leu
1 5 10
<210> 22
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 22
Arg Glu Leu Ala Tyr Ser Val Glu Thr Thr Ala Glu Ser Leu
1 5 10
<210> 23
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 23
Val Ser Trp Thr Arg Ser Ala Leu Ser Asp Leu Pro Arg Trp
1 5 10
<210> 24
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 24
Leu Ser Asp Leu Pro Arg Trp Arg Glu Pro Pro Gln Ile Tyr
1 5 10
<210> 25
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 25
Ser Leu Phe Phe Ala Ser Gly Gln Leu Arg Glu Leu Ala Tyr
1 5 10
<210> 26
<211> 14
<212> PRT
<213>It is artificial synthesized
<400> 26
Ala Leu Ser Asp Leu Pro Arg Trp Arg Glu Pro Pro Gln Ile
1 5 10
<210> 27
<211> 95
<212> PRT
<213> ESAT-6
<400> 27
Met Thr Glu Gln Gln Trp Asn Phe Ala Gly Ile Glu Ala Ala Ala Ser
1 5 10 15
Ala Ile Gln Gly Asn Val Thr Ser Ile His Ser Leu Leu Asp Glu Gly
20 25 30
Lys Gln Ser Leu Thr Lys Leu Ala Ala Ala Trp Gly Gly Ser Gly Ser
35 40 45
Glu Ala Tyr Gln Gly Val Gln Gln Lys Trp Asp Ala Thr Ala Thr Glu
50 55 60
Leu Asn Asn Ala Leu Gln Asn Leu Ala Arg Thr Ile Ser Glu Ala Gly
65 70 75 80
Gln Ala Met Ala Ser Thr Glu Gly Asn Val Thr Gly Met Phe Ala
85 90 95
<210> 28
<211> 100
<212> PRT
<213> CFP-10
<400> 28
Met Ala Glu Met Lys Thr Asp Ala Ala Thr Leu Ala Gln Glu Ala Gly
1 5 10 15
Asn Phe Glu Arg Ile Ser Gly Asp Leu Lys Thr Gln Ile Asp Gln Val
20 25 30
Glu Ser Thr Ala Gly Ser Leu Gln Gly Gln Trp Arg Gly Ala Ala Gly
35 40 45
Thr Ala Ala Gln Ala Ala Val Val Arg Phe Gln Glu Ala Ala Asn Lys
50 55 60
Gln Lys Gln Glu Leu Asp Glu Ile Ser Thr Asn Ile Arg Gln Ala Gly
65 70 75 80
Val Gln Tyr Ser Arg Ala Asp Glu Glu Gln Gln Gln Ala Leu Ser Ser
85 90 95
Gln Met Gly Phe
100
<210> 29
<211> 198
<212> PRT
<213> ESAT-6-CFP-10
<400> 29
Met Thr Glu Gln Gln Trp Asn Phe Ala Gly Ile Glu Ala Ala Ala Ser
1 5 10 15
Ala Ile Gln Gly Asn Val Thr Ser Ile His Ser Leu Leu Asp Glu Gly
20 25 30
Lys Gln Ser Leu Thr Lys Leu Ala Ala Ala Trp Gly Gly Ser Gly Ser
35 40 45
Glu Ala Tyr Gln Gly Val Gln Gln Lys Trp Asp Ala Thr Ala Thr Glu
50 55 60
Leu Asn Asn Ala Leu Gln Asn Leu Ala Arg Thr Ile Ser Glu Ala Gly
65 70 75 80
Gln Ala Met Ala Ser Thr Glu Gly Asn Val Thr Gly Met Phe Ala Asn
85 90 95
Val Ala Met Ala Glu Met Lys Thr Asp Ala Ala Thr Leu Ala Gln Glu
100 105 110
Ala Gly Asn Phe Glu Arg Ile Ser Gly Asp Leu Lys Thr Gln Ile Asp
115 120 125
Gln Val Glu Ser Thr Ala Gly Ser Leu Gln Gly Gln Trp Arg Gly Ala
130 135 140
Ala Gly Thr Ala Ala Gln Ala Ala Val Val Arg Phe Gln Glu Ala Ala
145 150 155 160
Asn Lys Gln Lys Gln Glu Leu Asp Glu Ile Ser Thr Asn Ile Arg Gln
165 170 175
Ala Gly Val Gln Tyr Ser Arg Ala Asp Glu Glu Gln Gln Gln Ala Leu
180 185 190
Ser Ser Gln Met Gly Phe
195
Claims (10)
1. a kind of antigen composition for being used to detect tuberculosis infection T cell, it is characterised in that the antigen composition includes ESAT-
6th, CFP-10 and wantonly eight polypeptides or wantonly eight containing amino acid sequence as shown in SEQ ID NO.1~SEQ ID NO.26
The combination of above polypeptide.
2. antigen composition as claimed in claim 1, it is characterised in that described eight polypeptides or wantonly more than eight polypeptides
Combination using and in the SEQ ID NO.1~SEQ ID NO.26 it is any shown in sequence have 85% homology polypeptide,
Or replace described ESAT-6, CFP-10 with ESAT-6-CFP-10.
3. antigen composition as claimed in claim 2, its feature exists, the amino acid sequence such as SEQ ID of the ESAT-6
Shown in NO.27, the amino acid sequence of the CFP-10 is as shown in SEQ ID NO.28, the amino acid of the ESAT-6-CFP-10
Sequence is as shown in SEQ ID NO.29.
4. a kind of kit for being used to detect tuberculosis infection T cell, it is characterised in that including as described in claim 1-3 is any
Antigen composition and detection gamma interferon reagent.
5. kit as claimed in claim 4, it is characterised in that the reagent of the detection gamma interferon includes enzyme linked immunological
Detection reagent, chemoluminescence method detection reagent, immunofluorescence detection agent.
6. the application of kit as claimed in claim 4, it is characterised in that for detecting that T cell passes through described antigen combination
The cell factor that thing is secreted after stimulating, the cell factor is gamma interferon.
7. the application of kit as claimed in claim 6, it is characterised in that the lymphocyte from peripheral blood, cerebrospinal fluid,
Hydrothorax or ascites.
8. the application of kit as claimed in claim 6, it is characterised in that ESAT-6 and CFP- described in the antigen composition
10 or described ESAT-6-CFP-10 final concentration of 4~200 μ g/mL, final concentration of 40~1000 μ g/mL of the polypeptide.
9. the application of kit as claimed in claim 6, it is characterised in that the reagent of the detection gamma interferon also includes using
Phosphate buffer makees negative control, and its testing result is designated as N；With the antigen composition as stimulated in vitro thing, it is detected
As a result it is designated as T；Make positive control with lectin and bovine serum albumin(BSA), its testing result is designated as P.
10. the application of kit as claimed in claim 9, it is characterised in that for the content of the gamma interferon, detection knot
Fruit T-N >=0.15~0.5IU/mL, judges infection mycobacterium tuberculosis；Testing result T-N 0.15~0.5IU/mL of ＜, judge not
Infect mycobacterium tuberculosis.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710197679.1A CN107144694B (en) | 2017-03-29 | 2017-03-29 | For detecting the antigen, kit and application of tuberculosis infection T cell |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710197679.1A CN107144694B (en) | 2017-03-29 | 2017-03-29 | For detecting the antigen, kit and application of tuberculosis infection T cell |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN107144694A true CN107144694A (en) | 2017-09-08 |
| CN107144694B CN107144694B (en) | 2019-06-14 |
Family
ID=59783846
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710197679.1A Active CN107144694B (en) | 2017-03-29 | 2017-03-29 | For detecting the antigen, kit and application of tuberculosis infection T cell |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107144694B (en) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107219362A (en) * | 2017-03-29 | 2017-09-29 | 武汉海吉力生物科技有限公司 | Antigen, kit and application for detecting tuberculosis infection T cell |
| CN110702918A (en) * | 2019-09-24 | 2020-01-17 | 广州迪澳医疗科技有限公司 | Kit for rapidly detecting active tuberculosis |
| WO2023078438A1 (en) * | 2021-11-08 | 2023-05-11 | 成都可恩生物科技有限公司 | Mycobacterium tuberculosis fusion protein, preparation method therefor and use thereof |
| CN117777259A (en) * | 2024-02-23 | 2024-03-29 | 上海科新生物技术股份有限公司 | Antigen composition for detecting tuberculosis infection, kit and application thereof |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104628833A (en) * | 2015-01-23 | 2015-05-20 | 中国疾病预防控制中心传染病预防控制所 | Antigen composition used for immunodetection of tuberculosis infected cell and application thereof |
| CN107011418A (en) * | 2017-03-29 | 2017-08-04 | 武汉海吉力生物科技有限公司 | Detect antigen polypeptide pond and its application of mycobacterium tuberculosis infection |
| CN107216373A (en) * | 2017-03-29 | 2017-09-29 | 武汉海吉力生物科技有限公司 | Detect antigen polypeptide pond and its application of mycobacterium tuberculosis infection |
| CN107219362A (en) * | 2017-03-29 | 2017-09-29 | 武汉海吉力生物科技有限公司 | Antigen, kit and application for detecting tuberculosis infection T cell |
-
2017
- 2017-03-29 CN CN201710197679.1A patent/CN107144694B/en active Active
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104628833A (en) * | 2015-01-23 | 2015-05-20 | 中国疾病预防控制中心传染病预防控制所 | Antigen composition used for immunodetection of tuberculosis infected cell and application thereof |
| CN107011418A (en) * | 2017-03-29 | 2017-08-04 | 武汉海吉力生物科技有限公司 | Detect antigen polypeptide pond and its application of mycobacterium tuberculosis infection |
| CN107216373A (en) * | 2017-03-29 | 2017-09-29 | 武汉海吉力生物科技有限公司 | Detect antigen polypeptide pond and its application of mycobacterium tuberculosis infection |
| CN107219362A (en) * | 2017-03-29 | 2017-09-29 | 武汉海吉力生物科技有限公司 | Antigen, kit and application for detecting tuberculosis infection T cell |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107219362A (en) * | 2017-03-29 | 2017-09-29 | 武汉海吉力生物科技有限公司 | Antigen, kit and application for detecting tuberculosis infection T cell |
| CN107219362B (en) * | 2017-03-29 | 2019-08-09 | 武汉海吉力生物科技有限公司 | For detecting the antigen, kit and application of tuberculosis infection T cell |
| CN110702918A (en) * | 2019-09-24 | 2020-01-17 | 广州迪澳医疗科技有限公司 | Kit for rapidly detecting active tuberculosis |
| WO2023078438A1 (en) * | 2021-11-08 | 2023-05-11 | 成都可恩生物科技有限公司 | Mycobacterium tuberculosis fusion protein, preparation method therefor and use thereof |
| CN117777259A (en) * | 2024-02-23 | 2024-03-29 | 上海科新生物技术股份有限公司 | Antigen composition for detecting tuberculosis infection, kit and application thereof |
| CN117777259B (en) * | 2024-02-23 | 2024-06-07 | 上海科新生物技术股份有限公司 | Antigen composition for detecting tuberculosis infection, kit and application thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CN107144694B (en) | 2019-06-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN111856027B (en) | New coronavirus antibody detection kit suitable for examination of patients without obvious symptoms | |
| CN107144694B (en) | For detecting the antigen, kit and application of tuberculosis infection T cell | |
| CN107219362B (en) | For detecting the antigen, kit and application of tuberculosis infection T cell | |
| CN102004155B (en) | Kit and method for detecting mycobacterium tuberculosis infection and application | |
| CN104628833B (en) | A kind of tuberculosis infection cellular immunization detectable antigens composition and application thereof | |
| CN104597239B (en) | Antigen stimulant and kit for detecting mycobacterium tuberculosis infection, and application of antigen stimulant | |
| CN102253204A (en) | Detection of tuberculosis and infection by mycobacterium yuberculosis using HBHA | |
| CN107011418A (en) | Detect antigen polypeptide pond and its application of mycobacterium tuberculosis infection | |
| CN107216373A (en) | Detect antigen polypeptide pond and its application of mycobacterium tuberculosis infection | |
| WO2018076404A1 (en) | Method for in vitro detection of active tuberculosis | |
| CN107219363B (en) | For detecting the antigen, kit and application of tuberculosis infection T cell | |
| CN107141341A (en) | Detect antigen polypeptide pond and the application of mycobacterium tuberculosis infection | |
| CN111044728B (en) | IgM antibody colloidal gold test strip for rapidly detecting adenovirus and preparation method thereof | |
| CN113717258B (en) | Antigen polypeptide composition for immune detection of SARS-CoV-2 infected cells, application and kit thereof | |
| CN109374886A (en) | Infectious bovine rhinotrachetis virus antibody assay kit and its application | |
| CN106053783A (en) | Quick time-resolved fluorescence immunoassay kit for detection of T cells infected with tuberculosis and detection method of kit | |
| CN107091932A (en) | Tuberculosis immunodiagnosis molecular marker and its medical usage | |
| CN106939035A (en) | A kind of mycobacterium tuberculosis T cell antigen epitope polypeptide and its application | |
| Shalit et al. | Comparison of polyclonal antiserum versus monoclonal antibodies for the rapid diagnosis of influenza A virus infections by immunofluorescence in clinical specimens | |
| Sampaio et al. | Measles, rubella, mumps and Toxoplasma gondii antibodies in saliva of vaccinated students of schools and universities in São Paulo City, Brazil | |
| CN104628834B (en) | A kind of tuberculosis infection T cell immunodetection antigen and application thereof | |
| CN114671928A (en) | Application of mycobacterium tuberculosis T cell epitope protein Rv1566c-444 | |
| CN110498844B (en) | Peste des petits ruminants diagnostic kit | |
| CN105759054A (en) | ELISPOT detection kit for detecting bovine brucellosis | |
| CN108318681A (en) | A kind of detection kit and its detection method of library wave fever virus |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant |